https://avgeeks.videonest.co/videos/349120/why-fathers-work-1969 https://img.videonest.org/gamma/349120_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349120/why-fathers-work-1969 Why Fathers Work (1969) The film follows Ed Kimble, a structural iron worker, as he begins his day and heads to work on a skyscraper construction site. It highlights the importance of work in a community, showcasing the various skilled workers involved in building the skyscraper and their contributions. Ed's job not only provides for his family but also gives him a sense of pride and achievement. The narrative emphasizes that every worker plays a vital role in maintaining the city's functionality and growth, illustrating the interconnectedness of different jobs in meeting community needs. Keywords Ed Kimble, structural iron worker, skyscraper construction, community, skilled workers, pride, achievement, importance of work, family, city growth 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 802 https://avgeeks.videonest.co/videos/349121/siqueiros-el-maestro-march-of-humanity-latin-america-1969 https://img.videonest.org/gamma/349121_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349121/siqueiros-el-maestro-march-of-humanity-latin-america-1969 Siqueiros El Maestro: March Of Humanity - Latin America (1969) The film explores the life and work of David Alfaro Siqueiros, a prominent Mexican muralist known for his monumental mural "The March of Humanity." It highlights Siqueiros's artistic philosophy, which emphasizes the importance of mural painting as a public art form that reflects social change and the struggles of the Mexican people. The documentary details his creative process, including the use of synthetic paints and large-scale models, and his collaboration with students and assistants. Siqueiros believes in the unity of sculpture and painting, aiming to create a deeper emotional expression through his art. The film also emphasizes his commitment to continuously improving his work until the very end. Keywords David Alfaro Siqueiros, muralist, March of Humanity, Mexican art, social change, public art, synthetic paints, sculpture, painting, cultural movement 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 820 https://avgeeks.videonest.co/videos/349122/muscle-electrical-activity-of-contraction-1969 https://img.videonest.org/gamma/349122_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349122/muscle-electrical-activity-of-contraction-1969 Muscle: Electrical Activity Of Contraction (1969) The film "Muscle: Electrical Activity of Contraction" (1969) explores how muscle contractions are initiated by nerve impulses. It demonstrates the relationship between electrical stimulation of muscle fibers and their contraction using specialized laboratory equipment. The film highlights the concept of action potential, showing that a muscle fiber either fully contracts or not at all, and illustrates how electrical activity precedes mechanical contraction. It emphasizes the importance of nerve stimulation in controlling muscle strength and movement. Keywords muscle contraction, nerve impulses, electrical stimulation, action potential, muscle fibers, oscilloscope, mechanical contraction, muscle strength 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 520 https://avgeeks.videonest.co/videos/349123/ears-and-hearing-2nd-ed-1969 https://img.videonest.org/gamma/349123_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349123/ears-and-hearing-2nd-ed-1969 Ears And Hearing (2nd Ed, 1969) The film "Ears and Hearing" (1969) provides an in-depth explanation of the human ear's anatomy and the mechanics of hearing. It describes how sound waves are collected by the outer ear, transmitted through the auditory canal to the eardrum, and then amplified by the small bones in the middle ear. The film further explores the conversion of mechanical energy into electrochemical signals in the inner ear, detailing the role of the cochlea and the auditory nerve in processing sound. It also addresses hearing impairments, distinguishing between sensory and conductive deafness, and outlines treatment options, including surgery and hearing aids. Keywords human ear, anatomy, hearing mechanics, sound waves, eardrum, middle ear, inner ear, cochlea, auditory nerve, sensory deafness, conductive deafness, treatment options, surgery, hearing aids 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 1305 https://avgeeks.videonest.co/videos/349124/american-flag-the-story-of-old-glory-rev-ed-1969 https://img.videonest.org/gamma/349124_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349124/american-flag-the-story-of-old-glory-rev-ed-1969 American Flag: The Story Of Old Glory (Rev Ed, 1969) The film explores the history of the American flag, detailing its evolution from foreign flags brought by explorers to the establishment of a unique national symbol. It highlights significant events such as the signing of the Declaration of Independence, the creation of the first official flag in 1777, and the flag's role during key moments like the War of 1812 and the Civil War. The narrative emphasizes the flag's representation of independence, unity, and democratic rights, culminating in its status as a cherished symbol for all Americans. Keywords American flag, history, independence, unity, democratic rights, Betsy Ross, Declaration of Independence, War of 1812, Civil War, symbol 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 800 https://avgeeks.videonest.co/videos/349125/muscle-chemistry-of-contraction-1969 https://img.videonest.org/gamma/349125_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349125/muscle-chemistry-of-contraction-1969 Muscle: Chemistry Of Contraction (1969) *Muscle: Chemistry of Contraction* (1969) is an **educational science film** produced by **Encyclopedia Britannica Educational Corporation (EBEC)**. The film explores the **internal structure of muscles**, using **models and visual demonstrations** to explain the **process of muscle contraction**. It presents the **scientific challenge of understanding the chemical reactions behind muscle movement**, introducing the **sliding rod theory** as a key explanation. The film also examines the role of **actin, myosin, and adenosine triphosphate (ATP)** in controlling muscle activity, providing a **detailed look at the biochemistry of movement**. Designed as a **resource for biology and physiology education**, the film helps students understand the **complex interactions between molecular components in muscular function**. 2025-03-23T06:10:25.388Z yes A/V Geeks 16mm Films no 908 https://avgeeks.videonest.co/videos/349126/problems-of-conservation-soil-1969 https://img.videonest.org/gamma/349126_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349126/problems-of-conservation-soil-1969 Problems Of Conservation: Soil (1969) The film discusses the critical importance of soil conservation for agriculture and the environment, highlighting the historical transition from a farming-based economy to urbanization. It explains the formation of soil, the dangers of erosion caused by water and wind, and the depletion of soil nutrients due to agricultural practices. The film emphasizes the need for effective soil conservation techniques, such as contour plowing, crop rotation, and the establishment of conservation districts, to maintain soil health and productivity. It calls for increased awareness and better land use planning to support a growing population while preserving vital soil resources. Keywords soil conservation, agriculture, erosion, urbanization, nutrient depletion, contour plowing, land use planning, environmental awareness, conservation practices 2025-03-23T06:10:25.391Z yes A/V Geeks 16mm Films no 822 https://avgeeks.videonest.co/videos/349127/av-geeks-16mm-lunch-3-21-2025 https://img.videonest.org/gamma/349127_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/349127/av-geeks-16mm-lunch-3-21-2025 AV Geeks 16mm Lunch 3-21-2025 Is it possible to watch old 16mm films outside on a patio during the day? Let's find out! #16mmfilms #avgeeks NARA 306-lss-32 (silent) Zoo Animals in the Wild : Beavers Fiberglass Pole Vault "Lifesaving And Water Safety - Removal From The Water" The Weekend 2025-03-23T06:10:25.486Z yes A/V Geeks 16mm Films no 4066 https://avgeeks.videonest.co/videos/355334/model-cities-library-albuquerque-silent-1971 https://img.videonest.org/gamma/355334_thumbnail_resized_v2.webp https://gamma.videonest.org/355334_video_v3.mp4 [Model Cities Library, Albuquerque, silent, 1971] Raw footage of a bookmobile and libraries in Albuquerque. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 346 Model Cities LibrarybookmobilechildrenreadingbooksAlbuquerqueNew Mexicochildren's literacycommunity outreach programlibrary servicesarchive footageeducational program https://avgeeks.videonest.co/videos/355335/how-to-build-a-better-golf-swing-part-1-1975 https://img.videonest.org/gamma/355335_thumbnail_resized_v2.webp https://gamma.videonest.org/355335_video_v3.mp4 How To Build A Better Golf Swing, Part 1 (1975) This instructional video focuses on developing a better golf swing by breaking down its components into manageable parts. It emphasizes the importance of body movement, rhythm, and the concept of coiling and uncoiling to generate power. Key elements include maintaining a steady center, following a consistent swing plane, achieving an adequate arc, and utilizing centrifugal force for maximum club head speed. The video provides exercises to help golfers internalize these principles, ultimately leading to a more effective and natural swing. Keywords golf swing, power flow, rhythm, steady center, swing plane, arc, centrifugal force, exercises, muscle memory 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 966 golf swinggolfbody mechanicscoilinguncoilingsportsrhythmgolf instructionfitnesstechniqueswing tipsgolf tipssports training https://avgeeks.videonest.co/videos/355336/thailand-land-of-smiles-1973 https://img.videonest.org/gamma/355336_thumbnail_resized_v2.webp https://gamma.videonest.org/355336_video_v3.mp4 Thailand: Land Of Smiles (1973) The film explores Thailand's rich cultural heritage, particularly focusing on Buddhism and its tranquil influence on the Thai people. It highlights the significance of temples, which serve as centers of worship, learning, and meditation. The film also showcases traditional Thai dance and music, emphasizing the discipline and dedication of performers. Additionally, it touches on the agricultural practices in Chiang Mai, the importance of rice cultivation, and the role of elephants in logging. The serene lifestyle of the Thai people, their rich traditions, and the beauty of their landscapes are depicted throughout, culminating in the celebration of festivals such as Loi Krathong. Keywords Thailand, Buddhism, temples, dance, culture, agriculture, rice, elephants, festivals, tranquility 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1690 https://avgeeks.videonest.co/videos/355337/hour-of-decision-episode-8-in-the-beginning-1950s https://img.videonest.org/gamma/355337_thumbnail_resized_v2.webp https://gamma.videonest.org/355337_video_v3.mp4 Hour Of Decision - Episode 8 - In The Beginning (1950s) Billy Graham! The film features a sermon discussing the concept of sacrifice, particularly focusing on the ultimate sacrifice made by Jesus Christ on the cross for humanity's sins. It reflects on biblical themes, starting from the Garden of Eden, and emphasizes the consequences of disobedience to God. The speaker shares personal anecdotes, including a story about a soldier who saved his grandfather during the Battle of Gettysburg, to illustrate the importance of sacrifice. The message encourages viewers to accept Christ for peace and salvation, highlighting the hope of eternal life. Keywords sacrifice, Jesus Christ, Garden of Eden, sin, salvation, Gettysburg, sermon, faith, peace, eternal life Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 857 Billy GrahamHour of DecisionChristianityReligionGreatest SacrificeCliff BarrowsGeorge Beverly SheaTed SmithPaul MickelsonInterviewTelevangelistSpiritualFaithGospelEvangelism https://avgeeks.videonest.co/videos/355338/the-weekend-1970 https://img.videonest.org/gamma/355338_thumbnail_resized_v2.webp https://gamma.videonest.org/355338_video_v3.mp4 The Weekend (1970) The film "The Weekend" explores the strained relationship of a married couple during a weekend getaway. Through their dialogue, they confront feelings of dissatisfaction, love, and the challenges of marriage, revealing underlying tensions and the complexities of their connection. The couple grapples with questions about their happiness, love, and the possibility of divorce, all while navigating their roles as parents. Keywords marriage, relationship, couple, weekend getaway, dissatisfaction, love, divorce, communication, family, emotional struggle 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 933 Penny KunardAndy Corbin1970sDramaMovieHotel RoomPacking SuitcasesThe Weekend https://avgeeks.videonest.co/videos/355339/navy-new-recruits-1930s https://img.videonest.org/gamma/355339_thumbnail_resized_v2.webp https://gamma.videonest.org/355339_video_v3.mp4 [Navy new recruits, 1930s?] The film provides an overview of the training process for new recruits in the United States Navy. It highlights the rigorous entrance examinations, the importance of physical health, and the various aspects of naval discipline. Recruits undergo military training, receive essential uniforms and gear, learn to sleep in hammocks, and participate in infantry drills to foster teamwork and obedience. The film also emphasizes the significance of proper nutrition, recreational activities, and swimming lessons, ensuring that recruits are well-prepared for life at sea while addressing their spiritual needs through the support of a chaplain. NOTE: the leader says this film is "Cowboy Holiday" and it is not that film. Keywords Navy, recruits, training, military discipline, physical health, teamwork, uniforms, swimming lessons, nutrition, chaplain support Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 427 US NavyNaval Training Stationrecruitsmedical examshaircutshammock trainingNavy lifemilitary trainingboot campinductionnew recruitsbasic training https://avgeeks.videonest.co/videos/355340/language-of-maps-1964 https://img.videonest.org/gamma/355340_thumbnail_resized_v2.webp https://gamma.videonest.org/355340_video_v3.mp4 Language Of Maps (1964) The film explains how maps utilize symbols and colors to represent various geographical features and man-made structures. It discusses the importance of understanding these symbols for navigation and orientation, highlighting concepts such as contour lines, scale, and legends. The viewer learns how maps can convey information about elevation, water depth, and even climatic conditions, emphasizing the intricate relationship between maps and the natural world. Keywords maps, symbols, contour lines, scale, orientation, geographical features, navigation, legends, elevation, water depth, climate 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 592 map readinggeographic featuresaerial viewmap symbolsmap scaleriverlakeairportcoastlinedamcartographyeducationgeographymap skillsspatial analysis https://avgeeks.videonest.co/videos/355341/the-calendar-1963 https://img.videonest.org/gamma/355341_thumbnail_resized_v2.webp https://gamma.videonest.org/355341_video_v3.mp4 The Calendar (1963) The film explores the concept of time and calendars, explaining how early humans measured time using the sun and moon. It discusses the transition from observing natural cycles to creating calendars for tracking days, months, and years. The film highlights the significance of calendars in planning events, remembering important dates, and their role in agriculture and daily life. Keywords time, calendars, measurement, early humans, sun, moon, seasons, planning, events, agriculture, history 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 619 timecalendarclockbirthdaysholidaysmeasurementSan Jose State CollegeEncyclopaedia Britannica Filmsmeasure time https://avgeeks.videonest.co/videos/355342/living-things-are-everywhere-1963 https://img.videonest.org/gamma/355342_thumbnail_resized_v2.webp https://gamma.videonest.org/355342_video_v3.mp4 Living Things Are Everywhere (1963) The film explores the abundance of living organisms in various environments, highlighting that life exists in unexpected places. It emphasizes the diversity of living things, from plants and animals in water to those on land and in the air, showcasing how life can thrive in numerous settings. Keywords living things, biodiversity, nature, ecosystems, unexpected places, plants, animals, water, land, air 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 584 Lake Michiganwildlifefishingboyexplorationnatureanimalsoutdoorsadventuredocumentaryeducationalnatural worldboy's adventure https://avgeeks.videonest.co/videos/355343/amphibian-embryo-1963 https://img.videonest.org/gamma/355343_thumbnail_resized_v2.webp https://gamma.videonest.org/355343_video_v3.mp4 Amphibian Embryo (1963) The film explores the reproductive cycles and embryonic development of amphibians, specifically frogs and salamanders. It details the processes of fertilization, egg development, and the stages of embryogenesis, including cleavage, gastrulation, and the formation of organs. Time-lapse photography is used to illustrate the rapid changes during development, highlighting differences and similarities between toads and salamanders. The film concludes with the transition of larvae to adult forms and their eventual return to water for reproduction. Keywords amphibians, reproduction, fertilization, embryonic development, frogs, salamanders, time-lapse photography, cleavage, gastrulation, larvae, adult transition 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 938 Amphibian EmbryoFrog ReproductionSalamander ReproductionFertilizationEggsDevelopmentAmphibiansFrogsSalamandersAnimal LifeBiologyZoologyScienceEducationAnimal Development https://avgeeks.videonest.co/videos/355344/your-food-1964 https://img.videonest.org/gamma/355344_thumbnail_resized_v2.webp https://gamma.videonest.org/355344_video_v3.mp4 Your Food (1964) In this educational film, Rob eagerly anticipates a fishing trip with Uncle Mac, where he catches a large fish. Inspired, he decides to surprise his mother by preparing a dinner that includes not only the fish but also his favorite raspberries and a variety of other foods. Throughout the preparation, Uncle Mac explains the importance of fuel for both motors and the human body, highlighting how different foods provide essential nutrients for various cells. Rob learns to choose a balanced meal that includes proteins, vitamins, and minerals, ultimately creating a nutritious dinner for his family, topped off with a dessert of fresh raspberries. Keywords fishing, family, nutrition, cooking, proteins, vitamins, minerals, meal planning, education 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 416 familyfishingberry pickingfamily dinnerUncle MacRoboutdoor activitiessummervacationfunmemoriesrelativesfoodnaturelake https://avgeeks.videonest.co/videos/355345/your-sleep-and-rest-1964 https://img.videonest.org/gamma/355345_thumbnail_resized_v2.webp https://gamma.videonest.org/355345_video_v3.mp4 Your Sleep And Rest (1964) In this film, Kathy and Rob embark on a camping trip where they learn about the importance of rest and energy. Rob has various activities throughout the day, including collecting firewood and helping set up the campsite, which makes him feel tired. The film explains how energy is utilized in the body, the role of blood in delivering fuel and oxygen to cells, and how rest aids in recovery and growth. It emphasizes the need for good bedtime habits and the differences in sleep requirements between children and adults. Keywords camping, energy, rest, blood circulation, sleep, children, bedtime habits, outdoor activities 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 364 Family vacationCamping tripBeachCampfireHikingExploringFirewoodFamilyNatureOutdoorsTravelAdventure https://avgeeks.videonest.co/videos/355346/railroad-builders-1963 https://img.videonest.org/gamma/355346_thumbnail_resized_v2.webp https://gamma.videonest.org/355346_video_v3.mp4 Railroad Builders (1963) In the 1850s, the American West lacked efficient transportation, hindering development. To address this, a transcontinental railroad was proposed, with various routes surveyed. The Civil War allowed for the approval of a central route, leading to the formation of the Union Pacific and Central Pacific railroads. Despite initial challenges, including conflicts with Native Americans and financial skepticism, construction progressed rapidly with the help of immigrant labor. The two railroads met at Promontory Point, Utah, on May 10, 1869, marking a significant milestone in uniting the nation and facilitating westward expansion, transforming the frontier into populated areas by 1890. Keywords transcontinental railroad, American West, 1850s, Union Pacific, Central Pacific, construction, immigrants, Promontory Point, development, Civil War 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 826 Transcontinental RailroadAmerican West1850sRailroad Builderswestward expansionOregonCaliforniaRail networkConstruction19th Century AmericaPioneerExpansionHistory DocumentaryDocumentary FilmRailroad History https://avgeeks.videonest.co/videos/355347/electricity-and-how-its-made-1964 https://img.videonest.org/gamma/355347_thumbnail_resized_v2.webp https://gamma.videonest.org/355347_video_v3.mp4 Electricity And How It's Made (1964) The film explores the concept of electricity, demonstrating how it can be generated through simple experiments such as rubbing different materials together. It explains the basics of electric currents, the role of batteries, and how electromagnets work. The film also discusses how electricity can be harnessed to power motors and generators, emphasizing its importance in everyday life and technology. Keywords electricity, lightning, experiments, electric current, batteries, electromagnets, motors, generators, science education 2025-03-23T00:00:00.000Z yes A/V Geeks 16mm Films no 881 static electricitylightningelectricityexperimentdry cellsgalvanometerphysicsscienceeducational https://avgeeks.videonest.co/videos/356363/the-discus-1959 https://img.videonest.org/gamma/356363_thumbnail_resized_v2.webp https://gamma.videonest.org/356363_video_v3.mp4 The Discus (1959) The discus throw requires a comprehensive understanding of its principles, emphasizing the importance of twist, torque, and centrifugal force. Athletes must develop a systematic approach to improve their technique, focusing on achieving a key position and momentum during the throw. Proper footwork and body alignment are crucial for maximizing power in the unwinding motion. Beginners should start with basic drills to establish comfort and rhythm before progressing to full throws, while coaches should emphasize relaxation and the rotary nature of the event to prevent tension and improve performance. Keywords discus throw, technique, twist, torque, centrifugal force, momentum, footwork, beginners, coaching, rhythm Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 795 Discus ThrowTrack and FieldYale UniversityYale Athletic AssociationTechnique AnalysisCentrifugal ForceTorqueTwistSports TrainingAthletic PerformanceInstructional VideoHow ToSports ScienceCompetitionField Events https://avgeeks.videonest.co/videos/357383/to-be-growing-older-1973 https://img.videonest.org/gamma/357383_thumbnail_resized_v2.webp https://gamma.videonest.org/357383_video_v3.mp4 To Be Growing Older (1973) The film features a reflective monologue by a 90-year-old woman discussing the challenges of aging and living alone. She expresses the difficulties of maintaining a household, the loneliness of not having visitors, and the importance of family connections. The woman shares her thoughts on aging gracefully, the need for social engagement, and how staying active can combat feelings of oldness. She emphasizes the wisdom of older generations and the value of intergenerational relationships, while also touching on the emotional struggles of those in nursing homes. Keywords aging, loneliness, family, wisdom, nursing home, social engagement, intergenerational relationships, active lifestyle, emotional struggles 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 885 Nursing HomeElderly CareSenior ActivitiesAgingMahjongShuffleboardElderly LifeSenior CitizensRetirementSocial InteractionHealthWell-beingDocumentary FilmCaregivingActivities for Seniors https://avgeeks.videonest.co/videos/357384/fiberglass-pole-vault-1965 https://img.videonest.org/gamma/357384_thumbnail_resized_v2.webp https://gamma.videonest.org/357384_video_v3.mp4 Fiberglass Pole Vault (1965) The film discusses the revolutionary impact of the fiberglass pole in pole vaulting, highlighting its ability to improve performance through efficient energy conversion. It explains how the extreme bending of the pole allows athletes to store and utilize kinetic energy more effectively, leading to higher vaults. The film emphasizes the importance of technique, including the takeoff process and arm positioning, in maximizing the potential of the fiberglass pole. It notes that while the transition to fiberglass may initially be challenging for some athletes, mastering the new techniques is essential for success. Keywords fiberglass pole, pole vaulting, performance improvement, energy conversion, takeoff technique, athlete training, bending mechanics, kinetic energy, potential energy 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 827 Pole VaultingFiberglass PoleTrack and FieldAthletic PerformanceKinetic EnergyPotential EnergyAthletic TrainingSportsInstructional VideoTechniqueMastering https://avgeeks.videonest.co/videos/357385/tiros-experimental-weather-satellite-1960 https://img.videonest.org/gamma/357385_thumbnail_resized_v2.webp https://gamma.videonest.org/357385_video_v3_360.mp4 TIROS Experimental Weather Satellite (1960) The film discusses the development and significance of the TIROS (Television and Infrared Observation Satellite) project, which began in 1958 under NASA. It highlights the need for improved weather prediction tools, showcasing how satellites can gather crucial meteorological data from space. The film details the satellite's design, launch, and operational capabilities, emphasizing its role in monitoring cloud formations and atmospheric conditions. TIROS represents a significant advancement in meteorology, aiming to enhance weather forecasting and provide valuable information for disaster preparedness. Keywords TIROS, weather satellite, NASA, meteorology, cloud monitoring, space technology, atmospheric data, weather prediction, satellite launch, technology advancement Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 832 TIROS Satelliteweather satelliteNASARCAweather forecastinginfrared observationsatellite technology19581959space explorationmeteorologysciencetechnologycold war https://avgeeks.videonest.co/videos/357386/av-geeks-16mm-lunch-3-24-2025 https://img.videonest.org/gamma/357386_thumbnail_resized_v2.webp https://gamma.videonest.org/357386_video_v3_360.mp4 AV Geeks 16mm Lunch 3-24-2025 I dunno what's going on with OBS and Restream today #avgeeks #16mmfilms 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 3328 https://avgeeks.videonest.co/videos/357387/av-geeks-16mm-lunch-3-24-2025 https://img.videonest.org/gamma/357387_thumbnail_resized_v2.webp https://gamma.videonest.org/357387_video_v3_360.mp4 AV Geeks 16mm Lunch 3-24-2025 I dunno what's going on with OBS and Restream today #avgeeks #16mmfilms 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 420 16mm filmdigital conversionstreaming issuesexternal drivetechnical difficultiescomputer troubleshootingLasergraphicsfilm scanningvideo editingdata transferarchivepost-productionworkflowfile managementmedia https://avgeeks.videonest.co/videos/358678/music-studio-harry-partch-1958 https://img.videonest.org/gamma/358678_thumbnail_resized_v2.webp https://gamma.videonest.org/358678_video_v3_360.mp4 Music Studio : Harry Partch (1958) The film features composer Harry Partch discussing his unique musical philosophy and the unconventional instruments he creates and plays. He emphasizes the integration of music with other art forms, particularly film, to create a unified sensory experience. Partch's exploration of alternative musical scales and his innovative instruments highlight his commitment to expanding the boundaries of traditional music. Keywords Harry Partch, music philosophy, unique instruments, alternative scales, film, art integration, composer, musical carpentry Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1079 Harry Partch43-tone scaleExperimental MusicMusical InstrumentsMusic StudioDocumentaryChicagoRecordMusicAmerican ComposerAvant-Garde MusicMicrotonal Music20th Century MusicIntonationMusical Innovation https://avgeeks.videonest.co/videos/358679/haunted-palace-silent-raw-footage-1970s https://img.videonest.org/gamma/358679_thumbnail_resized_v2.webp https://gamma.videonest.org/358679_video_v3_converted.mp4 [Haunted Palace, silent raw footage, 1970s] silent raw footage of a camera crew shooting a narrative film. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1141 FilmmakingMovie ProductionBehind the scenesCamera setupLightingFilmingRehearsal https://avgeeks.videonest.co/videos/358680/dont-be-afraid-1971 https://img.videonest.org/gamma/358680_thumbnail_resized_v2.webp https://gamma.videonest.org/358680_video_v3_converted.mp4 Don't Be Afraid (1971) The film "Don't Be Afraid" from 1971 addresses the struggles of youth in finding their identity and place in the world. It emphasizes the importance of communication and understanding between generations, urging adults to listen to and engage with young people. The film advocates for a church community that fosters genuine relationships and participation, encouraging youth to explore real issues and share their experiences. It promotes a message of love, acceptance, and the need to live life fully without fear. Keywords youth, identity, communication, church, community, love, acceptance, fear, participation, generational understanding 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1149 familylife70sConcordia FilmsyouthChronicleDocumentarySocial Commentary https://avgeeks.videonest.co/videos/358681/fire-drill-1982 https://img.videonest.org/gamma/358681_thumbnail_resized_v2.webp https://gamma.videonest.org/358681_video_v3_converted.mp4 Fire Drill (1982) The film focuses on the importance of fire drills in schools, demonstrating how students learn to react during a fire emergency. It outlines procedures for evacuating the building, including using alternate routes if the primary exit is blocked. The students practice staying low to avoid smoke inhalation and emphasize the need to report any signs of fire. The film concludes with a successful fire drill, highlighting the effectiveness of their training and preparedness. Keywords fire drills, school safety, emergency procedures, evacuation routes, smoke inhalation, fire reporting, preparedness 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 998 fire drillelementary schoolevacuationsafetyschool childrenemergencysafety proceduresschool safetyfire safetydisaster preparednesschild safety https://avgeeks.videonest.co/videos/358682/spain-rediscovered-1966 https://img.videonest.org/gamma/358682_thumbnail_resized_v2.webp https://gamma.videonest.org/358682_video_v3.mp4 Spain Rediscovered (1966) The film "Spain Rediscovered" explores the historical journey of Spain, highlighting its rich cultural heritage shaped by various invasions and influences over centuries. It chronicles the transformation from a land of invasions to a modern nation, showcasing the impact of tourism and economic changes on Spanish society. The narrative reflects on Spain's glorious past, including the unification under Catholic Monarchs Isabella and Ferdinand, and the subsequent golden age of exploration and conquest. Despite historical challenges, the film portrays a hopeful Spain that is evolving, embracing modernity while cherishing its traditions and artistic legacy. Keywords Spain, history, invasions, culture, tourism, economic change, Isabella, Ferdinand, golden age, modernity, traditions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 985 AlhambraMoorish fortressSpainIberiaSpanish HistoryRoman aqueductCarthaginiansVisigothsMediterranean SeaEuropean HistoryTravel DocumentaryHistorical SitesArchitectureAncient History https://avgeeks.videonest.co/videos/358683/how-to-build-a-golf-swing-part-2-1975 https://img.videonest.org/gamma/358683_thumbnail_resized_v2.webp https://gamma.videonest.org/358683_video_v3_converted.mp4 How To Build A Golf Swing, Part 2 (1975) The film tutorial focuses on developing a consistent golf swing by emphasizing the importance of muscle memory, grip positioning, and swing mechanics. It explains how to achieve proper hand placement on the club, the significance of maintaining a square club face at impact, and the correct distance from the ball. The tutorial encourages practicing with half swings to build control and gradually increasing to full swings while maintaining good fundamentals. It highlights the dynamics of golf and the need for a routine to enhance performance during play. Keywords golf swing, muscle memory, grip positioning, impact, club face, distance, practice, fundamentals, routine, dynamics 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 988 golf swinggolfswingNational Golf Foundationbuild swinggolf instructionimprove swinggolf tipssportshow totutorialgolf lesson https://avgeeks.videonest.co/videos/358684/lifesaving-and-water-safety-removal-from-the-water-1974 https://img.videonest.org/gamma/358684_thumbnail_resized_v2.webp https://gamma.videonest.org/358684_video_v3_converted.mp4 Lifesaving And Water Safety: Removal From The Water (1974) The film focuses on essential techniques for safely removing victims from water during emergencies. It emphasizes the importance of artificial respiration and the need for careful handling of potential spinal injuries. Various removal techniques are demonstrated, including using a rigid support and different carries, while stressing the priority of breathing assistance over extraction from the water. Keywords lifesaving, water safety, artificial respiration, spinal injury, rescue techniques, victim removal, emergency response 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 372 American Red Crosswater safetylifesavingCPRrescuefirst aidemergency responsewater rescuelifeguarddrowning preventionsurvival skillspublic safety trainingsafety tipsemergency preparednessaccident prevention https://avgeeks.videonest.co/videos/358685/two-indians-red-reflections-of-life-1973 https://img.videonest.org/gamma/358685_thumbnail_resized_v2.webp https://gamma.videonest.org/358685_video_v3_converted.mp4 Two Indians : Red Reflections Of Life (1973) "Two Indians: Red Reflections of Life" explores the experiences and perspectives of Native American youth as they navigate their cultural identity and modern life. The film highlights their connection to traditional practices, such as music and dance, while discussing the challenges they face in balancing their heritage with contemporary society. It emphasizes the importance of education, community, and personal involvement in shaping their future, as well as the generational divide in perspectives on cultural preservation and adaptation. Keywords Native American, youth, cultural identity, music, dance, education, community, heritage, generational divide, traditional practices 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1569 https://avgeeks.videonest.co/videos/358686/the-talking-car-1953 https://img.videonest.org/gamma/358686_thumbnail_resized_v2.webp https://gamma.videonest.org/358686_video_v3_converted.mp4 The Talking Car (1953) In "The Talking Car," two children, Jack and Mary, engage in a conversation with a talking car named Rags, who emphasizes the importance of traffic safety. Rags shares insights about traffic signals, pedestrian safety, and the need for vigilance around vehicles. The children recall their safety lessons from school and discuss various safety measures, such as using crosswalks, being careful after school, and the dangers of running into the street. The film aims to educate young viewers on safe practices to follow while navigating traffic. Keywords talking car, traffic safety, children, education, pedestrian rules, safety measures, crosswalks, vigilance, school lessons, Rags Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 813 Talking CarcartoonAnimationComedyClassicShort Filmstraffic safetyJackMarydogAlfred HigginsFrederick K Rockett Co https://avgeeks.videonest.co/videos/358687/the-color-of-man-1955 https://img.videonest.org/gamma/358687_thumbnail_resized_v2.webp https://gamma.videonest.org/358687_video_v3_converted.mp4 The Color Of Man (1955) The film explores the genetic basis of skin color, attributing variations primarily to melanin levels, which are influenced by ultraviolet radiation from the sun. It discusses how different environments have shaped human skin tones over thousands of years, with darker skin providing advantages in high UV areas and lighter skin being beneficial in low UV regions. The film highlights the adaptability of humans to their environments and emphasizes that despite these differences, people are more alike genetically than they may appear. It concludes by advocating for a greater understanding of our shared humanity. Keywords skin color, melanin, ultraviolet radiation, genetics, adaptation, environment, survival, human differences, hereditary traits Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-24T00:00:00.000Z yes A/V Geeks 16mm Films no 587 MelaninSkin ColorHuman BiologyRobert Carl CohenGershon KingsleyRobert DoubledayUniversity of CaliforniaDocumentary FilmScience EducationBiology DocumentaryHuman AnatomyGeneticsPigmentation https://avgeeks.videonest.co/videos/360007/the-changing-face-of-eastern-europe-1969 https://img.videonest.org/gamma/360007_thumbnail_resized_v2.webp https://gamma.videonest.org/360007_video_v3.mp4 The Changing Face Of Eastern Europe (1969) The film "The Changing Face of Eastern Europe" explores the evolution of Eastern European nations under Soviet influence post-World War II. It details the transition from strict Soviet control to a period of limited liberalization, highlighting events such as the establishment of the Warsaw Pact, the rise of nationalism, and attempts at reform in countries like Czechoslovakia and Romania. The film also discusses the impact of Western culture and economics on these nations, the complexities of peaceful coexistence, and the persistent threat of Soviet intervention. Keywords Eastern Europe, Soviet Union, communism, Warsaw Pact, liberalization, nationalism, Cold War, reform, peaceful coexistence, Iron Curtain 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 902 World War IISoviet UnionEastern EuropeKodakScreen News Digestphotographyrare footagehistorical documentarydocumentary filmSoviet propagandaEastern European Historynewsreel https://avgeeks.videonest.co/videos/360008/young-fathers-teenage-love-1980s https://img.videonest.org/gamma/360008_thumbnail_resized_v2.webp https://gamma.videonest.org/360008_video_v3.mp4 Young Fathers - Teenage Love (1980s) The film discusses the rising rates of teenage pregnancy in the U.S. and highlights the often-overlooked struggles of teenage fathers. It features personal stories of young fathers like Chick and Charles, who became parents at 17 and 16, respectively. They express the challenges of balancing work, school, and parenting while also navigating their relationships with the mothers of their children. The film emphasizes the need for support systems for teenage fathers, who often feel scared and unprepared, and showcases their determination to stay involved in their children's lives despite the difficulties they face. Keywords teenage pregnancy, teenage fathers, parenting, support systems, relationships, challenges, personal stories, responsibility, family dynamics Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 788 Teenage PregnancyTeenage FathersParentingUnited StatesPrenatal ClassesYouth SupportSalt Lake CityRebecca Sobel https://avgeeks.videonest.co/videos/360009/dairy-products-from-moo-to-you-1975 https://img.videonest.org/gamma/360009_thumbnail_resized_v2.webp https://gamma.videonest.org/360009_video_v3.mp4 Dairy Products - From Moo To You (1975) The film explores the importance of dairy products, highlighting their nutritional value and role in a balanced diet. It details the dairy farming process, from milking cows to processing milk into various products like cheese, butter, and ice cream. The film emphasizes the significance of dairy farming in the U.S., particularly in states like Wisconsin, and explains the different types of dairy cattle and their contributions. It also covers the processing methods used to ensure the quality and safety of dairy products. Keywords dairy products, nutrition, milk, cheese, butter, ice cream, dairy farming, processing, health, Wisconsin 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 788 Dairy FarmDairy CattleMilk ProductionHolsteinsDairy ProductsWisconsinFood GroupBalanced Diet https://avgeeks.videonest.co/videos/360010/toddlers-hours-of-hazard-1965 https://img.videonest.org/gamma/360010_thumbnail_resized_v2.webp https://gamma.videonest.org/360010_video_v3.mp4 Toddler's Hours Of Hazard (1965) The film highlights the dangers of home accidents among toddlers, particularly between the ages of 1 to 5, emphasizing that many of these incidents can be prevented. It follows the story of a 2-year-old named Richard, who becomes a victim of a home accident due to a chaotic family environment and lack of supervision. Expert Dr. Robert J. Hagerty shares findings from a study that identifies key risk factors, including hunger, fatigue, and the need for constant supervision. The film stresses the importance of parental awareness and creating a safe home environment to prevent such accidents. Keywords toddlers, home accidents, prevention, parental supervision, safety, children, Dr. Robert J. Hagerty, chaos, risk factors 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 795 child safetyaccident preventionhome accidentstoddler injurieschildhood accidentschildren's safetyhome safetyinjury preventionsafety tipschild healthpublic safetyhealth and safetyaccident prevention tipstoddler safetychildren's hospital https://avgeeks.videonest.co/videos/360011/seasons-of-sexuality-1980 https://img.videonest.org/gamma/360011_thumbnail_resized_v2.webp https://gamma.videonest.org/360011_video_v3.mp4 Seasons Of Sexuality (1980) "Seasons of Sexuality" is a film that explores the concept of sexuality as an integral part of human personality, emphasizing its expression from infancy through old age. It discusses how personal and cultural standards shape our understanding and expression of sexuality and highlights the importance of communication and respect in relationships. The film addresses the changes in perceptions of sexuality throughout different life stages, from childhood curiosity to teenage exploration and mature relationships, illustrating that sexuality is a lifelong aspect of human experience. Keywords sexuality, personality, human experience, communication, relationships, love, maturity, cultural standards, exploration, intimacy 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 786 familypicniclakesummerchildrenswimmingoutdoorfunrecreationlifestylehappyfamily funsummer activitieskidswater https://avgeeks.videonest.co/videos/360012/safety-demonstration-on-the-band-saw-1969 https://img.videonest.org/gamma/360012_thumbnail_resized_v2.webp https://gamma.videonest.org/360012_video_v3.mp4 Safety Demonstration On The Band Saw (1969) This instructional film on band saw safety highlights the machine's design, usage, and operational procedures. It emphasizes the importance of proper adjustments, safety precautions like wearing goggles, and techniques for cutting different shapes. The film also addresses the correct handling of stock to avoid accidents, such as ensuring the material lies flat and preventing binding. Additionally, it discusses the use of jigs and special holding devices for safe operation and effective cutting. Keywords band saw, safety, cutting techniques, adjustments, goggles, stock handling, jigs, holding devices, woodworking, operational procedures 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 814 Band SawSafety DemonstrationWoodworkingIndustrial SafetyWoodworking TechniquesSafety PrecautionsE. P. ResearchLos AltosCaliforniaHow-toDIYTutorialWorkshopTechniquesTools https://avgeeks.videonest.co/videos/360013/its-a-screen-printed-world-1960 https://img.videonest.org/gamma/360013_thumbnail_resized_v2.webp https://gamma.videonest.org/360013_video_v3.mp4 It's A Screen Printed World (1960) "It's A Screen Printed World" explores the evolution and significance of screen printing, highlighting its growth as a modern and efficient printing method. The film outlines the basic elements of screen printing, including frames, screens, inks, and squeegees, while emphasizing the versatility of the technique in producing high-quality images on various surfaces. Through the lens of the Advanced Process Supply Company, it showcases the advancements in equipment and inks that have transformed screen printing into a sophisticated industry capable of meeting diverse printing needs. Keywords screen printing, evolution, techniques, Advanced Process Supply Company, inks, frames, versatility, industry growth, printing surfaces, modern equipment Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 836 screen printingsilk screenprint designprinting methodsmass producescreen meshmanufacturing processindustrial printingprint productionscreen printing techniquessilk screen printingdesign printinglarge format printingcustom printingprinting tutorial https://avgeeks.videonest.co/videos/360014/swimming-rescues-1974 https://img.videonest.org/gamma/360014_thumbnail_resized_v2.webp https://gamma.videonest.org/360014_video_v3.mp4 Swimming Rescues (1974) Emphasizes the importance of safe, non-swimming techniques for rescuing drowning victims, highlighting that most drownings can be prevented with proper knowledge. It details various approaches and adaptations for lifesaving, including entry methods, swimming strokes, and carries, while stressing that swimming rescues should only be a last resort. Lifesavers must be proficient in swimming skills before engaging in rescue training, and constant practice is essential for maintaining these skills. Keywords drowning prevention, lifesaving techniques, non-swimming rescues, swimming skills, rescue training, Red Cross, aquatic emergencies 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 511 water safetyswimming rescuesRed Crosslifesavingcrawl strokebreast strokelifeguarddrowning preventionwater rescuefirst aidCPRswimming techniquessafety tipssurvival swimmingaquatics https://avgeeks.videonest.co/videos/360015/simple-machines-levers-2nd-ed-1984 https://img.videonest.org/gamma/360015_thumbnail_resized_v2.webp https://gamma.videonest.org/360015_video_v3.mp4 Simple Machines: Levers (2nd Ed, 1984) Discusses the principles of levers, a type of simple machine that helps lift heavy loads by changing the direction or magnitude of force applied. It explains how the position of the fulcrum affects the amount of force needed to lift a load and demonstrates various applications of levers in tools such as shovels, hammers, scissors, and wheelbarrows. The film emphasizes the trade-off between force and distance based on the fulcrum's location, illustrating how levers can be used to amplify force or increase speed in different scenarios. Keywords lever, fulcrum, force, load, simple machine, distance, speed, tools, mechanics Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 781 Simple MachinesLeversFulcrumForceDistancePhysicsEducationScienceEducational VideosCoronet Films https://avgeeks.videonest.co/videos/360016/indonesia-a-new-nation-of-asia-1959 https://img.videonest.org/gamma/360016_thumbnail_resized_v2.webp https://gamma.videonest.org/360016_video_v3.mp4 Indonesia: A New Nation Of Asia (1959) The film presents a portrait of Indonesia as a newly independent nation, highlighting the struggles and aspirations of its diverse population. Salim, a teacher, reflects on the challenges faced by the Indonesian people, such as overcrowding, poverty, and the need for education and trade skills. The film discusses the historical context of Dutch colonialism and the transition to independence, emphasizing the importance of unity among various ethnic groups. It showcases the agricultural lifestyle of the majority of Indonesians, their reliance on rice farming, and the potential for economic growth through natural resources. The cultural richness of Indonesia, including its religious diversity and traditional arts, is also celebrated as the nation strives for progress. Keywords Indonesia, independence, Salim, education, agriculture, Dutch colonialism, ethnic diversity, economy, culture, traditions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 983 IndonesiaIndonesiandaily lifeDutch East Indiesnew nationindependencehistorydocumentarycultureSoutheast AsiaIndonesian Culture https://avgeeks.videonest.co/videos/360017/animals-unlimited-1950 https://img.videonest.org/gamma/360017_thumbnail_resized_v2.webp https://gamma.videonest.org/360017_video_v3.mp4 Animals Unlimited (1950) "Animals Unlimited" explores the wildlife and natural beauty of the Kruger National Park in South Africa, the largest game reserve in the world. The film highlights the diverse range of animals, including lions, hippos, and various species of birds, while emphasizing the delicate balance of nature and the importance of conservation. It portrays the thrill of observing these creatures in their natural habitat, free from human interference, and showcases the intricate relationships between predator and prey in the wild. Keywords Kruger National Park, wildlife, conservation, South Africa, lions, hippos, nature, game reserve, predator, prey Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1152 Kruger National ParkSouth Africawildlifelionsantelopeanimalsgame reserveAfrican safariwild animalsnature documentarytravel documentarywarthog https://avgeeks.videonest.co/videos/360018/three-mothers-and-four-fathers-1961 https://img.videonest.org/gamma/360018_thumbnail_resized_v2.webp https://gamma.videonest.org/360018_video_v3.mp4 Three Mothers And Four Fathers (1961) The film tells the poignant story of Lee Po, a nine-year-old boy in Hong Kong who has faced immense hardship and loss. After losing his parents while escaping from Red China, he is passed between families, each time facing neglect and cruelty. Lee Po's life reflects the struggles of many children in Hong Kong's impoverished neighborhoods, where survival is a daily challenge. The narrative follows a missionary's search for Lee Po after encountering him in a marketplace, illustrating themes of love, loss, and the quest for belonging. Ultimately, the film highlights the importance of compassion and the hope that someone will care for those who feel lost. Keywords Lee Po, Hong Kong, orphan, missionary, survival, family, poverty, compassion, loss, belonging Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1142 Hong KongchildhoodcrueltyMissionariesChild WelfareSocial IssuesLee PoRed ChinaDocumentaryabuseexploitationAsiahuman rightschildrencolonialism https://avgeeks.videonest.co/videos/360019/approach-to-school-site-development-1967 https://img.videonest.org/gamma/360019_thumbnail_resized_v2.webp https://gamma.videonest.org/360019_video_v3.mp4 Approach To School Site Development (1967) The film discusses the importance of developing school sites that enhance educational experiences and foster environmental awareness among students. It highlights the collaborative efforts of school planning committees, which include educators, students, and community members, to create outdoor laboratories that utilize natural features for hands-on learning. The film showcases various activities where students engage with their environment, such as planting trees, studying wildlife, and conducting scientific experiments. Emphasizing the role of school sites in community development, the film argues that well-planned school environments can serve as valuable resources for both education and recreation, ultimately contributing to better citizenship and environmental stewardship. Keywords school site development, environmental education, community involvement, outdoor laboratories, student engagement, natural resources, planning committee, hands-on learning, biodiversity, conservation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1104 Ann Arbor High SchoolSchool Site DevelopmentSite PlanningCurriculum EnrichmentMichiganCommunity UseEducational FacilitiesSchool ConstructionSite SelectionMaster PlanHigh SchoolPlanningDevelopmentMichigan SchoolsCommunity Engagement https://avgeeks.videonest.co/videos/360020/label-logic-1968 https://img.videonest.org/gamma/360020_thumbnail_resized_v2.webp https://gamma.videonest.org/360020_video_v3.mp4 Label Logic (1968) The film discusses a California test involving five women shoppers who were tasked with selecting common household items based on informed choices. The results revealed that many consumers are influenced by factors such as price, advertising, and packaging, leading to a significant margin of error in their selections. The importance of reading and understanding product labels is emphasized, as labels provide essential information about the product's contents, quality, and safety. The film outlines various labeling regulations enforced by the FDA, which aim to protect consumers by ensuring truthful representation of products. It also highlights the necessity for consumers to heed label instructions to avoid potential dangers, particularly with drugs and household chemicals. Keywords consumer behavior, product labels, informed choices, FDA regulations, shopping test, safety, advertising influence, intelligent buying, household items, health risks Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1095 consumer buyinggrocery shoppingproduct packagingpricing strategiesCaliforniamarket researchconsumer behaviorbusinessmarketinggrocerypackagingpricingstrategiesshoppingbuying behavior https://avgeeks.videonest.co/videos/360021/av-geeks-16mm-lunch-3-26-2025 https://img.videonest.org/gamma/360021_thumbnail_resized_v2.webp https://gamma.videonest.org/360021_video_v3.mp4 AV Geeks 16mm Lunch 3-26-2025 Wonderful Wednesdays include watching 16mm films! #16mmfilms #avgeeks Rip Van Winkle filmstrip Zoo Animals in the Wild : Rhinos and Hippos Simple Machines: Levers 2nd Ed To Be Growing Older How To Build A Better Golf Swing, Part 1 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 3893 https://avgeeks.videonest.co/videos/360022/av-geeks-16mm-lunch-3-25-2025 https://img.videonest.org/gamma/360022_thumbnail_resized_v2.webp https://gamma.videonest.org/360022_video_v3.mp4 AV Geeks 16mm Lunch 3-25-2025 We had all the tech glitches yesterday, so no problems today?! (please..) #16mmfilms #avgeeks Model Cities Library Zoo Animals in the Wild : Crocodiles Puritan Family of Early New England "TIROS Experimental Weather Satellite" Scott's New Old Friend 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 4036 https://avgeeks.videonest.co/videos/361745/cutting-an-external-national-fine-thread-1941 https://img.videonest.org/gamma/361745_thumbnail_resized_v2.webp https://gamma.videonest.org/361745_video_v3.mp4 Cutting an External National Fine Thread (1941) Jam Handy! Provides a detailed overview of the process of cutting screw threads on a lathe. It explains the different types of screw threads, the importance of precision in machining, and outlines the four basic steps involved in thread cutting: setting up the work, making an undercut, grinding the threading tool, and cutting the thread. The film emphasizes the need for accurate measurements and careful alignment of tools to ensure quality results, showcasing the skill required by machinists. Keywords lathe, machining, screw threads, thread cutting, precision, tool grinding, machining process, undercut, alignment, measurements Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 691 thread cuttinglathe machinemachiningscrew threadthreading toolundercutprecision machiningmetalworkingmanufacturing processNBS standardsNational Bureau of Standards https://avgeeks.videonest.co/videos/361746/light-beam-named-ray-1973 https://img.videonest.org/gamma/361746_thumbnail_resized_v2.webp https://gamma.videonest.org/361746_video_v3.mp4 Light Beam Named Ray (1973) Introduces the concept of light through the character Ray, a personification of light beams. Ray explains the origins of light, its crucial role in visibility, and how it interacts with various surfaces through reflection and refraction. The film covers topics such as the speed of light, the principles of reflection and refraction, the functioning of lenses and prisms, and the nature of different types of light, including lasers. It emphasizes the importance of light in everyday life, science, and technology, making complex concepts accessible to viewers. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1184 optical systemlight beamlight raysreflectionHandel FilmRayphysics educationanimated sciencelight phenomenaoptical physicsray tracingscience animationeducational filmlight refractionspecular reflection https://avgeeks.videonest.co/videos/361747/leisure-time-photography-1980 https://img.videonest.org/gamma/361747_thumbnail_resized_v2.webp https://gamma.videonest.org/361747_video_v3.mp4 Leisure Time Photography (1980) The film features world-class photographer Freeman Patterson, who emphasizes the importance of creativity and perspective in photography. He believes that many photographers are limited by conventional rules and encourages them to experiment and express themselves through their work. Patterson discusses the significance of light, composition, and the ability to see the world differently, advocating for photography as a creative outlet accessible to everyone. He also highlights the joy of discovering beauty in everyday surroundings and the personal growth that comes from engaging with photography. Keywords Freeman Patterson, photography, creativity, perspective, self-expression, composition, light, experimentation, everyday beauty, accessible hobby 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1185 Freeman Pattersonlandscape photographynature photographyphotographysunrisesunset https://avgeeks.videonest.co/videos/361748/millions-of-pies-1970 https://img.videonest.org/gamma/361748_thumbnail_resized_v2.webp https://gamma.videonest.org/361748_video_v3.mp4 Millions Of Pies (1970) "Millions Of Pies" is an educational film that explores how machines assist in food production, particularly in making pies and other baked goods. It contrasts the efforts of a mother cooking for her family with the efficiency of machines that can produce large quantities of food quickly. The film highlights the importance of automation in modern food preparation while acknowledging that some tasks, especially those requiring a personal touch, are best done by skilled individuals. Keywords food production, machines, automation, baking, pies, education, efficiency, family cooking, conveyor belts, special cakes 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 867 apple turnoversbakingfamily cookingfood preparationrecipecooking tutorialfamily recipedessert recipeapple dessertturnover recipeNational Instructional Televisionfoodcookingdessertbaking tutorial https://avgeeks.videonest.co/videos/361749/everyones-a-winner-1976 https://img.videonest.org/gamma/361749_thumbnail_resized_v2.webp https://gamma.videonest.org/361749_video_v3.mp4 Everyone's A Winner (1976) The film focuses on a physical education class where students participate in fitness tests designed to measure their physical performance, specifically agility, balance, and strength. The instructor emphasizes that the tests are not about competition against others, but rather personal improvement. Through various exercises and tests such as the side step and standing long jump, students learn the importance of physical fitness in everyday activities and how to enhance their abilities. Keywords physical education, fitness tests, agility, balance, strength, personal improvement, exercises, side step, standing long jump Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 898 gymnasticsphysical educationbalanceflexibilityEl Toyan SchoolSan Diego CountyDede Sargent https://avgeeks.videonest.co/videos/361750/is-a-career-in-the-service-industries-for-you-1972 https://img.videonest.org/gamma/361750_thumbnail_resized_v2.webp https://gamma.videonest.org/361750_video_v3.mp4 Is A Career In The Service Industries For You? (1972) This film explores career opportunities in the service industries, emphasizing the importance of planning for the workforce. It highlights various service occupations, such as food preparation, lodging services, personal services, and protective services, which are experiencing rapid growth. The film encourages viewers to consider their interests and skills while preparing for a career, suggesting that many service jobs offer advancement opportunities and the chance for self-employment. It also stresses the importance of interpersonal skills and education in succeeding in these fields. Keywords service industries, career opportunities, food preparation, lodging services, personal services, protective services, job growth, advancement, interpersonal skills, education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 898 service industrycareer opportunitiesjob growthjob marketcareereducationemploymentindustryservice jobsKona KaiAndorra TheatreYe Olde Cleanersbusinessopportunitiesgrowth https://avgeeks.videonest.co/videos/361751/thats-me-1963 https://img.videonest.org/gamma/361751_thumbnail_resized_v2.webp https://gamma.videonest.org/361751_video_v3.mp4 That's Me (1963) Features Alan Arkin. The film features a conversation between a social worker and a young Puerto Rican man named Juan, who spends his time in a park playing guitar instead of attending school. The social worker tries to understand Juan's reasons for not being in school and encourages him to consider different educational and career options. Juan expresses his disinterest in traditional schooling and work, preferring to enjoy life in the park. The dialogue explores themes of cultural identity, aspirations, and the challenges faced by young people in urban settings. Keywords social worker, Juan, Puerto Rican, education, guitar, cultural identity, aspirations, urban life, conversation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 906 social workerinterviewNew York CityAlan ArkinAndrew Duncanpark benchguitarThat's MeDocumentary FilmNYC Social Servicesmusicianlife story https://avgeeks.videonest.co/videos/361752/alexander-who-used-to-be-rich-last-sunday-1989 https://img.videonest.org/gamma/361752_thumbnail_resized_v2.webp https://gamma.videonest.org/361752_video_v3_360.mp4 Alexander Who Used To Be Rich Last Sunday (1989) "Alexander Who Used to Be Rich Last Sunday" follows a young boy named Alexander who reflects on how he lost the money he received from his grandparents. Despite his initial excitement about being rich, he quickly spends his earnings on trivial items, such as gum and a snake rental. Throughout the story, Alexander grapples with the challenges of saving money and dealing with the teasing of his brothers. Ultimately, he learns that wealth can be fleeting and that he must be more responsible with his finances if he wants to save for something special, like a walkie-talkie. Keywords Alexander, rich, money, spending, saving, family, lessons, childhood, siblings 2025-03-26T00:00:00.000Z yes A/V Geeks 16mm Films no 915 FamilyDramaNew JerseyChildren's FilmBernard WiletsJudith ViorstDiane HaagStewart AsbjorsenBill FiegeRoxanne SponnobleKaffee Haus https://avgeeks.videonest.co/videos/361753/av-geeks-16mm-lunch-3-27-2025 https://img.videonest.org/gamma/361753_thumbnail_resized_v2.webp https://gamma.videonest.org/361753_video_v3_360.mp4 AV Geeks 16mm Lunch 3-27-2025 Pollen be damned! We are watching films outside till our faces get all puffy! #16mmfilms #avgeeks Rhyming Families filmstrip Zoo Animals in the Wild : Bears Survival Swimming The Color of Man Introduction to Reaction Kinetics The Discus 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 3912 https://avgeeks.videonest.co/videos/363413/work-of-the-heart-1967 https://img.videonest.org/gamma/363413_thumbnail_resized_v2.webp https://gamma.videonest.org/363413_video_v3_360.mp4 Work Of The Heart (1967) The film "Work Of The Heart" explores the intricate functions of the human heart and its vital role in pumping blood throughout the body. It details how the heart adjusts its rate based on the body's needs, the mechanisms behind heartbeats, and the structure of the heart, including its chambers and valves. The film also discusses the electrical activity of the heart, the significance of the pacemaker, and modern advancements in heart surgery, including valve replacement, emphasizing ongoing research aimed at improving cardiac health and longevity. Keywords heart, blood circulation, pacemaker, heart valves, electrocardiogram, heart surgery, valve replacement, cardiac research, human anatomy, blood transport system LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1077 human heartblood flowbody functionheart rateblood transportanatomyphysiologyeducationsciencebiologycardiovascular system https://avgeeks.videonest.co/videos/363414/living-things-in-a-drop-of-water-1965 https://img.videonest.org/gamma/363414_thumbnail_resized_v2.webp https://gamma.videonest.org/363414_video_v3_360.mp4 Living Things In A Drop Of Water (1965) The film explores the incredible diversity of life forms visible through microscopes, particularly focusing on single-celled organisms known as protists found in a drop of water. It highlights various types of protists, their movement mechanisms, reproduction methods, and their roles in ecosystems, including their relationships with larger animals like cows. The narrative emphasizes the importance of these tiny organisms in the food chain and their impact on human life, both beneficial and harmful. Keywords protists, microorganisms, microscopy, ecosystems, diversity of life, reproduction, food chain, relationships, human impact, diseases LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 702 wildlifezebragirafferhinocerosducksplanktonmicroscopetelescopephotographywaternaturesafarianimalsscienceastronomy https://avgeeks.videonest.co/videos/363415/seasons-of-home-a-1930s-american-life-silent-home-movies-1939 https://img.videonest.org/gamma/363415_thumbnail_resized_v2.webp https://gamma.videonest.org/363415_video_v3.mp4 Seasons of Home: A 1930s American Life (silent home movies, 1939) This 1930s home movie footage offers a warm, nostalgic glimpse into rural American life, capturing a blend of **family gatherings, outdoor recreation, and everyday chores**. Scenes range from a woman trimming grass with a scythe and children playing with puppies to families embarking on fishing trips, rowing across quiet lakes, and proudly displaying their catches. Throughout the film, people interact joyfully—**laughing, waving, playing games**, and sharing affectionate moments across generations. Dogs, ever-present, add charm and continuity, while seasonal changes bring visual variety, from **lush green fields and shady woods** to **snow-covered homes and shoveling scenes**. The film beautifully documents the **simple pleasures, hard work, and close-knit community** that defined life in 1930s rural America. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 907 family gatheringfishinghuntingdogsgrass cuttingvintage home moviesrural lifefamilyhome movies https://avgeeks.videonest.co/videos/363416/eclipses-of-the-sun-and-moon-1965 https://img.videonest.org/gamma/363416_thumbnail_resized_v2.webp https://gamma.videonest.org/363416_video_v3.mp4 Eclipses Of The Sun And Moon (1965) The film documents a scientific expedition to observe a total solar eclipse from a jet flying over Canada. It explains the mechanics of solar and lunar eclipses, detailing the roles of the Earth, Moon, and Sun, and describes the significance of studying eclipses for understanding solar phenomena like the corona and prominences. The film highlights the rarity of total eclipses and the challenges scientists face in gathering data during these brief events, emphasizing the importance of eclipses in advancing our knowledge of the universe. Keywords solar eclipse, lunar eclipse, Earth, Moon, Sun, corona, prominences, astronomy, shadow path, scientific expedition LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 651 solar eclipsetotal eclipseNASAscientistsastronautssunEdmontonCanadaspacescienceastronomyeclipse2024DocumentaryNASA Scientists https://avgeeks.videonest.co/videos/363417/cattleman-a-ranchers-story-2nd-ed-1964 https://img.videonest.org/gamma/363417_thumbnail_resized_v2.webp https://gamma.videonest.org/363417_video_v3.mp4 Cattleman: A Rancher's Story (2nd Ed, 1964) "Cattleman: A Rancher's Story" follows a rancher reflecting on his 35 years of cattle ranching, highlighting the challenges and changes in the industry. As he prepares for the summer visit of his daughter’s friend, Wendy, he balances family life with the realities of ranch management. The rancher faces a significant decision: to continue the traditional method of raising cattle until they are yearlings or to adapt to modern practices by selling calves earlier and using trucks for transport. This shift signifies a broader economic change in ranching, emphasizing efficiency over tradition. The story captures the bond between the rancher, his family, and the dedicated cowboy, Ranger, who represents the old ways of ranching. Keywords cattle ranch, family, tradition, economic change, ranch management, calves, yearlings, modernization, cowboy, summer visit LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1262 https://avgeeks.videonest.co/videos/363418/the-dairy-farmer-1965 https://img.videonest.org/gamma/363418_thumbnail_resized_v2.webp https://gamma.videonest.org/363418_video_v3.mp4 The Dairy Farmer (1965) The film "The Dairy Farmer" explores the complexities of modern dairy farming in America, focusing on the Hartman family farm. It highlights the transition from traditional methods to mechanization, showcasing how modern machinery increases efficiency while addressing challenges such as rising operational costs and competition from larger farms. The film emphasizes the importance of family involvement in farming and the necessity of adapting to changing agricultural practices to remain viable. Keywords dairy farming, mechanization, family farm, efficiency, rising costs, competition, agricultural practices, modern machinery, Hartman family, milk production LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1013 Dairy FarmingDairy CattleUnited StatesHartman FarmFarmlandMechanized MilkingFarmingAgriculture TechnologyDairy ProductionModern FarmingCattleMilk ProductionAmerican Farming https://avgeeks.videonest.co/videos/363419/what-makes-clouds-1965 https://img.videonest.org/gamma/363419_thumbnail_resized_v2.webp https://gamma.videonest.org/363419_video_v3.mp4 What Makes Clouds? (1965) The film explains the formation of clouds, starting with the basic concept that clouds are made of water droplets. It discusses how fog occurs when clouds hug the ground and describes the process of water evaporation from the earth's surface. The video illustrates how air can hold water vapor and how temperature changes can lead to condensation, forming clouds. It also highlights the importance of tiny particles in the air that serve as surfaces for the water vapor to condense upon. The process of air rising, expanding, and cooling is crucial for cloud formation, and the film concludes by mentioning ongoing research into how rain is formed from cloud droplets. Keywords cloud formation, evaporation, condensation, water vapor, fog, temperature, air pressure, particles, rain LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1074 Golden Gate Bridgetime-lapsecloud formationSan Franciscofogwater dropletsdramaticmeteorologynature documentaryCalifornialandscapeatmospheric phenomena https://avgeeks.videonest.co/videos/363420/sheep-ranch-country-1949 https://img.videonest.org/gamma/363420_thumbnail_resized_v2.webp https://gamma.videonest.org/363420_video_v3.mp4 Sheep Ranch Country (1949) The film explores the agricultural landscape of Southeastern Australia, focusing on sheep farming and dairy production. It highlights the challenges faced by farmers, including droughts and bushfires, as well as the importance of wool exports to the economy. The story follows the Robertson family, who manage a sheep station, detailing the shearing process and the annual livestock auction in the nearby town of Gandy. The film also emphasizes the significance of education for rural children and the connection between local agriculture and major cities like Melbourne and Sydney, which serve as commercial hubs for exporting goods. Keywords Australia, sheep farming, dairy production, wool exports, Robertson family, shearing, livestock auction, education, agriculture, Southeastern Australia Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1182 AustraliaSoutheastern Australiasheep farmingdairy farmingdairy productswheat farmsEucalyptus treesfarmingagriculturelandscapedocumentaryAustralian Historyruralcountrysiderural life https://avgeeks.videonest.co/videos/363421/american-indians-of-today-1957 https://img.videonest.org/gamma/363421_thumbnail_resized_v2.webp https://gamma.videonest.org/363421_video_v3.mp4 American Indians Of Today (1957) The film "American Indians Of Today" (1957) explores the lives of contemporary American Indians, focusing on their cultural practices, economic activities, and governance on reservations. It highlights the San Carlos Apache reservation's success in cattle ranching and self-governance through tribal councils. The film discusses the challenges faced by various tribes in adapting to modern life while preserving their traditions, including education, employment, and the impact of urban migration. It emphasizes the ongoing changes within Native American communities and the potential for economic development through resources and education. Keywords American Indians, reservations, San Carlos Apache, tribal council, cultural practices, economic activities, urban migration, education, self-governance, modernization LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 862 San Carlos ApacheArizonaNative Americancattle herdingpowwowtrading postIndigenous CulturesAmerican WestDocumentaryHistoryApache TribeArizona CultureTraditional PracticesLivestockCultural Heritage https://avgeeks.videonest.co/videos/363422/zero-hour-1978 https://img.videonest.org/gamma/363422_thumbnail_resized_v2.webp https://gamma.videonest.org/363422_video_v3.mp4 Zero Hour (1978) Based on a Ray Bradbury story. "Zero Hour" depicts the imaginative play of children as they engage in a game called "Invasion," where they pretend to defend against Martians. The story unfolds through conversations between kids and their parents, revealing the complexities of childhood imagination, the influence of peers, and the dynamics of growing up. The children express their thoughts on life, logic, and the idea of an invasion, all while navigating their playful world filled with make-believe scenarios. As the game escalates, the adults observe the chaos and nostalgia of childhood, reflecting on their own experiences. Keywords children, imagination, invasion, play, Martians, childhood, dynamics, adults, nostalgia 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1182 Zero HourRay BradburyInvasion gamechildren playingBFA Educational Mediachildren's gamescience fiction filmfamily filmshort filmeducational filmclassic literatureadaptationchildrens animationRay Bradbury adaptationinvasion https://avgeeks.videonest.co/videos/363423/millpond-memories-1958 https://img.videonest.org/gamma/363423_thumbnail_resized_v2.webp https://gamma.videonest.org/363423_video_v3.mp4 Millpond Memories (1958) "Millpond Memories" is a nostalgic exploration of a boy's experiences at an old mill pond, where he observes various wildlife and learns about nature's intricacies. The film captures the boy's interactions with frogs, turtles, fish, and other animals, highlighting the beauty and complexity of the ecosystem. It reflects on the passage of time and the connections between nature and childhood memories. Keywords mill pond, wildlife, nostalgia, nature, frogs, turtles, fish, childhood, ecosystem, memories Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 622 Millpond Memoriesbullfroggreen frogleopard frogspotted turtlemuskratwildlife documentaryfrogsturtlesamphibiansreptilesnature documentaryanimalsMillpondEarl L.Hilfiker https://avgeeks.videonest.co/videos/363424/we-explore-the-beach-1955 https://img.videonest.org/gamma/363424_thumbnail_resized_v2.webp https://gamma.videonest.org/363424_video_v3.mp4 We Explore The Beach (1955) In this vintage film, Betty and Billy explore a beach with their friend Mr. Boon. They engage in activities like playing hide-and-seek, discovering a sandpiper's nest, and learning about various beach animals such as seagulls, pelicans, and different types of shells. Mr. Boon teaches them about ships, lighthouses, and the tide, while they collect shells and observe marine life. The adventure culminates in a trip to the pier to buy fish for dinner, illustrating the wonders of beach exploration and the importance of nature. This film is suffering from some emulsion damage due to vinegar syndrome. Keywords beach, exploration, children, nature, animals, shells, tide, pelican, seagull, Mr. Boon, adventure Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 614 Coronet Instructional FilmsBirdsSandpiperPelicanBird nestBeachNatureAnimalsEducational FilmWildlifeDocumentaryCoastal Birds https://avgeeks.videonest.co/videos/363425/horizons-in-sciences-new-challenges-new-conquests-1966 https://img.videonest.org/gamma/363425_thumbnail_resized_v2.webp https://gamma.videonest.org/363425_video_v3.mp4 Horizons In Sciences: New Challenges, New Conquests (1966) This film highlights significant achievements in space exploration and scientific research during the 1960s. It covers the Gemini 8 mission, where astronauts Neil Armstrong and David Scott faced a critical emergency during their space flight but ultimately succeeded in their docking procedure. The film also discusses the Soviet Luna 9's successful soft landing on the moon, showcasing the advancements in space technology. Additionally, it features young scientists, including Henry Wagner Jr., who excel in scientific talent competitions, emphasizing the importance of youth in driving future discoveries. Keywords Gemini 8, Neil Armstrong, David Scott, space exploration, Luna 9, soft landing, scientific research, youth scientists, Henry Wagner Jr., Eastman Kodak 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 843 Gemini 8ApolloNeil ArmstrongDavid Scottspace rendezvousLuna 9Atlas Agenamoon landingdockingspace missionNASAspace explorationorbital mechanics1960shistorical footage https://avgeeks.videonest.co/videos/363426/egypt-gift-of-the-nile-1977 https://img.videonest.org/gamma/363426_thumbnail_resized_v2.webp https://gamma.videonest.org/363426_video_v3.mp4 Egypt: Gift Of The Nile (1977) The film explores the history of ancient Egypt, focusing on the life of Pharaoh Tutankhamun and the significance of the Nile River in sustaining Egyptian civilization. It discusses the construction of the pyramids, the craftsmanship involved, and the cultural legacy left by the pharaohs. The documentary highlights the mysteries surrounding the Sphinx and the pyramids, the role of scribes in preserving history, and the obsession with death and the afterlife in ancient Egyptian culture. It concludes by reflecting on the grandeur of the Pharaohs, particularly Ramses II, and the enduring impact of their monumental architecture. Keywords Tutankhamun, Nile River, ancient Egypt, pyramids, Sphinx, craftsmanship, afterlife, Ramses II, scribes, history 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1783 https://avgeeks.videonest.co/videos/363427/plain-indexing-and-cutting-spur-gear-1941 https://img.videonest.org/gamma/363427_thumbnail_resized_v2.webp https://gamma.videonest.org/363427_video_v3.mp4 Plain Indexing and Cutting Spur Gear (1941) Explains the process of cutting spur gears using a milling machine, detailing the terminology and dimensions crucial for gear design. It covers the setup of the milling machine, including the use of a dividing head for accurate spacing of cuts, the selection of appropriate cutters based on the gear specifications, and the importance of checking dimensions and calculations throughout the process. The tutorial emphasizes that the actual cutting is a minor part of the job, provided that proper preparations are made. Keywords spur gear, milling machine, gear design, dividing head, cutter selection, machining process, power transmission, gear specifications Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1461 https://avgeeks.videonest.co/videos/363428/keep-the-promise-1980s https://img.videonest.org/gamma/363428_thumbnail_resized_v2.webp https://gamma.videonest.org/363428_video_v3.mp4 Keep The Promise (1980s?) Essentially it's a slideshow committed to 16mm film. The presentation emphasizes Pillsbury's commitment to quality and the pride of its employees in maintaining high standards. It highlights the importance of teamwork across various roles—from farmers to marketing and production staff—in delivering quality products. The message stresses that quality is a meticulous process that begins with selecting raw ingredients and continues through production and packaging, ensuring consumer confidence in Pillsbury products. Keywords Pillsbury, quality, commitment, teamwork, production, employees, consumer confidence, raw ingredients, marketing, standards Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 676 Pillsburyfood productionfarminghigh qualitytransportationJack Stafford https://avgeeks.videonest.co/videos/363429/summer-is-an-adventure-1957 https://img.videonest.org/gamma/363429_thumbnail_resized_v2.webp https://gamma.videonest.org/363429_video_v3.mp4 Summer Is An Adventure (1957) The film follows the Johnson family as they embark on a summer adventure after receiving an invitation from Aunt Clara and Uncle Charlie to spend a weekend at a nearby lake. The journey is filled with sights of summer, including flowers, farms, and parks. Upon arrival, Fred and Judy enjoy their first speedboat ride, play with fireflies, swim in the lake, and have a picnic in the woods, where they discover various wildlife and nature. The trip concludes with a gentle summer rain and a beautiful rainbow, leaving the children with cherished memories of their adventure. Keywords summer, adventure, Johnson family, lake, speedboat, picnic, nature, wildlife, fireflies, rainbow Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 630 family tripsummerlakesummer adventureAunt ClaraUncle Charlieweekend tripvintage filmCoronet Filmshome moviefamily vacationsummer memories https://avgeeks.videonest.co/videos/363430/emergencies-in-the-making-2nd-ed-1969 https://img.videonest.org/gamma/363430_thumbnail_resized_v2.webp https://gamma.videonest.org/363430_video_v3.mp4 Emergencies In The Making (2nd Ed, 1969) The film emphasizes the importance of vigilance and caution while driving, highlighting how small, often overlooked details can lead to serious emergencies. It categorizes potential dangers into five groups: unpredictable drivers (the "other guy"), children, road conditions, weather influences (Mother Nature), and driver behavior (us). The narrative encourages drivers to anticipate unexpected situations, maintain awareness of their surroundings, and take proactive measures to avoid accidents, ultimately promoting safer driving practices. Keywords driving safety, emergencies, vigilance, road conditions, children, weather, driver behavior, accidents, awareness Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1261 https://avgeeks.videonest.co/videos/363431/an-american-museum-1954 https://img.videonest.org/gamma/363431_thumbnail_resized_v2.webp https://gamma.videonest.org/363431_video_v3.mp4 An American Museum (1954) The film explores the role of a curator at the City Art Museum of St. Louis, highlighting the process of evaluating and acquiring art. It emphasizes the importance of art in education for both children and adults, showcasing how museums serve as a reflection of history and culture. The curator's responsibilities include authenticating art, managing exhibitions, and engaging the community. The film illustrates the challenges of maintaining a diverse collection while providing educational experiences that inspire future generations. Keywords curator, City Art Museum, St. Louis, art evaluation, education, exhibitions, community engagement, history, authenticity, art collection Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1453 https://avgeeks.videonest.co/videos/363432/shot-put-the-1960 https://img.videonest.org/gamma/363432_thumbnail_resized_v2.webp https://gamma.videonest.org/363432_video_v3.mp4 Shot-Put, The (1960) The film provides a comprehensive guide on shot putting techniques, emphasizing the importance of body mechanics and the effective use of big muscle groups for maximum shot distance. Key principles include maintaining natural movements, developing a strong drive, and mastering footwork. It discusses the significance of a power position, the role of conditioning, and the necessity of weight training. The film also highlights the importance of practice and mental preparation for competition, encouraging athletes to focus on form and technique over mere speed. Keywords shot put, technique, body mechanics, muscle groups, power position, conditioning, weight training, practice, competition, form Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 843 Shot PutTrack and FieldYale UniversityYale Athletic AssociationYale Track TeamAthleticsSportsTechniqueInstructional VideoTrainingCompetitionCollege TrackField Events https://avgeeks.videonest.co/videos/363433/hour-of-decision-the-mystery-of-bethlehem1955 https://img.videonest.org/gamma/363433_thumbnail_resized_v2.webp https://gamma.videonest.org/363433_video_v3.mp4 Hour Of Decision - The Mystery of Bethlehem(1955?) Billy Graham. The film "Hour of Decision" presents a Christmas-themed message centered around the mystery of Bethlehem and the significance of Jesus Christ's birth. The speaker reflects on traditional Christmas customs, the nativity scene, and the biblical story of Jesus's birth, emphasizing the importance of accepting Christ into one's heart. It highlights Christ as the creator, preserver, redeemer, and future judge of the world, urging viewers to embrace faith and salvation during the holiday season. Keywords Christmas, Bethlehem, Jesus Christ, faith, salvation, nativity, mediator, redemption, holiday, tradition Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1046 Christmas StoryMartin LutherHour of DecisionChristmas TreeLuke 2BethlehemChristianityReligionHolidayChristmas https://avgeeks.videonest.co/videos/363434/grinding-wheel-safety-part-2-1981 https://img.videonest.org/gamma/363434_thumbnail_resized_v2.webp https://gamma.videonest.org/363434_video_v3.mp4 Grinding Wheel Safety, Part 2 (1981) Presented by Dave Brown from Tel-e-train, is the second part of a series on grinding wheel safety. It details the proper procedures for mounting a grinding wheel, emphasizing the importance of cleanliness, proper torque, and safety checks. The video also discusses balancing the wheel, the significance of using safety guards, and the necessity of regular maintenance checks for grinders. It warns against the dangers of improper handling and stresses the need for safety gear. The presentation concludes with a reminder that safety should always be prioritized in the workplace. Keywords grinding wheel, safety, mounting, torque, balancing, maintenance, guards, handling, personal protective equipment, workplace safety LIMITED DISTRIBUTION. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1214 https://avgeeks.videonest.co/videos/363435/myra-hess-plays-beethoven-19450 https://img.videonest.org/gamma/363435_thumbnail_resized_v2.webp https://gamma.videonest.org/363435_video_v3.mp4 Myra Hess Plays Beethoven (19450 British pianist Myra Hess playing the first movement of Beethoven's Sonata in F minor, op. 57 (Appassionata). 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 565 Myra HessBeethovenSonata in F MinorSteinway & Sonspianoclassical musicPiano PerformanceClassical PianoSonata F MinorBeethoven Sonata https://avgeeks.videonest.co/videos/363436/shakespeares-theater-the-globe-playhouse-1960 https://img.videonest.org/gamma/363436_thumbnail_resized_v2.webp https://gamma.videonest.org/363436_video_v3.mp4 Shakespeare's Theater: The Globe Playhouse (1960) In 1600 London, the Globe Playhouse became a hub of entertainment, particularly for plays written by William Shakespeare, who was both an owner and a leading playwright. The Globe featured a unique structure with multiple acting areas, including the main platform for action and the inner study for interior scenes. The flexibility of the theater allowed for dynamic scene changes and creative staging, enhancing the audience's experience. Various acting areas, such as the terrace and music gallery, contributed to the storytelling, while stage machinery and trap doors facilitated dramatic effects, including the appearances of ghosts and other characters. Shakespeare's plays utilized dialogue and movement across the different stages to engage the audience in the unfolding drama. Keywords Globe Playhouse, Shakespeare, theater, 1600 London, acting areas, stage design, Elizabethan, audience experience, drama, trap doors Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1035 ShakespeareGlobe PlayhouseElizabethan theaterTwelfth NightLondonstage designacting areasShakespearean StudiesHistoryDramaPerformanceLondon TheaterEnglish HistoryRenaissance TheaterStagecraft https://avgeeks.videonest.co/videos/363437/an-introduction-to-reaction-kinetics-1959 https://img.videonest.org/gamma/363437_thumbnail_resized_v2.webp https://gamma.videonest.org/363437_video_v3.mp4 An Introduction To Reaction Kinetics (1959) Discusses the control of chemical reactions, focusing on the reaction between hydrogen and chlorine to form hydrogen chloride. It illustrates how temperature and energy affect reaction rates, explaining concepts like activated complexes, potential energy barriers, and the conditions necessary for reactions to occur. The video also touches on the importance of collision frequency and the role of catalysts in enhancing reaction rates, emphasizing the practical applications of reaction kinetics in industry. Keywords chemical reactions, hydrogen, chlorine, hydrogen chloride, reaction rates, activated complexes, potential energy barriers, temperature, catalysts, reaction kinetics Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 787 Chemical ReactionsHydrogenChlorineReaction KineticsPhysical ChemistryChemistryAmerican Chemical SocietyTechnicolorEducationScience https://avgeeks.videonest.co/videos/363438/learning-with-film-and-video-1985 https://img.videonest.org/gamma/363438_thumbnail_resized_v2.webp https://gamma.videonest.org/363438_video_v3.mp4 Learning With Film And Video (1985) The film discusses the importance of using films and videos in education to engage diverse student populations and enhance learning. It highlights how films can provide common experiences, facilitate discussions, and cater to different learning styles, making complex subjects more accessible. Teachers express that films help students connect with content, understand various cultures, and stimulate intellectual discussions that traditional teaching methods may not achieve. Overall, the film advocates for the integration of visual media in classrooms to enrich the educational experience. Keywords education, films, learning, diversity, teaching methods, engagement, cultural understanding, visual media, student experience, classroom tools LIMITED DISTRIBUTION. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 939 science educationclassroom learningdiverse studentseducational filmelementary educationeducational resourcesteaching methodsSTEM educationinclusive educationscience experimentslesson planscurriculumschoolstudentslearning https://avgeeks.videonest.co/videos/363439/safety-for-the-new-employee-1973 https://img.videonest.org/gamma/363439_thumbnail_resized_v2.webp https://gamma.videonest.org/363439_video_v3.mp4 Safety For The New Employee (1973) The film emphasizes the importance of workplace safety, illustrating various hazards and the necessary precautions to avoid accidents. It uses humor and personification to explain safety measures, such as wearing safety glasses, proper lifting techniques, and maintaining clean workspaces. The narrative warns against the consequences of neglecting safety protocols, highlighting that accidents can lead to severe injuries, financial loss, and job repercussions. Overall, it serves as a comprehensive guide to fostering safe work habits. Keywords safety, workplace, accidents, precautions, hazards, safety glasses, lifting techniques, housekeeping, injury prevention, safety protocols LIMITED DISTRIBUTION. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 961 safety glassesworkplace safetyeye protectionsafety regulationsaccident prevention https://avgeeks.videonest.co/videos/363440/stress-1977 https://img.videonest.org/gamma/363440_thumbnail_resized_v2.webp https://gamma.videonest.org/363440_video_v3.mp4 Stress (1977) In this film, a couple, Mike and Jane, are navigating the challenges of starting a family while managing stress from new responsibilities, including buying a house and Mike's new job. Amidst the excitement of their upcoming baby, Mike experiences stress-related health issues, leading him to seek medical advice. The doctor explains that both good and bad changes can cause stress, and Mike learns the importance of managing it for his health and his family's well-being. The story highlights the balance between joy and anxiety during significant life changes. Keywords stress, family, pregnancy, new job, house buying, health, anxiety, doctor, life changes LIMITED DISTRIBUTION. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 883 WeddingChurchFamilyCeremonyCelebrationFootballNew House https://avgeeks.videonest.co/videos/363441/water-safety-the-basics-1979 https://img.videonest.org/gamma/363441_thumbnail_resized_v2.webp https://gamma.videonest.org/363441_video_v3.mp4 Water Safety: The Basics (1979) This film emphasizes the importance of water safety during recreational activities like swimming, boating, and fishing. It highlights the dangers of drowning, especially for those who cannot swim, and provides practical tips for safe practices, including learning to swim, choosing safe swimming locations, using life jackets, and employing the buddy system. It also discusses how to handle emergencies in the water and how to assist someone in distress without putting oneself at risk. Keywords water safety, drowning prevention, swimming tips, boating safety, life jackets, rescue techniques, buddy system, emergency procedures LIMITED DISTRIBUTION. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1001 Water SafetyDrowningSwimmingLifeguardPool RulesSafety PrecautionsWater SportsSwimming SkillsPool SafetyWater RescueAccident PreventionSurvival Skills https://avgeeks.videonest.co/videos/363442/inside-insideout-1972 https://img.videonest.org/gamma/363442_thumbnail_resized_v2.webp https://gamma.videonest.org/363442_video_v3.mp4 Inside Inside/Out (1972) "Inside Inside/Out" is an educational television program aimed at children, focusing on social and emotional health. It encourages children to express their thoughts and feelings, engage in discussions, and identify with the characters' experiences. The program emphasizes the importance of mental, emotional, and social health in education, allowing children to explore their feelings in a supportive environment. It combines drama with educational content, fostering a pupil-oriented approach rather than a strict teacher-led format. Developed by multiple educational agencies and supported by Exxon Corporation, the series promotes self-reflection and understanding among children. Keywords educational television, social health, emotional health, children, discussion, self-expression, mental health, pupil-oriented, Exxon Corporation, Inside Out 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 871 children playingInside Outtag gamechild developmentchild psychologykids gameseducational gameslearning through playearly childhood educationpreschool activitiesNational Instructional Television https://avgeeks.videonest.co/videos/363443/be-my-witnesses-1960s https://img.videonest.org/gamma/363443_thumbnail_resized_v2.webp https://gamma.videonest.org/363443_video_v3_360.mp4 Be My Witnesses (1960s) Explores the mission of the Christian church to spread the gospel worldwide, emphasizing the importance of personal responsibility in evangelism. It discusses the challenges faced by missionaries, including cultural differences, language barriers, and safety concerns. The narrative highlights the evolving role of missionaries, transitioning from leaders to partners with indigenous church leaders, and the necessity of adapting to modern methods of outreach. The film showcases the growth of Christianity in various regions, such as Africa and Latin America, and underscores the significance of serving others selflessly, as modeled by Jesus Christ. Keywords Christianity, missions, evangelism, missionaries, cultural differences, indigenous leadership, outreach, global church, personal responsibility, service Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1225 https://avgeeks.videonest.co/videos/363444/one-turkey-twoturkey-1971 https://img.videonest.org/gamma/363444_thumbnail_resized_v2.webp https://gamma.videonest.org/363444_video_v3_360.mp4 One Turkey, TwoTurkey (1971) The film features a playful counting song about turkeys, showcasing ten different turkeys engaging in various fun activities. It emphasizes numbers and words as viewers count along with the turkeys, highlighting their amusing behaviors and characteristics. The turkeys are depicted in various settings, creating a whimsical and entertaining experience for children. Keywords turkeys, counting, children, fun, animation, numbers, educational, playful, whimsical 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 325 TurkeysFarm AnimalsPoultryFeedingGobbleBirdsAnimalsWildlife https://avgeeks.videonest.co/videos/363445/what-makes-day-and-night-1947 https://img.videonest.org/gamma/363445_thumbnail_resized_v2.webp https://gamma.videonest.org/363445_video_v3_360.mp4 What Makes Day And Night (1947) In this educational film, Jim and Jane ask their dad about the concepts of day and night. He explains that the Earth is a rotating globe that turns on its axis, causing one side to experience daylight while the other side is in darkness. Using a flashlight to represent the sun, he demonstrates how the Earth’s rotation creates the cycle of day and night. The film illustrates various daily activities around the world, showing that while one region experiences day, another is in night, emphasizing the continuous turning of the Earth. Keywords day, night, Earth, rotation, axis, sunlight, globe, educational, children, activities Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 495 Earth rotationday and nightglobescience explanationchildren educationkidseducational videoscience for kidsplanet earthsolar systemrotationastronomygeographyeducational contentchildren's learning https://avgeeks.videonest.co/videos/363446/the-sugar-cereal-imitation-orange-breakfast-1975 https://img.videonest.org/gamma/363446_thumbnail_resized_v2.webp https://gamma.videonest.org/363446_video_v3_360.mp4 The Sugar Cereal Imitation Orange Breakfast (1975) The film presents humorous tips for kids on how to convince their parents to let them eat sugary cereals for breakfast instead of healthier options. It emphasizes the appeal of sweet breakfast foods and suggests tactics like shopping independently, reading cereal labels, and mixing cereals with candy to create appealing breakfast alternatives. The film also critiques the misleading nature of juice products, highlighting the high sugar content and low actual juice percentages in many popular beverages. Keywords sugary cereals, breakfast, kids, parents, marketing, nutrition, juice products, sugar content, humor 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 475 Kellogg'sFruit LoopsApple JacksSugary CerealsBreakfast Desserts1970sKidsCommercialsRetroVintageBreakfastNostalgiaChildhoodAdvertisingFood https://avgeeks.videonest.co/videos/363447/people-working-with-data-1975 https://img.videonest.org/gamma/363447_thumbnail_resized_v2.webp https://gamma.videonest.org/363447_video_v3_360.mp4 People Working WIth Data (1975) The film explores the various roles individuals can take when working with data, emphasizing the importance of facts and information in different professions. It highlights careers such as ocean scientists, school secretaries, weathercasters, and news reporters, showcasing how each role involves gathering, organizing, and communicating data. The narrative encourages viewers to consider their interests in working with people, things, or data, and how these elements contribute to one's personality and career choices. Keywords data, professions, ocean scientist, school secretary, weathercaster, news reporter, information, investigation, communication, career choices 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 475 DataPeopleTeacherNews ReporterOceanographerConstruction WorkerWorking with Data1970sEducationScienceOccupationsNews https://avgeeks.videonest.co/videos/363448/growing-growing-1971 https://img.videonest.org/gamma/363448_thumbnail_resized_v2.webp https://gamma.videonest.org/363448_video_v3_360.mp4 Growing Growing (1971) The film explores the curiosity of children about how plants grow from seeds. They engage in a playful experiment involving planting seeds, watering them, and observing their growth. The dialogue reflects their wonder about nature, the role of sunlight, and the transformation from seeds to flowers and trees. The children also share imaginative thoughts about the magic of seeds and the seasonal changes in nature. Keywords growth, plants, seeds, children, nature, curiosity, sunlight, gardening, experimentation 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 616 GardeningSeed PlantingPumpkin PlantsPlant GrowthRadishesBean StockKidsElementary SchoolEducationScienceNatureGrowing PlantsVegetable GardeningPumpkin GrowingSeed Germination https://avgeeks.videonest.co/videos/363449/how-animals-live-in-winter-1956 https://img.videonest.org/gamma/363449_thumbnail_resized_v2.webp https://gamma.videonest.org/363449_video_v3_360.mp4 How Animals Live In Winter (1956) In winter, Penny and her brother Chris explore how animals survive the cold season. They learn about birds that migrate to warmer areas and those that stay, like the ones they feed. They discover various animals, including a snowshoe rabbit that changes color for camouflage, a raccoon that hibernates, and a badger and skunk that remain active in search of food. They eventually find Bucky the deer, who adapts to winter by eating tree buds and grass despite the challenges of finding food. The film illustrates the different strategies animals use to stay warm and fed during winter. Keywords winter, animals, migration, hibernation, snowshoe rabbit, raccoon, badger, skunk, deer, survival Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 608 snowmanwinteranimalschildrensnowwhite rabbitbirdsmigration https://avgeeks.videonest.co/videos/363450/denmark-tour-1951 https://img.videonest.org/gamma/363450_thumbnail_resized_v2.webp https://gamma.videonest.org/363450_video_v3_360.mp4 Denmark Tour (1951?) Part of King's Crossroads TV show from 1951-2. Showcases Denmark through the lens of Hans Christian Andersen's fairy tales, beginning in Copenhagen and highlighting significant historical sites such as Roskilde Cathedral, ancient Viking fortresses, and royal castles. It captures Denmark's serene landscape, rich history, and cultural heritage, including visits to Andersen's childhood home and various charming towns. The narrator emphasizes the connection between the country's beauty and Andersen's storytelling, inviting viewers to appreciate Denmark's unique charm. Keywords Denmark, Hans Christian Andersen, fairy tales, Copenhagen, Roskilde Cathedral, Viking history, royal castles, cultural heritage, childhood home, historical sites Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 602 DenmarkCopenhagenHans Christian AndersenLittle MermaidRosenborg CastleViking FortressHistoryCultureTravelDocumentaryDanish CultureScandinavian History https://avgeeks.videonest.co/videos/363451/no-other-gods-1950 https://img.videonest.org/gamma/363451_thumbnail_resized_v2.webp https://gamma.videonest.org/363451_video_v3.mp4 No Other Gods (1950) The film "No Other Gods" revolves around Judy, who seeks advice from her Uncle Bill about dating and relationships, particularly regarding her mother’s past. The story unfolds a love triangle involving Judy and two suitors, Kirk and Tricky, with themes of ambition, sports, and the pursuit of success. As Tricky faces a career-ending injury, the characters grapple with the importance of love and integrity over material pursuits. The narrative also touches on the significance of faith and moral choices, culminating in a resolution that emphasizes the value of relationships over wealth. Keywords love triangle, dating, ambition, sports, injury, faith, moral choices, relationships, integrity Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1181 Family FilmsNo Other GodsBlack and WhiteDramaFamilyphoto albumdatingteenagerCharles F. RoyalS.M. Hershey https://avgeeks.videonest.co/videos/363452/heart-that-sings-1956 https://img.videonest.org/gamma/363452_thumbnail_resized_v2.webp https://gamma.videonest.org/363452_video_v3.mp4 Heart That Sings (1956) "Heart That Sings" follows a family's journey as they navigate the challenges of music and faith. The story centers on young Ted, who aspires to join the church choir despite his father's skepticism about his singing abilities. As Ted practices and receives encouragement from choir director Mr. Carter, tensions arise within the family, particularly with John, who feels overwhelmed by church commitments. Ultimately, the family's love for music and each other leads to a hopeful resolution, as John decides to rejoin the choir, emphasizing the importance of unity and faith in their lives. Keywords choir, family, music, faith, encouragement, struggle, unity, church, singing, aspirations Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1361 https://avgeeks.videonest.co/videos/363453/use-your-eyes-1973 https://img.videonest.org/gamma/363453_thumbnail_resized_v2.webp https://gamma.videonest.org/363453_video_v3.mp4 Use Your Eyes (1973) The film encourages viewers to truly observe and appreciate their surroundings, emphasizing the importance of seeing beyond the surface. It suggests that understanding the world requires looking at things from multiple perspectives and paying attention to details. By examining everyday objects and environments closely, one can discover new insights and beauty in the world. Keywords observation, awareness, perspective, beauty, details, discovery, environment, learning Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 624 childflower fieldnaturewalkingobservationclose-upseeing https://avgeeks.videonest.co/videos/363454/just-before-eve-1978 https://img.videonest.org/gamma/363454_thumbnail_resized_v2.webp https://gamma.videonest.org/363454_video_v3.mp4 Just Before Eve (1978) Flip Wilson and Martin Sheen! In this whimsical dialogue, Adam converses with God about his feelings of boredom in a seemingly perfect world. Adam expresses dissatisfaction with his existence, feeling unfulfilled and in need of companionship. God encourages Adam to explore his creativity and find meaning in life. Through their discussions, they contemplate the need for connection, the nature of creation, and the importance of love and understanding. Ultimately, Adam learns that he can create and share experiences, which alleviates his boredom and leads to a deeper appreciation of life. Keywords Adam, God, boredom, companionship, creativity, existence, meaning, connection, love, understanding 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1423 https://avgeeks.videonest.co/videos/363455/maltese-unicorn-1978 https://img.videonest.org/gamma/363455_thumbnail_resized_v2.webp https://gamma.videonest.org/363455_video_v3_360.mp4 Maltese Unicorn (1978) In this whimsical tale, a boy named Brian faces accusations of breaking a family heirloom, a malt unicorn. Throughout the story, he insists on his innocence while navigating misunderstandings with his family. With a mix of humor and creativity, Brian imagines himself as a detective, drawing parallels to famous sleuths like Sherlock Holmes. Ultimately, he learns the value of honesty and the importance of trust within his family. Keywords malt unicorn, family, innocence, detective, humor, honesty, misunderstandings, trust 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1406 https://avgeeks.videonest.co/videos/363456/cutting-a-taper-with-a-compound-rest-and-with-taper-attachment-1941 https://img.videonest.org/gamma/363456_thumbnail_resized_v2.webp https://gamma.videonest.org/363456_video_v3_360.mp4 Cutting A Taper With A Compound Rest And With Taper Attachment (1941) Jam Handy! The film details the precise process of cutting tapered shafts using an engine lathe, showcasing the importance of skilled craftsmanship and modern machine methods. It explains the steps involved in setting up the lathe, determining the correct angles with a compound rest, and measuring dimensions accurately with tools like a micrometer and bevel protractor. The video also illustrates the use of a taper attachment for cutting tapers less than 15° and emphasizes the significance of checking measurements against drawings to ensure precision. The film concludes with the finished tapered shafts, highlighting the operator's skill and the quality of the machining process. Keywords tapered shaft, engine lathe, compound rest, taper attachment, precision machining, skilled craftsmanship, micrometer, bevel protractor, production line, manufacturing process Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-28T00:00:00.000Z yes A/V Geeks 16mm Films no 605 precision machiningengine lathetapered shaftcompound restmachine shopblueprintmachining techniquesindustrial manufacturingmetalworkingfabricationengineering techniquesmechanical engineering https://avgeeks.videonest.co/videos/363457/distances-the-1947 https://img.videonest.org/gamma/363457_thumbnail_resized_v2.webp https://gamma.videonest.org/363457_video_v3_360.mp4 Distances, The (1947) "Distances" explores the nuances of distance running, emphasizing the importance of technique, style, and training. It discusses how runners can improve their performance through proper stride mechanics, calisthenics, and controlled tension. The film highlights common mistakes such as over-relaxation and overstriding, which can lead to fatigue and injury, and advocates for a circular stride and ball-of-the-foot landing for efficiency and speed. Keywords distance running, technique, style, training, stride mechanics, calisthenics, controlled tension, over-relaxation, overstriding, circular stride, ball-of-the-foot landing, efficiency, speed Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 643 Track and FieldDistance RunningCollege AthletesNational MeetRunning FormStaminaCalisthenics https://avgeeks.videonest.co/videos/363458/overture-to-rosamunde-1940 https://img.videonest.org/gamma/363458_thumbnail_resized_v2.webp https://gamma.videonest.org/363458_video_v3_360.mp4 Overture to Rosamunde (1940) *Overture to Rosamunde* (1940) is a **9-minute performance film** produced by **Commonwealth Pictures Corporation**, featuring the **National Philharmonic Orchestra** performing Franz Schubert’s *Overture to Rosamunde*. The film offers an intimate view of a **live orchestral performance**, highlighting the **conductor's role** and providing **close-up shots** of different sections of the orchestra as they play key passages. Designed to introduce audiences to classical music, the film captures the **collaborative dynamics of a symphony orchestra**, showcasing both the artistry of Schubert’s composition and the musicians’ technical skill. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-03-27T00:00:00.000Z yes A/V Geeks 16mm Films no 631 Franz SchubertRosamunde OvertureNational PhilharmonicSymphony Orchestraclassical musicorchestraFriedrich Feherconductingclassical music performanceconcertphilharmonic orchestra https://avgeeks.videonest.co/videos/363459/av-geeks-16mm-lunch-3-31-2025 https://img.videonest.org/gamma/363459_thumbnail_resized_v2.webp https://gamma.videonest.org/363459_video_v3.mp4 AV Geeks 16mm Lunch 3-31-2025 Bye bye March! See you next year! Now it's time for some 16mm films! #16mmfilms #avgeeks The Monkey and the Crab MOS Use Pesticide Safely PSA (from NARA) Let's Make Up A Story Carnival Comes To Town Woodland Indians of Early America (Rev) And Of Course You 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 4058 https://avgeeks.videonest.co/videos/363460/av-geeks-16mm-lunch-3-28-2025 https://img.videonest.org/gamma/363460_thumbnail_resized_v2.webp https://gamma.videonest.org/363460_video_v3.mp4 AV Geeks 16mm Lunch 3-28-2025 You can't have a real Friday without some reels.. of 16mm films! Amiright?! #16mmfilms #avgeeks 306-lss-16 4 Jingle Bells Borax Hoja Betrayed Shot-put, the 2025-03-29T00:00:00.000Z yes A/V Geeks 16mm Films no 3769 https://avgeeks.videonest.co/videos/364908/stringer-portrait-of-a-newsreel-1979 https://img.videonest.org/gamma/364908_thumbnail_resized_v2.webp https://gamma.videonest.org/364908_video_v3.mp4 Stringer: Portrait Of A Newsreel (1979) "Stringer: Portrait Of A Newsreel" chronicles the life of Mike Giddinger, a freelance cameraman who captured unique and often absurd stories for newsreels in the early 20th century. The film showcases Giddinger's adventures, from motorcycle races involving turkey chases to documenting significant events like labor strikes and natural disasters. Through his lens, viewers experience a blend of humor, invention, and the challenges of capturing real-life moments, highlighting the evolution of newsreel storytelling before the rise of television. Keywords Mike Giddinger, newsreel, freelance cameraman, motorcycle race, turkey chase, labor strikes, natural disasters, absurdity, 1930s, documentary LIMITED DISTRIBUTION. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1706 https://avgeeks.videonest.co/videos/364909/the-big-yellow-schooner-to-byzantium-1977 https://img.videonest.org/gamma/364909_thumbnail_resized_v2.webp https://gamma.videonest.org/364909_video_v3.mp4 The Big Yellow Schooner To Byzantium (1977) Narrated by Henry Fonda The film "The Big Yellow Schooner to Byzantium" explores the importance of inclusive education for severely and profoundly handicapped children within the public school system. It emphasizes the need for awareness and sensitivity towards these children's potential, advocating for their right to an education and social integration. The narrative highlights the collaboration between parents and educators to create a supportive environment that fosters growth and development, challenging societal norms that isolate these children. The film ultimately conveys a message of hope and the belief that all individuals, regardless of their abilities, can achieve a fulfilling life. Keywords inclusive education, handicapped children, public schools, human rights, awareness, potential, collaboration, parents, educators, social integration, growth, development, hope Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 927 intellectual disabilitymental retardationschool busempty classroomdisability rightssocial issuesdocumentaryspecial educationinclusive educationaccessible educationschooleducationstudents with disabilities https://avgeeks.videonest.co/videos/364910/summer-of-opportunity-1960s https://img.videonest.org/gamma/364910_thumbnail_resized_v2.webp https://gamma.videonest.org/364910_video_v3.mp4 Summer Of Opportunity (1960s) The film presents a promotional message by Alistair Cook about the PF Collier vacation earnings program aimed at college students. It highlights the unique educational opportunities available through summer work experiences, travel, and earning potential while working with a major corporation. Cook shares anecdotes from his own experiences and testimonials from participants who gained valuable skills, financial rewards, and cultural exposure. The program emphasizes personal growth, networking, and the importance of practical experience in education. Keywords summer vacation, education, travel, PF Collier, college students, work experience, earning potential, personal growth, networking, Alistair Cook Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 840 Summer VacationTravelAdventureDocumentaryMPO Television FilmsAlistair Cooke https://avgeeks.videonest.co/videos/364911/the-family-altar-1956 https://img.videonest.org/gamma/364911_thumbnail_resized_v2.webp https://gamma.videonest.org/364911_video_v3.mp4 The Family Altar (1956) "The Family Altar" depicts a family's experience during a smallpox outbreak that affects their young daughter, Susie. As the family navigates quarantine and fear, they find comfort and strength through their faith and family devotions. The story emphasizes the importance of relying on God during difficult times and the supportive role of community. Ultimately, the family decides to hold evening devotions, inspired by their experiences, to foster spiritual growth and resilience. Keywords family, smallpox, quarantine, faith, community, devotion, healing, support, family altar Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1562 https://avgeeks.videonest.co/videos/364912/rx-for-fire-1960s https://img.videonest.org/gamma/364912_thumbnail_resized_v2.webp https://gamma.videonest.org/364912_video_v3.mp4 Rx For Fire (1960s) The seminar focuses on fire safety and prevention in hospitals, emphasizing the dangers of oxygen-enriched environments and the importance of quick response in case of fire. It covers the use of various fire extinguishers, fire alarm systems, and the necessity of maintaining a clean and organized environment to prevent fire hazards. The seminar also highlights the significance of proper training, teamwork, and the need for established evacuation plans tailored to each hospital's needs. Keywords fire safety, fire prevention, hospitals, oxygen hazards, fire extinguishers, fire alarms, evacuation plans, training, fire hazards, housekeeping Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1146 fire safetyfire preventionhospital firefire drilloxygen safetyNorth Memorial HospitalMinneapolisMinnesotasafety trainingmedical trainingemergency preparedness https://avgeeks.videonest.co/videos/364913/social-development-1950 https://img.videonest.org/gamma/364913_thumbnail_resized_v2.webp https://gamma.videonest.org/364913_video_v3.mp4 Social Development (1950) The film follows the Jones and Brown families as they spend summer at the beach, highlighting the development of their children from infancy to early childhood. It explores the stages of social development, emphasizing how children interact, play, and form friendships over the years. The narrative discusses the importance of play, the emergence of individuality, and the impact of parental guidance on children's social skills. As they grow, children navigate friendships, conflicts, and the transition to adolescence, learning to balance personal identity with social relationships. Keywords social development, childhood, friendships, play, individuality, parenting, growth stages, adolescence, family dynamics Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 920 Family ReunionChild DevelopmentSummer VacationBeachSocial InteractionPlayChildrenFamily FunSummer ActivitiesBeach FunKids ActivitiesEducational ActivitiesChild PsychologyDevelopmentVacation https://avgeeks.videonest.co/videos/364914/special-equipment-rescues-1974 https://img.videonest.org/gamma/364914_thumbnail_resized_v2.webp https://gamma.videonest.org/364914_video_v3.mp4 Special Equipment Rescues (1974) Discusses essential scuba diving safety and rescue techniques. It highlights the importance of following safety rules, such as not diving alone and knowing how to use rescue equipment effectively. It demonstrates various rescue methods, including the removal of a weight belt, inflating life vests, and using paddleboards and rescue tubes. The film emphasizes that proper training and equipment can significantly enhance a rescuer's ability to save lives in emergencies. Keywords scuba diving, rescue techniques, safety rules, weight belt, life vest, buoyancy, paddleboard, rescue tube, emergency equipment, lifesaver training LIMITED DISTRIBUTION. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 587 water safetyunderwater rescuelife savingscuba divingRed Crossemergency responserescue techniqueswater sports safetydiving safetyfirst aidCPRsurvival skillsocean safetywater rescuesafety training https://avgeeks.videonest.co/videos/364915/to-forgive-a-thief-1966 https://img.videonest.org/gamma/364915_thumbnail_resized_v2.webp https://gamma.videonest.org/364915_video_v3.mp4 To Forgive A Thief (1966) The film follows Dusty, a teenager recently released from juvenile detention, who struggles to find acceptance and a place to belong. With the help of a supportive couple running a Christian halfway house, Dusty and other boys learn about family, forgiveness, and faith. Despite initial resistance, they begin to adapt to their new environment, but Dusty grapples with his past as a thief and the fear of never being forgiven. The story highlights themes of redemption, the importance of community, and the transformative power of love and faith. Keywords Dusty, halfway house, redemption, forgiveness, Christian faith, juvenile delinquency, community support, family, transformation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1840 https://avgeeks.videonest.co/videos/364917/farm-family-in-winter-1967 https://img.videonest.org/gamma/364917_thumbnail_resized_v2.webp https://gamma.videonest.org/364917_video_v3.mp4 Farm Family In Winter (1967) The film depicts life on a farm during winter, showcasing the challenges and adaptations farmers face in this season. It highlights the transition from traditional farming methods to more scientific approaches, emphasizing the importance of livestock care and modern machinery. The farmer reflects on his experiences, the role of his son in managing the farm, and the seasonal changes affecting both crops and animals. The narrative also touches on family traditions, like selecting a Christmas tree, and the reliance on veterinary care for sick animals. Keywords farm, winter, livestock, machinery, family, veterinary care, Christmas tree, farming methods, challenges, adaptation LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 921 snowmobiletobogganwinter farmfarm familyBluff Hillwinter activitiesfamily funwinter sportssnowfamily documentaryoutdoor activitiesrural lifewinter landscapehillfarm https://avgeeks.videonest.co/videos/364918/looking-at-reptiles-1964 https://img.videonest.org/gamma/364918_thumbnail_resized_v2.webp https://gamma.videonest.org/364918_video_v3_360.mp4 Looking At Reptiles (1964) The film discusses the evolution and characteristics of reptiles, tracing their lineage back over 150 million years to the time of the dinosaurs. It highlights the few surviving groups of reptiles today, such as turtles, snakes, and crocodilians, detailing their unique adaptations, behaviors, and habitats. The film emphasizes the importance of reptiles in the ecosystem and the threats they face due to human activities, urging viewers to consider conservation efforts to protect these ancient creatures. Keywords reptiles, evolution, dinosaurs, tuatara, crocodilians, turtles, snakes, conservation, ecosystem, adaptation LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 623 ReptilesTuataraCrocodilesLizardsNew ZealandDinosaursAlligatorsSnakesCold-bloodedEggsWildlife DocumentaryNew Zealand WildlifeReptilian LifeAncient ReptilesRare Reptiles https://avgeeks.videonest.co/videos/364919/claudius-boy-of-ancient-rome-1964 https://img.videonest.org/gamma/364919_thumbnail_resized_v2.webp https://gamma.videonest.org/364919_video_v3_360.mp4 Claudius: Boy Of Ancient Rome (1964) This film starts with some water damage. Set in the second century, this film follows the life of Claudius, a Roman boy, amidst the grandeur of ancient Rome. It explores his education, friendship with Vistus, a slave, and the societal norms of the time. Claudius learns about virtues like courage, loyalty, and obedience while grappling with the realities of slavery and the privileges of his noble status. As he navigates childhood and the expectations of becoming a man, the story culminates in a poignant reflection on growth and the transition from boyhood to manhood. Keywords Claudius, ancient Rome, boyhood, slavery, education, virtues, friendship, nobility, transition, growth LIMITED DISTRIBUTION. 2025-03-31T00:00:00.000Z yes A/V Geeks 16mm Films no 966 Ancient RomeRoman EmpireeducationchildrenschoolClaudiusGreekwax tabletsRoman educationAncient Civilizationhistory documentaryclassical education https://avgeeks.videonest.co/videos/364920/stapler-geeks-lunch-4-1-2025 https://img.videonest.org/gamma/364920_thumbnail_resized_v2.webp https://gamma.videonest.org/364920_video_v3_360.mp4 Stapler Geeks Lunch 4-1-2025 Thanks for all your interest in my collection! Excited to show you more! #staplers4life #staplergeeks 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 2358 https://avgeeks.videonest.co/videos/370489/revealing-eye-1972 https://img.videonest.org/gamma/370489_thumbnail_resized_v2.webp https://gamma.videonest.org/370489_video_v3_360.mp4 Revealing Eye (1972) The film "Revealing Eye" explores the evolution of photography and cinematography in capturing movement that is imperceptible to the naked eye. It highlights early experiments by pioneers like Eadweard Muybridge and Mare, who developed techniques to analyze motion through sequential images and time-lapse photography. The film discusses the advancements in high-speed photography, allowing the observation of rapid events such as a bullet piercing glass or the intricate movements of living organisms. It also showcases various applications of these techniques in understanding biological processes, mechanical functions, and natural phenomena, revealing the unseen dynamics of life and the universe. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1111 ChronophotographyEadweard Muybridgemotion picture cameraanimal locomotioncatdiscus throwmotion studiesphotography19th centuryscience historytechnology historyinvention https://avgeeks.videonest.co/videos/370490/vd-quiz-getting-the-answers-right-1977 https://img.videonest.org/gamma/370490_thumbnail_resized_v2.webp https://gamma.videonest.org/370490_video_v3.mp4 VD Quiz: Getting The Answers Right (1977) Leonard Nimoy discusses the prevalence and misconceptions surrounding sexually transmitted diseases (STDs), emphasizing the importance of awareness, diagnosis, and treatment. It highlights that a case of a sexually transmissible disease is contracted every five seconds in America, with millions of cases reported annually. The film features conversations among characters discussing symptoms, the need for medical check-ups, and the importance of informing sexual partners about potential infections. It dispels common myths regarding the transmission and prevention of STDs, stressing that birth control pills do not prevent STDs and that proper medical diagnosis is crucial for treatment. The film concludes by encouraging viewers to seek regular check-ups and to be proactive about their sexual health. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1488 https://avgeeks.videonest.co/videos/370491/how-to-divide-fractions-1948 https://img.videonest.org/gamma/370491_thumbnail_resized_v2.webp https://gamma.videonest.org/370491_video_v3.mp4 How To Divide Fractions (1948) We've shown you the entire overscanned frame so you can see the sprockets and the optical soundtrack The film explains how to divide fractions using a systematic approach. It demonstrates the process of determining how many times a fraction fits into a whole number by inverting the fraction and multiplying it by the whole number. Various examples illustrate the method, showing its practical applications in real-life scenarios such as measuring ribbon and constructing models. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 629 fractionsmathelementary mathvisual learningproblem solvingmeasurementdivisioneducational videokids learningmathematics educationfraction problemsvisual mathelementary schoolmath helplearning resources https://avgeeks.videonest.co/videos/370492/martin-the-snake-charmer-1987 https://img.videonest.org/gamma/370492_thumbnail_resized_v2.webp https://gamma.videonest.org/370492_video_v3.mp4 Martin: The Snake Charmer (1987) Features Martin, a snake charmer from Sri Lanka, who shares insights about his homeland, lifestyle, and the unique traditions of his gypsy family. He describes Sri Lanka's beauty, the significance of tourism, and the art of snake charming, which he learned from his father. Martin discusses the challenges he faces, including societal expectations regarding marriage and the dangers of working with snakes. He and his friend Raja embark on a journey to the capital city, Colombo, to earn money for their families, highlighting their experiences and the cultural practices of their community. LIMITED DISTRIBUTION. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1056 Snake CharmersSri LankaColomboNomadsFishingIndian OceanTeluguMartinDocumentary FilmSri Lankan CultureTraditional FishingTravel DocumentarySri Lankan NomadsCoastal LifeCultural Traditions https://avgeeks.videonest.co/videos/370493/matter-matter-everywhere-how-materials-change-silent-footage-1970 https://img.videonest.org/gamma/370493_thumbnail_resized_v2.webp https://gamma.videonest.org/370493_video_v3.mp4 Matter Matter Everywhere: How Materials Change (silent footage, 1970) We are tracking down the soundtrack.. Matter, Matter Everywhere: How Materials Change (1970) is an 11-minute color educational film produced by Coronet Films. Aimed at introducing basic concepts in physics and chemistry, the film illustrates a variety of physical and chemical changes using familiar household examples. These include sawing wood, mixing plaster, dissolving sugar in water, burning wax, baking bread, and rusting iron. Through these everyday scenarios, the film helps students understand how materials change form and properties, highlighting the distinction between reversible physical changes and irreversible chemical reactions. It serves as a clear and relatable resource for teaching foundational ideas about matter and material transformations. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 641 science experimentwoodwatergravelmaterials changejigsawphysicschemistryeducationalsciencetransformationexperimentmaterial sciencephysical changeschemical changes https://avgeeks.videonest.co/videos/370494/hollywood-usa-1960s https://img.videonest.org/gamma/370494_thumbnail_resized_v2.webp https://gamma.videonest.org/370494_video_v3.mp4 Hollywood, USA (1960s?) "Hollywood USA" explores the iconic status of Hollywood as a symbol of the movie industry, emphasizing its evolution from silent films to modern cinema. It highlights the importance of stars in shaping the entertainment landscape and introduces the Movie Land Wax Museum, dedicated to immortalizing the great performers of film history. The film features various legendary actors and their contributions to cinema, showcasing the meticulous work behind creating wax figures and sets that celebrate the magic of Hollywood. Keywords Hollywood, movie industry, stars, Movie Land Wax Museum, entertainment, film history, wax figures, legendary actors, cinema evolution Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1723 https://avgeeks.videonest.co/videos/370495/preventative-lifeguarding-1974 https://img.videonest.org/gamma/370495_thumbnail_resized_v2.webp https://gamma.videonest.org/370495_video_v3.mp4 Preventative Lifeguarding (1974) The film emphasizes the critical role of lifeguards in preventing accidents and ensuring safety at swimming facilities. It outlines essential lifeguarding practices, including constant vigilance, effective communication, and the importance of preventive measures. Lifeguards must enforce rules, monitor hazards, and maintain proper equipment to handle emergencies. The film also highlights the need for a buddy system among swimmers, proper training, and regular breaks for lifeguards to maintain alertness. Keywords lifeguarding, safety, prevention, emergencies, swimming pools, communication, training, buddy system, vigilance, equipment 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 601 lifeguard rescueocean rescueDaytona BeachFloridawater safetyemergency responseRed Crossbeach safetyfirst aidrescuewater rescuelifeguardsocean safetyFlorida beachesemergency services https://avgeeks.videonest.co/videos/370496/age-of-ballyhoo-edited-1979 https://img.videonest.org/gamma/370496_thumbnail_resized_v2.webp https://gamma.videonest.org/370496_video_v3.mp4 Age Of Ballyhoo (edited, 1979) Narrated by Gloria Swanson. "Age of Ballyhoo" captures the vibrant and transformative decade of the 1920s in America, highlighting the cultural, technological, and social changes of the era. It reflects on the post-war optimism, the rise of the automobile, the boom in consumerism, and the emergence of organized crime during Prohibition. The film showcases key figures and events, including Gloria Swanson's film debut, the fame of Babe Ruth and Charles Lindbergh, and the societal shifts that defined the Jazz Age. Through authentic documents, songs, and films, it portrays the 1920s as a time of excitement and innovation, while also hinting at the underlying challenges of the period. Keywords 1920s, Jazz Age, Gloria Swanson, Roxy Theater, automobiles, Prohibition, organized crime, Babe Ruth, Charles Lindbergh, consumerism, cultural change, technology 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1365 https://avgeeks.videonest.co/videos/370497/beating-the-booze-blues-1977 https://img.videonest.org/gamma/370497_thumbnail_resized_v2.webp https://gamma.videonest.org/370497_video_v3.mp4 Beating The Booze Blues (1977) Hosted by Lawrence Hilton-Jacobs. "Beating the Booze Blues" is an educational program created by high school students aimed at addressing alcohol use and abuse among youth. The film features skits, songs, and discussions about the effects of drinking, emphasizing the societal pressures to consume alcohol and the consequences of excessive drinking. Through demonstrations, including a breathalyzer test and role-playing scenarios, the program highlights the dangers of alcohol and encourages viewers to make informed decisions about drinking. Keywords alcohol abuse, youth education, peer pressure, social drinking, health awareness, alcohol effects, skits, breathalyzer test 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1333 https://avgeeks.videonest.co/videos/370498/colombia-1961 https://img.videonest.org/gamma/370498_thumbnail_resized_v2.webp https://gamma.videonest.org/370498_video_v3.mp4 Colombia (1961) The film follows the daily life of the Romero family living in Bogotá, Colombia. It highlights the roles of each family member, including the father, a geography and history professor, and the aspirations of the children. The story delves into Colombia's geography, culture, and economy, showcasing major cities like Medellín, Barranquilla, and Cartagena, along with the importance of coffee production. It emphasizes the blend of different cultures and lifestyles within the country, as well as the family's connection to their heritage and future aspirations. Keywords Bogotá, Colombia, Romero family, daily life, education, geography, culture, coffee production, Medellín, Barranquilla, Cartagena, family dynamics Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1073 BogotaColombiafamily lifedaily routineschoolsoccerUniversity AndesshoppingEducationCultureUniversityAndesColombia CultureFamily in BogotaDaily Life https://avgeeks.videonest.co/videos/370499/healthwise-good-eatin-1981 https://img.videonest.org/gamma/370499_thumbnail_resized_v2.webp https://gamma.videonest.org/370499_video_v3.mp4 Healthwise: Good Eatin' (1981) The film emphasizes the importance of healthy eating habits and a balanced diet. It contrasts nutritious food choices with junk food, illustrating how proper nutrition fuels the body like gasoline fuels a car. Various food groups are introduced, highlighting their benefits, while also warning against the pitfalls of excessive junk food consumption. The narrative centers around a character named Spinner who learns to make healthier food choices, ultimately leading to improved energy and well-being. Keywords healthy eating, balanced diet, food groups, nutrition, junk food, energy, Spinner, healthwise, choices 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 942 HealthWisehealthy eatingchild healthnutritionCoronet FilmsTake III https://avgeeks.videonest.co/videos/370500/graduation-a-follow-up-1973 https://img.videonest.org/gamma/370500_thumbnail_resized_v2.webp https://gamma.videonest.org/370500_video_v3.mp4 Graduation: A Follow Up (1973) Narrated by Burt Lancaster. The film follows Johnny, a young man with developmental challenges, as he navigates his journey from childhood to graduation. Despite being accepted by his peers in the neighborhood, Johnny faces loneliness when his friends move on to first grade without him. After attending a private school, he learns basic self-care and gains friendships but struggles with the transition to adulthood. Graduation brings uncertainty as he is not ready for independence, and his future options are limited due to a lack of accessible programs for young adults with disabilities. The film highlights the challenges faced by individuals like Johnny in finding social connections and meaningful activities post-school. Keywords Johnny, graduation, developmental challenges, social isolation, friendships, independence, sheltered workshops, activity centers, community support Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 903 intellectual disabilityspecial needschild developmentparentinginclusive educationschoolchildren with disabilitiesspecial educationearly interventiondevelopmental delaysfamily supporteducational resourcesinclusive classroomsdisability awarenesschildcare https://avgeeks.videonest.co/videos/370501/high-jump-1960 https://img.videonest.org/gamma/370501_thumbnail_resized_v2.webp https://gamma.videonest.org/370501_video_v3.mp4 High Jump (1960) The film "High Jump" provides an in-depth analysis of high jump techniques, focusing on the straddle or belly roll style as the most efficient method. It emphasizes the importance of lifting the center of gravity and achieving clearance over the crossbar. Key aspects discussed include the significance of proper takeoff, the role of the lead leg swing, and the necessity of separating the lift and roll phases during the jump. The film also highlights the importance of warm-up routines, conditioning, and the role of coaching in improving performance. Keywords high jump, straddle jump, belly roll, technique, center of gravity, lift, clearance, takeoff, lead leg swing, warm-up, conditioning, coaching Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 785 high jumptrack and fieldYale Universityinstructional filmFrank RyanYale Athletic Associationsports trainingathletic techniquesjump techniquefield eventscollege sportsuniversity sportsinstructional videosports instructioncompetitive sports https://avgeeks.videonest.co/videos/370502/kenji-comes-home-ca-1947 https://img.videonest.org/gamma/370502_thumbnail_resized_v2.webp https://gamma.videonest.org/370502_video_v3.mp4 Kenji Comes Home (ca. 1947) "Kenji Comes Home" portrays the struggles of Kenji Marawa, a soldier returning to Japan two years after World War II and the atomic bombing of Hiroshima. He finds his hometown unrecognizable, filled with ruins and strangers. As he searches for work amidst widespread unemployment, he befriends a boy named Shirou and reconnects with Aki, the sister of a deceased friend. Kenji navigates the complexities of post-war Japan, grappling with the concepts of democracy, labor unions, and the allure of communism. His journey involves personal growth, the search for identity, and the quest for faith in a world marked by chaos and uncertainty. Ultimately, Kenji's story reflects the broader challenges faced by a nation rebuilding itself after devastation. Keywords Kenji, Japan, post-war, Hiroshima, democracy, communism, friendship, identity, labor union, faith Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 2062 https://avgeeks.videonest.co/videos/370503/defenses-releases-and-escapes-1974 https://img.videonest.org/gamma/370503_thumbnail_resized_v2.webp https://gamma.videonest.org/370503_video_v3.mp4 Defenses, Releases And Escapes (1974) The film focuses on the essential techniques for lifesavers to safely rescue individuals in distress without endangering themselves. It highlights various scenarios where rescuers must handle panicky victims, employing strategies like blocking, turning, and escaping from holds. The film emphasizes the importance of training and preparedness, demonstrating effective techniques for releases and escapes to ensure the safety of both the rescuer and the victim. Keywords lifesaving, water safety, rescues, techniques, training, escapes, double drowning, victim, rescuer, safety 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 494 LifesavingWater SafetyAmerican Red CrossRescue TechniquesDrowningSwimming PoolFirst AidEmergency ResponseWater RescueCPRSafety TrainingPreventionSurvival SkillsSwimmingAquatic Safety https://avgeeks.videonest.co/videos/370504/happy-money-1969 https://img.videonest.org/gamma/370504_thumbnail_resized_v2.webp https://gamma.videonest.org/370504_video_v3.mp4 Happy Money (1969) Features Jerry Mathers ("Leave It To Beaver")! "Happy Money" is a film centered around a youth group's innovative approach to stewardship, emphasizing joy and celebration in giving. The project, initiated by a young girl named Linda, aims to change the perception of stewardship from a serious obligation to a joyful expression of gratitude. The film depicts discussions among family members and youth about the importance of positive attitudes towards giving, culminating in a performance that illustrates their experiences and lessons learned. The central message promotes the idea that stewardship can be a joyful and fulfilling part of life, rather than a burdensome duty. Keywords stewardship, joy, youth group, giving, celebration, gratitude, project, family, attitudes, Christian values 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1605 https://avgeeks.videonest.co/videos/370505/leo-beuerman-1969 https://img.videonest.org/gamma/370505_thumbnail_resized_v2.webp https://gamma.videonest.org/370505_video_v3.mp4 Leo Beuerman (1969) Nominated for an Academy Award,"Leo Beuerman" is a poignant documentary about a man who has lived in a self-imposed prison due to his physical disabilities. Despite his limitations, Leo finds purpose in life through repairing clocks, selling goods from his cart, and maintaining a sense of independence. He reflects on his past, the challenges he has faced, and his determination to overcome adversity. Leo's story is a testament to the human spirit's resilience and the importance of connection, purpose, and community. Keywords Leo Beuerman, documentary, disability, independence, adversity, resilience, community, purpose, self-imposed prison, human spirit Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 834 clock repairwatch repairvisual impairmentLeo BeuermanDocumentaryBiographicalJobDisabilityrepairwatchmakertimekeepingcraftsmanshipblind watchmakerskillperseverance https://avgeeks.videonest.co/videos/370506/the-fossil-story-1953 https://img.videonest.org/gamma/370506_thumbnail_resized_v2.webp https://gamma.videonest.org/370506_video_v3.mp4 The Fossil Story (1953) *The Fossil Story* (1953) is a **19-minute educational film** produced by **William E. Hockey and Associates** in collaboration with **Shell Oil Company**. The film explores the **earth’s prehistoric past** through the study of **fossil remains**, highlighting how fossils serve as a **record of ancient life**. It connects these discoveries to the presence of **natural resources** such as **oil, iron, and gemstones**, showing their geological significance. Featuring striking scenes from iconic locations like the **Grand Canyon**, **Petrified Forest**, and **La Brea Tar Pits in Los Angeles**, the film offers both scientific insight and visual grandeur, making it an engaging resource on **paleontology and natural history**. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 926 Grand CanyonGeologyPaleontologyPrehistoricFossilRock LayersPetroleumOil ExplorationGeologicalDocumentaryScienceAncientEarth ScienceSedimentary RockExploration https://avgeeks.videonest.co/videos/370507/chuckie-1987 https://img.videonest.org/gamma/370507_thumbnail_resized_v2.webp https://gamma.videonest.org/370507_video_v3.mp4 Chuckie (1987) The film tells the story of Lucy, a well-behaved girl who eagerly awaits the arrival of her baby brother, Chucky. Initially, Lucy struggles with Chucky's presence, feeling neglected and frustrated as her life changes. However, as time passes, she begins to bond with him, helping him with his chores and even eating his carrots. Ultimately, Lucy learns to embrace her new role as a big sister, finding joy in their relationship. Keywords Lucy, Chucky, baby brother, family, sibling rivalry, bonding, childhood, love, adjustment LIMITED DISTRIBUTION. 2025-04-06T00:00:00.000Z yes A/V Geeks 16mm Films no 819 Lucybaby brothernew babyhelping momputting toys awayeating carrotsfamilykidsadorablecutetoddlersiblingcareanimationcartoons https://avgeeks.videonest.co/videos/370508/what-is-cerebral-palsy-1948 https://img.videonest.org/gamma/370508_thumbnail_resized_v2.webp https://gamma.videonest.org/370508_video_v3.mp4 What Is Cerebral Palsy? (1948) The film discusses the historical misconceptions surrounding cerebral palsy, emphasizing its causes, symptoms, and treatment options. It explains that cerebral palsy can result from various factors, including brain hemorrhages and oxygen deprivation, rather than solely from birth injuries. The documentary highlights the importance of early diagnosis and individualized treatment, showcasing advancements in medical science, therapy, and educational approaches for affected children. It also stresses the significance of supportive environments and recreational activities in improving the quality of life for those with cerebral palsy. Keywords cerebral palsy, causes, treatment, misconceptions, diagnosis, therapy, education, children, medical advancements, support Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1123 Cerebral PalsyBrain DamageMuscle ControlOxygen SupplyHemorrhageStrokeNeurological DisordersChild NeurologyPaediatric HealthMedical EducationHealth Information https://avgeeks.videonest.co/videos/370509/australia-challenge-of-a-growing-nation-1966 https://img.videonest.org/gamma/370509_thumbnail_resized_v2.webp https://gamma.videonest.org/370509_video_v3.mp4 Australia Challenge Of A Growing Nation (1966) The film follows Tony Maretta, an Italian immigrant who travels over 10,000 miles to Australia, seeking opportunity and belonging in a growing nation. Australia welcomes over 100,000 immigrants annually, with a diverse population primarily of British descent. The film highlights the challenges of the Australian landscape, the agricultural industry, and the contributions of both new and old Australians in developing the country's economy. It emphasizes the importance of hard work, community, and the pursuit of a better life in a land filled with promise. Keywords immigration, Australia, opportunity, agriculture, economy, community, diversity, hard work, landscape, culture LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1004 AustraliaImmigrationHistory1966SydneyMelbourneBritishCaptain James CookQueen VictoriaDocumentaryMcGraw-HillTravel https://avgeeks.videonest.co/videos/370510/cheese-a-matter-of-taste-1986 https://img.videonest.org/gamma/370510_thumbnail_resized_v2.webp https://gamma.videonest.org/370510_video_v3.mp4 Cheese- A Matter Of Taste (1986) The film explores the rich cheese culture of France, highlighting the variety of cheeses produced across different regions. It details the traditional methods of cheese-making, from selecting quality milk to the aging processes in caves, and emphasizes the French dedication to their culinary heritage. The documentary showcases various types of cheese, including Roquefort, Brie, and goat cheese, explaining their unique characteristics and the artisanal practices involved in their production. Keywords cheese, France, Roquefort, Brie, cheese-making, traditions, dairy farming, culture, artisan, culinary heritage LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1294 https://avgeeks.videonest.co/videos/370511/as-for-me-and-my-house-1952 https://img.videonest.org/gamma/370511_thumbnail_resized_v2.webp https://gamma.videonest.org/370511_video_v3.mp4 As For Me And My House (1952) The film "As For Me and My House" explores the challenges faced by a young couple, Julie and Ned, as they navigate their marriage. Initially in love, their relationship deteriorates due to differing beliefs about religion. Julie values her faith deeply, while Ned is dismissive of it, leading to conflicts that threaten their union. Through a series of misunderstandings and arguments, they come to realize that love alone is not enough; they need a shared faith to reinforce their marriage. With guidance from Pastor Martin, they ultimately reconcile and commit to building their marriage on a foundation of faith in Christ. Keywords marriage, faith, religion, love, conflict, reconciliation, Pastor Martin, couple, shared beliefs, happiness Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1653 https://avgeeks.videonest.co/videos/370512/alaska-americas-northern-frontier-1965 https://img.videonest.org/gamma/370512_thumbnail_resized_v2.webp https://gamma.videonest.org/370512_video_v3.mp4 Alaska - America's Northern Frontier (1965) The film "Alaska: America's Northern Frontier" explores the unique geography, climate, and lifestyle of Alaska, highlighting its vast wilderness, rich natural resources, and the challenges faced by its residents. It discusses the state's separation from the Soviet Union, the impact of the Arctic Circle on daylight and temperatures, and the economic significance of fishing, tourism, and military presence. The film also covers transportation issues, the agricultural potential in the Matanuska Valley, and the traditional lifestyles of the Indigenous peoples of Alaska, emphasizing the blend of modern and traditional cultures. Keywords Alaska, geography, climate, wilderness, natural resources, fishing, tourism, military, transportation, agriculture, Indigenous peoples, culture LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1092 AlaskaGlaciersBering StraitArctic CircleJuneauSkagwaySitkaKetchikanDocumentary FilmTravel DocumentaryAlaskan WildernessArcticNature DocumentaryGeography of AlaskaUS National Parks https://avgeeks.videonest.co/videos/370513/boyhood-of-abraham-lincoln-2nd-ed-1992 https://img.videonest.org/gamma/370513_thumbnail_resized_v2.webp https://gamma.videonest.org/370513_video_v3.mp4 Boyhood Of Abraham Lincoln (2nd Ed, 1992) The film explores the early life of Abraham Lincoln, detailing his childhood in Kentucky and Indiana. It describes his family's struggles, including the death of his mother and sister, and highlights his strong work ethic and self-education through reading. Key moments include his experiences with the law, a significant trip to New Orleans that exposed him to slavery, and his eventual move to Illinois. The narrative captures Lincoln's transformation from a young boy into a determined man, setting the stage for his future as the 16th president of the United States. Keywords Abraham Lincoln, childhood, Kentucky, Indiana, family struggles, self-education, law, slavery, New Orleans, Illinois, president Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 769 Abraham LincolnboyhoodOhio RiverIndianaKentuckyfamilyAmerican HistoryBiographyHistorical DocumentaryChildhoodEarly LifePresident Lincoln https://avgeeks.videonest.co/videos/370514/report-from-africa-morocco-liberia-and-six-african-leaders-1957 https://img.videonest.org/gamma/370514_thumbnail_resized_v2.webp https://gamma.videonest.org/370514_video_v3.mp4 Report From Africa: Morocco, Liberia And Six African Leaders (1957) The film discusses the United States' involvement in Africa during the mid-20th century, highlighting American support for new governments in Morocco and Libya, including military aid and economic assistance. It emphasizes the strategic importance of military bases in Morocco and Libya for U.S. operations, particularly in relation to the Soviet threat. The film also features interviews with African leaders discussing independence, colonialism, and the need for self-determination. It concludes by stressing the importance of treating African nations with equality and dignity. Keywords United States, Africa, Morocco, Libya, military bases, independence, colonialism, economic assistance, African leaders, self-determination LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 833 Cold WarB-47 BombersUS Air ForceFrench MoroccoLibyamilitary basesEisenhowerguided missilesmilitary historystrategic air commandUS militaryNorth Africabomber aircraftCold War historyair power https://avgeeks.videonest.co/videos/370515/understanding-weather-precipitation-1992 https://img.videonest.org/gamma/370515_thumbnail_resized_v2.webp https://gamma.videonest.org/370515_video_v3.mp4 Understanding Weather: Precipitation (1992) The film follows Wesley, a trainee at the Weather Bureau of Investigation (WBI), as he learns about precipitation. Through a series of engaging lessons, he discovers the different forms of precipitation, such as rain, snow, and dew, and how they relate to temperature changes and water vapor in the air. Wesley's journey includes practical observations and experiments that help him understand how clouds form and the processes leading to precipitation. Ultimately, he learns that precipitation occurs when water droplets or ice crystals in clouds become too heavy to float and fall to the ground. Keywords Wesley, Weather Bureau of Investigation, precipitation, water vapor, clouds, temperature, dew, snow, rain, education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 817 precipitationweatheragent trainingrainsnowsleetweather forecastingmeteorological analysisWBIdew https://avgeeks.videonest.co/videos/370516/probability-1970 https://img.videonest.org/gamma/370516_thumbnail_resized_v2.webp https://gamma.videonest.org/370516_video_v3.mp4 Probability (1970) In the land of Howan, a bored Raja who never loses at games seeks a challenger to defeat him. He issues a proclamation offering riches to anyone who can beat him. Ali Mod, a clever young man, proposes a game he invented. Initially, the game ends in a draw, but Ali Mod explains the odds of their second game, revealing that certain numbers are statistically more likely to win. Ultimately, Ali Mod wins, and the Raja learns about probability and the importance of understanding odds in games. Keywords Raja, bored, games, challenge, Ali Mod, probability, odds, victory, proclamation, Howan LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 670 RajaHowdiastangame playingprobabilityanimatedstorytellingmatheducationAli Katt https://avgeeks.videonest.co/videos/370517/boyhood-of-george-washington-2nd-ed-1992 https://img.videonest.org/gamma/370517_thumbnail_resized_v2.webp https://gamma.videonest.org/370517_video_v3.mp4 Boyhood Of George Washington (2nd Ed, 1992) The film explores the early life of George Washington, detailing his childhood on a Virginia plantation, his family dynamics, and significant events that shaped his future. It highlights his relationships with his family, particularly his half-brother Lawrence, and his experiences as a young surveyor. The narrative follows Washington's transition from a boy dreaming of adventure to a young military officer, culminating in his early military experiences that foreshadow his future leadership in the American Revolution. Keywords George Washington, childhood, Virginia, plantation, family, surveying, military career, Mount Vernon, French and Indian War, first president Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 794 George WashingtonboyhoodVirginiaplantationfamily173217351738Englandearly lifechildhoodcolonial America https://avgeeks.videonest.co/videos/370518/survival-run-1979 https://img.videonest.org/gamma/370518_thumbnail_resized_v2.webp https://gamma.videonest.org/370518_video_v3.mp4 Survival Run (1979) Captures the intense experience of a competitive running event set in challenging terrain and one participant who is blind. Participants navigate steep paths, rocky areas, and thick fog as they race towards the finish line. The film emphasizes teamwork, determination, and the thrill of overcoming obstacles in a natural environment. Keywords Survival, competition, running, teamwork, obstacles, terrain, fog, determination, race LIMITED DISTRIBUTION. 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 696 Dipsea RaceBlind runnerguide runnermarathonrunningraceendurancesportsachievementinspirationathleticcompetitionvisual impairment https://avgeeks.videonest.co/videos/370519/weaving-1969 https://img.videonest.org/gamma/370519_thumbnail_resized_v2.webp https://gamma.videonest.org/370519_video_v3.mp4 Weaving (1969) The film provides an informative overview of the weaving process, highlighting the interlocking of warp and weft threads to create fabric. It explains the use of various looms, such as the backstrap loom and box loom, and demonstrates techniques for maintaining tension and achieving different patterns like tabby and twill weaves. The film emphasizes creativity in weaving by combining different materials and patterns. Keywords weaving, fabric, warp, weft, backstrap loom, box loom, patterns, tabby weave, twill weave, creativity 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 817 Backstrap LoomWeavingWarp ThreadsWeft YarnTextilesArts & CraftsHand WeavingLoom WeavingDIY WeavingTextile ArtsTraditional WeavingACI ProductionsStelios RoccosLois MoranErnest Ziegefeld https://avgeeks.videonest.co/videos/370520/navy-sailors-in-mediterranean-1930s https://img.videonest.org/gamma/370520_thumbnail_resized_v2.webp https://gamma.videonest.org/370520_video_v3.mp4 [Navy sailors in Mediterranean, 1930s?] This is an excerpt from an unknow film. Navy sailors explore the Mediterranean, visiting various locations including a British town, the Rock of Gibraltar, and the picturesque city of Venice. They experience local culture, historical sites, and the vibrant atmosphere of the Riviera, all while enjoying their time off from duty. The sailors appreciate the sights and adventures, from ancient ruins to gondola rides, highlighting the excitement of life in the Navy. Keywords Navy, Mediterranean, sailors, Gibraltar, Venice, travel, adventure, culture, ruins, gondola Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 426 Gibraltarshore leavesailorsrock climbingRivierascenic tourvintage filmtravelogueMediterraneanhistoricexplorationadventureclimbingcoastlinelandscape https://avgeeks.videonest.co/videos/370521/shakespeares-theater-henry-v-1961 https://img.videonest.org/gamma/370521_thumbnail_resized_v2.webp https://gamma.videonest.org/370521_video_v3.mp4 Shakespeare's Theater - Henry V (1961) The film explores the Elizabethan theater, focusing on Shakespeare's Globe Theater and its significance in London during his time. It discusses the limitations and conventions of the theater, including the absence of women on stage, the use of boy actors, and the audience's engagement with the performances. The film highlights the architecture of the Globe, the role of the audience, and the vibrant costumes that contributed to the theatrical experience. Keywords Shakespeare, Globe Theater, Elizabethan theater, London, boy actors, audience engagement, theater conventions, architecture, costumes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 818 Henry VShakespeareLaurence OlivierSir Laurence OlivierLord J. Arthur RankShakespeare's TheaterBritish CinemaClassic FilmEducational FilmHistorical DramaFilm adaptation of ShakespeareShakespearean performance https://avgeeks.videonest.co/videos/370522/a-christmas-visitor-1970s https://img.videonest.org/gamma/370522_thumbnail_resized_v2.webp https://gamma.videonest.org/370522_video_v3.mp4 A Christmas Visitor (1970s?) On Christmas morning, a fox prepares for a festive party, excited to celebrate his favorite holiday. However, he inadvertently disturbs a sleeping chipmunk while digging up a Christmas tree. The chipmunk, unfamiliar with Christmas, becomes hungry and starts eating all the food the fox had prepared. Despite the chaos, the other forest animals come to help, bringing more food and gifts. They remind everyone that the true spirit of Christmas lies in togetherness and sharing, leading to a joyful celebration despite the initial mishaps. Keywords Christmas, fox, chipmunk, party, forest animals, togetherness, sharing, holiday spirit 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 739 ChristmasChristmas partyChristmas treeStop MotionAnimalsmagpiefoxcatbunnyHolidayKidsCartoonsfestiveadventure https://avgeeks.videonest.co/videos/370523/understanding-weather-why-weather-changes-1992 https://img.videonest.org/gamma/370523_thumbnail_resized_v2.webp https://gamma.videonest.org/370523_video_v3.mp4 Understanding Weather: Why Weather Changes (1992) The film features a character named Wesley, who is in training at the Weather Bureau of Investigation. He learns about different air masses, their movements, and how they interact to cause weather changes. The training includes understanding high and low pressure systems, cold and warm fronts, and observing changes in weather conditions using various instruments. Wesley experiences firsthand the transition from a warm air mass to a cold front, noting changes in temperature, wind direction, and cloud types. Keywords Wesley, Weather Bureau of Investigation, air masses, weather changes, cold front, warm front, high pressure, low pressure, training, observation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 773 Weather ChangesAir MassesMeteorologyEducational FilmWeather BureauScience EducationAtmospheric ScienceWeather PatternsClimateEducational VideosMTI FilmCoronetWeather Forecasting https://avgeeks.videonest.co/videos/370524/darwin-and-the-theory-of-natural-selection-1967 https://img.videonest.org/gamma/370524_thumbnail_resized_v2.webp https://gamma.videonest.org/370524_video_v3.mp4 Darwin And The Theory Of Natural Selection (1967) In September 1835, Charles Darwin embarked on the HMS Beagle to the Galapagos Archipelago, where he observed unique species of plants and animals. His studies led him to question the prevailing belief that all species were created simultaneously. Noticing the distinct variations among species across the islands, Darwin theorized that they had descended from common ancestors brought over from the mainland. He proposed the concept of natural selection, suggesting that species evolve over generations through adaptation and competition for resources. His observations laid the groundwork for his revolutionary theory on the origins of species, which continues to influence modern science. Keywords Charles Darwin, HMS Beagle, Galapagos Islands, natural selection, species evolution, common ancestry, adaptation, competition, theory of evolution Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 750 Charles DarwinHMS BeagleGalapagos IslandsNatural SelectionTheory of EvolutionEvolutionary Biologyplant speciesanimal speciesGalapagos floraGalapagos faunaScientific DiscoveryDocumentary FilmDarwin's Theoryspecies adaptationIsland Biogeography https://avgeeks.videonest.co/videos/370525/indian-crafts-hopi-navajo-and-iroquois-1980 https://img.videonest.org/gamma/370525_thumbnail_resized_v2.webp https://gamma.videonest.org/370525_video_v3.mp4 Indian Crafts: Hopi, Navajo And Iroquois (1980) This film explores the traditional crafts of Native American tribes, specifically the Hopi, Navajo, and Iroquois. It highlights the craftsmanship of Hopi basket weaving and pottery, showcasing their techniques and cultural significance. The Navajo's weaving of wool blankets and rugs, as well as their silver jewelry making process, is also detailed. Additionally, the film discusses the Iroquois tradition of carving ceremonial masks from basswood trees. Each craft reflects the unique heritage and artistic expressions of these tribes. Keywords Hopi, Navajo, Iroquois, crafts, basket weaving, pottery, weaving, silver jewelry, traditional techniques, cultural heritage Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 717 Native Americanbasket makingpotteryyucca plantHopiNavajoIroquoisArts & CraftsTraditional CraftsIndigenous CultureNative American ArtHandicraftsCultural HeritageEducationHistory https://avgeeks.videonest.co/videos/370526/salt-essence-of-life-1979 https://img.videonest.org/gamma/370526_thumbnail_resized_v2.webp https://gamma.videonest.org/370526_video_v3.mp4 Salt - Essence Of Life (1979) "Salt: Essence of Life" explores the historical and contemporary significance of salt, detailing its extraction from the earth and oceans, its role in food preservation, livestock nutrition, and its various industrial uses. The film highlights how salt has shaped human civilization, from ancient trade routes to modern applications in healthcare and chemical production. It emphasizes salt's essential role in our daily lives, underscoring its necessity for health and well-being. Keywords salt, history, extraction, preservation, livestock, industrial uses, healthcare, civilization, nutrition, trade routes 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 1625 https://avgeeks.videonest.co/videos/370527/a-mexican-war-diary-1846-1958 https://img.videonest.org/gamma/370527_thumbnail_resized_v2.webp https://gamma.videonest.org/370527_video_v3.mp4 A Mexican War Diary 1846 (1958) Recounts the adventures of Samuel Chamberlain, who joins the U.S. Army during the Mexican-American War at the age of 16. He describes his journey from Boston to the war front, detailing encounters with Mexican soldiers, skirmishes, and the complexities of life in hostile territory. The narrative includes personal experiences with Mexican women, the brutality of war, and the moral dilemmas faced by soldiers. It culminates in the chaotic aftermath of battles, including the hanging of traitors and the celebration of peace. Keywords Mexican-American War, Samuel Chamberlain, adventure, skirmishes, brutality, soldiers, Mexican culture, personal stories, peace treaty, historical account 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 1045 Mexican-American WarSamuel ChamberlainU.S. ArmyWest PointZachary TaylorRio GrandeMonterreyBuena VistaAnimated DocumentaryHistory DocumentaryMilitary History https://avgeeks.videonest.co/videos/370528/evolution-of-man-1967 https://img.videonest.org/gamma/370528_thumbnail_resized_v2.webp https://gamma.videonest.org/370528_video_v3.mp4 Evolution Of Man (1967) The film explores the evolution of humans from ancient man-like creatures that lived millions of years ago in East Africa. It discusses the discovery of fossils and stone tools, the challenges in reconstructing the evolutionary timeline, and the theories proposed by Charles Darwin regarding natural selection. The narrative highlights key fossil finds, such as Australopithecus and Homo erectus, and examines the evolutionary pressures that led to the development of traits such as larger brains and tool-making capabilities. It raises questions about the origins of modern humans, the emergence of different races, and the ongoing genetic changes in humanity. Keywords evolution, fossils, natural selection, Charles Darwin, Australopithecus, Homo erectus, human ancestry, prehistoric, genetics, tool-making Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 818 Evolution of ManOlduvai Gorgefossil bonesnatural selectionEast African plainCharles Darwinhuman evolutionanthropologypaleontologyprimateshominidsfossilsscientific documentaryarchaeologyAfrica https://avgeeks.videonest.co/videos/370529/must-we-have-noise-1972 https://img.videonest.org/gamma/370529_thumbnail_resized_v2.webp https://gamma.videonest.org/370529_video_v3.mp4 Must We Have Noise (1972) *Must We Have Noise?* (1972) is an **11-minute color educational film** from the *Caring About Our Community Series*, produced by **Gordon-Kerckhoff Productions**. The film examines the **presence and impact of sound in everyday life**, from **natural ambient sounds** to the overwhelming barrage of **artificial noise** common in modern society. By drawing attention to the **often unnoticed or ignored sounds** around us, the film challenges viewers to reconsider their **acoustic environment**. Ultimately, it delivers a **subtle but powerful critique of noise pollution**, positioning it as a **major yet overlooked environmental issue**, and encourages greater awareness and responsibility in shaping a quieter, more mindful community. LIMITED DISTRIBUTION. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 680 familybeachchildren playingplaying outdoorsoutdoor playsummer funkidsactivitiesfamily funlifestylerecreationorange juicemaking juicetransistor radio https://avgeeks.videonest.co/videos/370530/the-european-economic-community-1965 https://img.videonest.org/gamma/370530_thumbnail_resized_v2.webp https://gamma.videonest.org/370530_video_v3.mp4 The European Economic Community (1965) The film discusses the formation and impact of the European Economic Community (EEC), highlighting its role in fostering international cooperation among member nations, including Germany, France, Italy, Belgium, Luxembourg, and the Netherlands. It details the economic goals of the EEC, such as eliminating tariffs, allowing free movement of labor and capital, and creating a common market. The narrative reflects on historical context, including the aftermath of World War II, the integration of the coal and steel industries, and the Treaty of Rome, which aimed to unify economic policies and increase trade among member states. The EEC's achievements include rising employment, improved living standards, and enhanced trade relations. Keywords European Economic Community, EEC, international cooperation, tariffs, common market, Treaty of Rome, economic integration, post-World War II, trade relations, employment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 795 European Economic Communityfree tradeinternational cooperationcommon marketeconomic goalsFranceGermanyItalyNetherlandsLuxembourgEuropean integrationpost-war Europeeconomic historyEEC1957 https://avgeeks.videonest.co/videos/370531/understanding-weather-winds-3rd-ed-1992 https://img.videonest.org/gamma/370531_thumbnail_resized_v2.webp https://gamma.videonest.org/370531_video_v3.mp4 Understanding Weather: Winds (3rd Ed, 1992) The film follows a character named Wesley as he trains to become an agent with the Weather Bureau of Investigation (WBI). Throughout his training, Wesley learns about wind, its invisibility, and how it is influenced by temperature differences and geographical features. He observes the effects of wind in both urban and rural settings, learns about jet streams, and discovers the significance of uneven heating by the sun. The film concludes with Wesley summarizing his lessons about wind systems and their patterns while expressing his preference for land over water. Keywords Wesley, Weather Bureau, wind, temperature differences, jet streams, uneven heating, training, observations, land, Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 831 Weather BureauMeteorologytrainingcloudswindairweatheranalysisscienceeducationCoronetMFI Film https://avgeeks.videonest.co/videos/370532/an-alphabet-of-weather-1991 https://img.videonest.org/gamma/370532_thumbnail_resized_v2.webp https://gamma.videonest.org/370532_video_v3.mp4 An Alphabet Of Weather (1991) An educational film that introduces children to the various elements of weather using the letters of the alphabet. Each letter represents a weather-related concept, such as air, clouds, temperature, and storms, providing a fun and engaging way to learn about the atmosphere and its changes. The film highlights the importance of weather in daily life and the roles of meteorologists in predicting it. Keywords weather, alphabet, education, children, meteorology, air, clouds, storms, temperature, precipitation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 811 WeatherStormsCloudsWindDegreesBallonsAir https://avgeeks.videonest.co/videos/370533/clay-in-action-1942 https://img.videonest.org/gamma/370533_thumbnail_resized_v2.webp https://gamma.videonest.org/370533_video_v3.mp4 Clay In Action (1942) The film demonstrates the process of sculpting a clay portrait, detailing the importance of armatures, measurements, and techniques used to create a three-dimensional representation. The sculptor begins with a sturdy base and applies strips of water clay, shaping them to follow the model's features. Measurements are taken to ensure accuracy, and the sculptor carves planes into the clay to form the facial features. The artist emphasizes personal interpretation, enhancing specific traits to express the model's character. The final result is a unique fusion of the model's appearance and the artist's vision, ready for casting or firing. Keywords sculpting, clay, portrait, armature, measurements, techniques, modeling, personal interpretation, character expression, casting Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 705 clay modelingwater claysculpturemodeling techniquesart tutorialhow to sculptclay sculpturesculpture tutorialart lessonChicago Teachers College https://avgeeks.videonest.co/videos/370534/biomes-tundra-1989 https://img.videonest.org/gamma/370534_thumbnail_resized_v2.webp https://gamma.videonest.org/370534_video_v3.mp4 Biomes: Tundra (1989) Discusses the tundra biome, highlighting its extreme climate characterized by low temperatures and a short growing season. It describes the unique adaptations of tundra wildlife, such as the muskox and arctic fox, which thrive in harsh conditions. The seasonal changes in the tundra are explored, detailing the brief summer when plant life flourishes and animals migrate to take advantage of the abundant food supply. As summer ends, the tundra prepares for the long, cold winter, leading to a decline in wildlife activity and the migration of many species. Keywords tundra, biome, climate, wildlife, muskox, arctic fox, permafrost, seasonal changes, migration, adaptation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 796 Musk OxArctic FoxArctic AnimalsTundra biomeclimate adaptationlayered furlow temperaturesanimal lifewildlife documentaryarctic wildlifenature documentaryadaptationsurvivalarctic ecosystemtundra ecosystem https://avgeeks.videonest.co/videos/370535/understanding-weather-storms-2nd-ed-1992 https://img.videonest.org/gamma/370535_thumbnail_resized_v2.webp https://gamma.videonest.org/370535_video_v3_360.mp4 Understanding Weather: Storms (2nd Ed, 1992) The film features a character named Wesley, who is training to become an agent with the Weather Bureau of Investigation (WBI). Throughout the film, Wesley experiences various weather phenomena, including hurricanes, thunderstorms, and tornadoes. He learns about the formation and characteristics of these storms, including how hurricanes develop over warm ocean waters and how tornadoes form within thunderstorms. The film emphasizes the importance of understanding weather patterns and staying safe during severe weather events. Keywords Wesley, Weather Bureau of Investigation, hurricane, thunderstorm, tornado, meteorology, weather patterns, training, safety Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 802 hurricanestormweathersatellitetrainingWeather BureauWBIInvestigationMeteorologyScienceEducation https://avgeeks.videonest.co/videos/370536/magnetic-electric-and-gravitational-fields-1961 https://img.videonest.org/gamma/370536_thumbnail_resized_v2.webp https://gamma.videonest.org/370536_video_v3.mp4 Magnetic, Electric, And Gravitational Fields (1961) The video explains the concepts of magnetic, electric, and gravitational fields using simple demonstrations. It shows how iron filings reveal the magnetic field around a magnet, how charged objects create electric fields that can attract materials, and how gravity creates a gravitational field that pulls objects toward the Earth. The video emphasizes that fields are invisible but their effects can be observed, and it discusses how these fields extend outwards in all directions from their sources. Keywords magnetic field, electric field, gravitational field, forces, iron filings, compass, charged objects, gravity, energy transfer LIMITED DISTRIBUTION. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 620 magnetismbar magnetiron filingscompasssteel rodmagnetic fieldscience experimentphysics experimenteducational videomagnetism experiment https://avgeeks.videonest.co/videos/370537/the-fun-of-being-thoughtful-kodachrome-1950 https://img.videonest.org/gamma/370537_thumbnail_resized_v2.webp https://gamma.videonest.org/370537_video_v3.mp4 The Fun Of Being Thoughtful (Kodachrome!, 1950) The film explores the concept of thoughtfulness through the Proctor family, who demonstrate its importance in daily life. The narrative follows Jane Proctor as she navigates family dynamics, learns the significance of being considerate, and helps her brother Eddie deal with a social dilemma regarding a girl he likes. The Proctors showcase how small acts of kindness and understanding can strengthen relationships and foster a caring environment. Keywords thoughtfulness, family, kindness, relationships, social dilemma, daily life, consideration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 519 familydinnermealtimethoughtfulnessground beefCoronet Instructional FilmsUnion Collegeinstructional filmhome economicscookingfood preparationfamily lifesocial studieseducationJane Proctor https://avgeeks.videonest.co/videos/370538/army-ants-a-study-of-social-behavior-1966 https://img.videonest.org/gamma/370538_thumbnail_resized_v2.webp https://gamma.videonest.org/370538_video_v3.mp4 Army Ants: A Study Of Social Behavior (1966) "Army Ants: A Study of Social Behavior" explores the complex social structures and behaviors of nomadic tropical army ants, which have evolved over 50 million years. The film details the organization of their colonies, consisting of a queen and thousands of workers, and illustrates their intricate foraging strategies during raids. Observations highlight the ants' ability to communicate through chemical trails, their unique nesting behaviors, and the dynamics of their reproductive cycles. The study emphasizes the importance of both field observations and laboratory experiments in understanding these fascinating insects. Keywords army ants, social behavior, colony organization, chemical trails, foraging strategies, reproductive cycles, field research, laboratory experiments LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1114 Army AntsEcitonBivouacSocial BehaviorInsect ColoniesAnimal BehaviorTropical AmericaScientific ObservationNature DocumentaryInsect SocietyAnt ColonyPredatorPreyForagingRaid https://avgeeks.videonest.co/videos/370539/walk-safe-young-america-1976 https://img.videonest.org/gamma/370539_thumbnail_resized_v2.webp https://gamma.videonest.org/370539_video_v3.mp4 Walk Safe! Young America (1976) Features June Lockhart! The film "Walk Safe Young America" is an educational short aimed at teaching children how to walk safely in urban environments. It emphasizes the importance of being aware of traffic, following safety signals, and using crosswalks. The narrative follows a character named Tommy, who learns about pedestrian safety after his pet, Sandy, is injured. The film covers various scenarios, including crossing streets, walking at night, and the proper way to exit vehicles. It stresses the need for vigilance and caution to prevent accidents. Keywords pedestrian safety, traffic awareness, children, urban environment, crosswalks, safety signals, educational film, injury prevention LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 940 child safetyschool safety patrolstreet safetycar accidentsafetychildrenschoolaccident preventionkids safetySandybad dreamfamily safetychild safety tipsstreet safety tipsschool safety https://avgeeks.videonest.co/videos/370540/what-is-the-church-1968 https://img.videonest.org/gamma/370540_thumbnail_resized_v2.webp https://gamma.videonest.org/370540_video_v3.mp4 What Is The Church? (1968) The film explores a church's community survey aimed at understanding the needs of its congregation and the surrounding area. It depicts the struggles between traditional views of church roles and the push for a more involved, service-oriented approach. Through discussions among church members, the narrative delves into the concept of the church as a body of people serving others, highlighting the importance of addressing social issues while maintaining spiritual commitments. Keywords church, community survey, involvement, service, spirituality, social issues, traditional views, congregation, ministering, youth, faith LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1747 https://avgeeks.videonest.co/videos/370541/survival-swimming-1975 https://img.videonest.org/gamma/370541_thumbnail_resized_v2.webp https://gamma.videonest.org/370541_video_v3.mp4 Survival Swimming (1975) The film demonstrates survival swimming techniques, emphasizing the importance of staying calm in emergencies. It teaches viewers how to utilize trapped air in clothing and boots to remain buoyant and floating. Various floating and treading techniques are explained, including the rotary kick, scissors kick, and breaststroke kick. The film also covers how to modify strokes for swimming with heavy clothing and provides tips on using clothing to create buoyancy and warmth in cold water situations. Keywords survival swimming, buoyancy, floating techniques, treading water, clothing flotation, emergency swimming, swimming strokes, water safety LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 461 Survival SwimmingWater SafetyRed CrossRotary KickScissor KickBreaststroke KickSwimming TechniquesSelf RescueWater RescueEmergency PreparednessSafety TrainingSurvival Skills Training https://avgeeks.videonest.co/videos/370542/portraits-of-aging-1978 https://img.videonest.org/gamma/370542_thumbnail_resized_v2.webp https://gamma.videonest.org/370542_video_v3.mp4 Portraits Of Aging (1978) Explores the lives of various elderly individuals, highlighting their experiences, joys, and challenges as they navigate aging. The film emphasizes the importance of community, creativity, and resilience, showcasing how these individuals continue to find purpose and joy in their lives despite the physical and emotional challenges they face. It also touches on themes of impermanence, the value of shared experiences, and the contributions of seniors to their communities. Keywords aging, community, resilience, creativity, impermanence, joy, shared experiences, elderly, life stories, support services Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1688 https://avgeeks.videonest.co/videos/370543/imagery-in-space-1971 https://img.videonest.org/gamma/370543_thumbnail_resized_v2.webp https://gamma.videonest.org/370543_video_v3.mp4 Imagery In Space (1971) Imagery in Space (1971) is an 11-minute experimental educational film produced by Burnford Film Productions in collaboration with ACI Films, Inc. Blending abstract visuals with an electronic soundtrack, the film explores how our perceptions of space—both physical and psychological—shape the way we relate to the world around us. With its trippy, psychedelic style, Imagery in Space invites viewers to consider how spatial awareness, movement, and visual cues influence human experience and understanding. Designed for classroom use, it offers a thought-provoking and sensory-rich journey, making it a standout example of early 1970s educational media with an avant-garde edge. LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 649 SurrealismAbstract FilmAnimationSpaceImageryAbstract AnimationExperimental FilmArt https://avgeeks.videonest.co/videos/370544/ashlad-and-his-good-helper-1968 https://img.videonest.org/gamma/370544_thumbnail_resized_v2.webp https://gamma.videonest.org/370544_video_v3.mp4 Ashlad And His Good Helper (1968) The story follows Ashlad, the youngest of three brothers, who sets out to build a magical ship that can travel on land, sea, and air to win the hand of a princess and half a kingdom. Despite his brothers' doubts, Ashlad receives help from a mysterious old man, leading him to successfully construct the ship. Along the way, he gathers a group of quirky companions, including Hungry Men, Whis Away, and Hot and Cold. They face various challenges set by the king, including consuming a massive storehouse of meat and retrieving water from the world's end. Ultimately, Ashlad outsmarts the king and wins the princess, leading to a joyful ending. Keywords Ashlad, magical ship, adventure, princess, brothers, challenges, companions, king, fairy tale 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 928 brotherskingdomkingshipforestchildrenstorytellingfairytaleadventureanimationkidsfamily https://avgeeks.videonest.co/videos/370545/concept-of-function-1959 https://img.videonest.org/gamma/370545_thumbnail_resized_v2.webp https://gamma.videonest.org/370545_video_v3.mp4 Concept Of Function (1959) This film discusses the concept of functions in mathematics, emphasizing their importance and modern formulations. It explains how to create ordered pairs from a set of numbers and illustrates how functions differ from other relations by ensuring that each input corresponds to a single output. The film uses various examples, including graphs and equations, to clarify the definitions of domain, range, and the unique relationship that defines a function. Keywords function, mathematics, ordered pairs, sets, domain, range, graphs, equations, high school algebra Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 958 McGraw-HillMathematicsfunctionsordered pairscoordinate systemAlgebraEducationText-FilmsRutgers UniversityYale University https://avgeeks.videonest.co/videos/370546/sheep-sheep-sheep-1970 https://img.videonest.org/gamma/370546_thumbnail_resized_v2.webp https://gamma.videonest.org/370546_video_v3.mp4 Sheep Sheep Sheep (1970) Sheep, Sheep, Sheep (1970), produced by Churchill Films, is a non-narrated visual meditation on the daily life and natural rhythms of sheep. Using only natural sounds, the film captures sheep as they graze, eat, sleep, wake, and move through the landscape, eventually making their way to the highlands. Through its quiet, observational style, the film evokes a sense of mood, pace, and connection to nature, offering viewers a contemplative experience that highlights the beauty and simplicity of pastoral life. LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 689 sheepgrazingwildlifenaturespringSheep's Springanimalsdocumentarywildlife documentaryspring grazingsheep wildlifenature documentary https://avgeeks.videonest.co/videos/370547/belgium-1940s https://img.videonest.org/gamma/370547_thumbnail_resized_v2.webp https://gamma.videonest.org/370547_video_v3_360.mp4 Belgium (1940s?) The film explores the rich cultural and industrial history of Belgium, highlighting its geographical advantages, agricultural practices, and the evolution of its industries, particularly steel. It describes the picturesque landscapes of Flanders, the resilience of its people against foreign threats, and the transformation of the region into a productive nation. The narrative also touches on Belgium's historical cities, their architectural marvels, and the artistic heritage that flourished during medieval times, showcasing the balance between tradition and modernity. Keywords Belgium, culture, industry, agriculture, Flanders, history, steel, medieval, cities, art, resilience Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1230 https://avgeeks.videonest.co/videos/370548/the-bread-winners-1974 https://img.videonest.org/gamma/370548_thumbnail_resized_v2.webp https://gamma.videonest.org/370548_video_v3_360.mp4 The Bread Winners (1974) "The Bread Winners" is an educational film from 1974 that promotes the importance of proper nutrition and healthy eating, particularly emphasizing the role of bread in a balanced diet. It features a game show format where contestants answer questions about bread's history and nutritional value. The film highlights how bread has been a staple food throughout history, contributing to the development of civilizations. It also discusses the four basic food groups and encourages children to make healthy food choices while having fun. Keywords nutrition, bread, education, game show, healthy eating, history, children, food groups, wellness LIMITED DISTRIBUTION. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1637 https://avgeeks.videonest.co/videos/370549/the-hurricane-inside-1970s https://img.videonest.org/gamma/370549_thumbnail_resized_v2.webp https://gamma.videonest.org/370549_video_v3_360.mp4 The Hurricane Inside (1970s) "The Hurricane Inside" explores the lives of individuals with cerebral palsy, emphasizing their struggles and triumphs as they seek independence and social integration. Through the support of United Cerebral Palsy (UCP) centers, people like Bill Chapella and Beverly Simpson find opportunities to learn, work, and connect with others. The film highlights the importance of specialized programs that provide education, therapy, and community, showcasing personal stories of resilience and the ongoing challenges faced by those with disabilities. It underscores the significance of early intervention and innovative treatments in improving quality of life. Keywords cerebral palsy, United Cerebral Palsy, independence, social integration, therapy, education, community, resilience, early intervention, personal stories Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 954 Cerebral PalsyUnited Cerebral Palsywork activitydisabilityvocational trainingemploymentSanta Ana Californiajob skillsadaptive employmentsupport servicescareer developmentindependent livinginclusive workplaceaccessible employmentcommunity resources https://avgeeks.videonest.co/videos/370550/veronica-1970 https://img.videonest.org/gamma/370550_thumbnail_resized_v2.webp https://gamma.videonest.org/370550_video_v3_360.mp4 Veronica (1970) The film "Veronica" follows a young girl navigating the complexities of identity, leadership, and peer pressure as she reflects on her experiences as a parade queen and a student leader. Veronica grapples with her self-image and the expectations placed on her by others, while also confronting issues of race, friendship, and individuality in a diverse school environment. Through her interactions with peers, she learns to embrace her true self and the importance of authenticity over societal labels. Shot in New Haven, CT. Keywords identity, leadership, peer pressure, self-image, race, individuality, friendship, authenticity, school environment Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1655 https://avgeeks.videonest.co/videos/370551/pause-to-consider-1964 https://img.videonest.org/gamma/370551_thumbnail_resized_v2.webp https://gamma.videonest.org/370551_video_v3.mp4 Pause To Consider (1964) The film revolves around Hal, who is in deep trouble after stealing $2,000 from his girlfriend's father. He is hiding in a cabin, grappling with guilt and fear of facing the consequences. His friends, including Pastor Brewer, encourage him to confront his issues and seek forgiveness, emphasizing the importance of facing one's problems rather than running away. Hal struggles with his sense of self-worth and the impact of his actions on his loved ones, ultimately realizing the need for personal redemption and the strength to face his past. Keywords guilt, redemption, friendship, forgiveness, theft, personal struggle, confrontation, faith, family, consequences LIMITED DISTRIBUTION. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1678 https://avgeeks.videonest.co/videos/370552/the-challenge-1960s https://img.videonest.org/gamma/370552_thumbnail_resized_v2.webp https://gamma.videonest.org/370552_video_v3.mp4 The Challenge (1960s??) The film highlights the alarming frequency and dangers of fires in the United States, emphasizing that a fire occurs every 37 seconds, resulting in significant property damage and loss of life. It discusses the common causes of fires, such as carelessness with smoking, improper handling of flammable materials, and faulty electrical systems. The film advocates for fire safety practices, urging viewers to use common sense, maintain their homes, and educate children about fire hazards. It concludes with a call to action for everyone to take responsibility in preventing fires and protecting lives. Keywords fire safety, prevention, carelessness, smoking hazards, electrical hazards, home maintenance, education, common sense, loss of life, responsibility Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-01T00:00:00.000Z yes A/V Geeks 16mm Films no 630 fire safetyfire preventionproperty damageloss of lifepublic service announcement https://avgeeks.videonest.co/videos/370553/av-geeks-16mm-lunch-4-4-2025 https://img.videonest.org/gamma/370553_thumbnail_resized_v2.webp https://gamma.videonest.org/370553_video_v3.mp4 AV Geeks 16mm Lunch 4-4-2025 Every day is a Friday when you've got a bunch of 16mm films to watch. #avgeeks #16mmfilms 2025-04-05T00:00:00.000Z yes A/V Geeks 16mm Films no 4314 https://avgeeks.videonest.co/videos/370554/av-geeks-16mm-lunch-4-3-2025 https://img.videonest.org/gamma/370554_thumbnail_resized_v2.webp https://gamma.videonest.org/370554_video_v3.mp4 AV Geeks 16mm Lunch 4-3-2025 It's a day to watch 16mm films! Are you with us? #avgeeks #16mmfilms 2025-04-04T00:00:00.000Z yes A/V Geeks 16mm Films no 4010 https://avgeeks.videonest.co/videos/370555/av-geeks-16mm-lunch-4-2-2025 https://img.videonest.org/gamma/370555_thumbnail_resized_v2.webp https://gamma.videonest.org/370555_video_v3.mp4 AV Geeks 16mm Lunch 4-2-2025 Are things back to normal? Are there films to watch? Are they 16mm? #avgeeks #16mmfilms 2025-04-03T00:00:00.000Z yes A/V Geeks 16mm Films no 4074 https://avgeeks.videonest.co/videos/372624/a-boy-named-david-1960s https://img.videonest.org/gamma/372624_thumbnail_resized_v2.webp https://gamma.videonest.org/372624_video_v3.mp4 A Boy Named David (1960s?) The film narrates the biblical story of David, the youngest son of Jesse, who becomes a shepherd and displays remarkable bravery by defeating a lion and a bear to protect his flock. Eventually, the prophet Samuel anoints him as the future king of Israel, despite his older brothers being considered first. David's faith in God leads him to confront the giant Goliath, whom he defeats with a slingshot, showcasing his courage and divine support, ultimately paving the way for his kingship. Keywords David, shepherd, lion, bear, Samuel, anointing, Goliath, faith, courage, Israel, king Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 656 Davidlionbearshepherdsheepflockshepherd's staffBible storyBiblicalAnimationChildren'sReligiousStoryParable https://avgeeks.videonest.co/videos/372625/the-concession-1970 https://img.videonest.org/gamma/372625_thumbnail_resized_v2.webp https://gamma.videonest.org/372625_video_v3.mp4 The Concession (1970) The film features a narrator who shares his passion for wildlife and nature, particularly around streams, lakes, and swamps. He enjoys fishing, hunting, and observing birds, especially nesting birds in their natural habitat. The narrator discusses a family of herons and their nesting behaviors, highlighting the beauty and complexity of life in the swamp. He also showcases the nurturing habits of birds, such as how they care for their young and the unique adaptations of different species. Keywords wildlife, nature, birds, swamp, herons, nesting, fishing, hunting, observation, family Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1002 swamp wildlifenesting birdsbird watchingfishingwildlife documentarynature documentarybirdsswampbirds nestingwildlife photographynaturebirds of preyswamp birdsdocumentary filmfishing documentary https://avgeeks.videonest.co/videos/372626/consumer-game-1973 https://img.videonest.org/gamma/372626_thumbnail_resized_v2.webp https://gamma.videonest.org/372626_video_v3.mp4 Consumer Game (1973) The film explores the challenges young consumers face in recognizing their role as buyers, particularly in the context of personal care products like deodorants. It emphasizes the importance of comparison shopping and being aware of advertising tactics that exploit insecurities. The narrative encourages consumers to read labels, understand product guarantees, and make informed decisions to ensure they get the best value for their money. Ultimately, it advocates for a proactive approach to shopping, highlighting the necessity of being a discerning consumer in a market filled with choices and marketing strategies. Keywords consumer awareness, comparison shopping, advertising tactics, product guarantees, informed decisions, market strategies, personal care products LIMITED DISTRIBUTION. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 979 YouthConsumerismMarketingCommercialSupermarketDeodorantAdvertisingConsumer TrendsRetailSalesBrandProduct PlacementTarget AudienceMarket ResearchDocumentary Film https://avgeeks.videonest.co/videos/372627/fast-food-whats-in-it-for-you-1988 https://img.videonest.org/gamma/372627_thumbnail_resized_v2.webp https://gamma.videonest.org/372627_video_v3.mp4 Fast Food: What's In It For You? (1988) The film follows a girl named Karen who feels pressured to lose weight and struggles with her unhealthy eating habits, often relying on junk food. Her younger brother Alex, who aspires to be taller for basketball, also indulges in unhealthy snacks. Through their interactions with Derek, a fast-food restaurant assistant manager, they learn about nutrition, the effects of fat and sugar on their bodies, and the importance of making healthier food choices without resorting to strict dieting. Ultimately, they discover that a balanced diet can help them feel better and achieve their goals. Keywords nutrition, fast food, healthy eating, weight loss, siblings, junk food, diet, carbohydrates, fat, sugar 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1000 Weight LossFast FoodGrapefruit DietBasketballHandstandWorkoutExerciseDietHealthFitnessLifestyleSports https://avgeeks.videonest.co/videos/372628/great-diamond-long-division-1973 https://img.videonest.org/gamma/372628_thumbnail_resized_v2.webp https://gamma.videonest.org/372628_video_v3.mp4 Great Diamond: Long Division (1973) In the kingdom of Boravia, a war erupted between the Waggles and the Dros after the discovery of a massive diamond. Initially living in harmony, their relationship soured when the diamond became a point of contention. The Dros, determined to keep the diamond, cut it into smaller gems to hide them from the Waggles. After a prolonged conflict, the Waggles captured the Dros' fortress but found the diamond missing. The Dros had successfully smuggled the smaller gems away. Eventually, both sides agreed to peace and divided the gems among their families, leaving one stone to symbolize their shared history of greed and conflict. LIMITED DISTRIBUTION. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 608 Math That CountsWogglesDrocksBosnavialong divisiongiant diamondanimatededucationalchildren'smathematicsadventurelearningkidsfilmprogramming https://avgeeks.videonest.co/videos/372629/duke-thomas-mailman-1967 https://img.videonest.org/gamma/372629_thumbnail_resized_v2.webp https://gamma.videonest.org/372629_video_v3.mp4 Duke Thomas: Mailman (1967) The film features a mailman reflecting on his daily routine and the various letters and packages he delivers. He expresses his thoughts on the importance of mail, the challenges he faces with addresses and heavy loads, and his interactions with customers. The mailman shares anecdotes about the joy of delivering letters and the significance of personal communication, all while maintaining a light-hearted attitude. LIMITED DISTRIBUTION. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 934 Postal WorkerMailmanPost OfficeMail SortingDuke ThomasDocumentaryHistoryEmploymentMail DeliveryPostal Service https://avgeeks.videonest.co/videos/372630/faith-in-ourselves-1975 https://img.videonest.org/gamma/372630_thumbnail_resized_v2.webp https://gamma.videonest.org/372630_video_v3.mp4 Faith In Ourselves (1975) Chronicles key moments in American history, beginning with the shot heard 'round the world at Lexington and Concord in 1775, leading to the Declaration of Independence drafted by Thomas Jefferson. It highlights the resilience of the American spirit through the War of 1812, the frontier life of early Americans, the Civil War's pivotal battle at Gettysburg, and the significant impact of immigrants on the nation's growth. The narrative continues through World War I, the attack on Pearl Harbor in 1941, and culminates with the Apollo 11 moon landing in 1969, emphasizing the ongoing pursuit of freedom and progress in America. LIMITED DISTRIBUTION. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1273 https://avgeeks.videonest.co/videos/372631/for-all-the-life-russian-1960s https://img.videonest.org/gamma/372631_thumbnail_resized_v2.webp https://gamma.videonest.org/372631_video_v3.mp4 For All The Life (Russian, 1960s?) Revolves around a teacher, Vera Sergeyevna, who recalls a traumatic experience she faced while working at a kindergarten. During a winter evening when she was preparing for exams, a fire broke out in the kindergarten. Her primary concern was to keep the children calm and safe, leading her to act quickly to evacuate them. She managed to save a young boy named Yura, but in doing so, she almost became a victim of the flames herself. The story highlights the importance of safety around children and the bravery of educators. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 615 fire safetyChristmas treeschool childrenclassroomdrawingteacherfiremanlessonsafety lessonschoolchildreneducationholiday safetyfire preventiondecember https://avgeeks.videonest.co/videos/372632/playground-safety-simple-as-a-b-c-1976 https://img.videonest.org/gamma/372632_thumbnail_resized_v2.webp https://gamma.videonest.org/372632_video_v3.mp4 Playground Safety - Simple as A, B, C (1976) The film emphasizes the importance of playground safety through the ABCD framework. It teaches children to avoid unsafe behaviors, be safety-minded, practice courtesy, and do their part to maintain a safe playground environment. Key rules include using equipment properly, waiting for turns, and keeping the area clean to prevent accidents. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 878 Playground SafetyElementary SchoolPlayground AccidentsRecessUnsafe BehaviorKids SafetyChild SafetySchool SafetyAccident PreventionElementary School SafetyPlayground RulesSafety TipsEducation VideosKids VideosSafety Videos https://avgeeks.videonest.co/videos/372633/the-monkeys-paw-1978 https://img.videonest.org/gamma/372633_thumbnail_resized_v2.webp https://gamma.videonest.org/372633_video_v3.mp4 The Monkey's Paw (1978) A family encounters a mysterious sailor who brings a cursed object known as the Monkey's Paw, which grants three wishes. The father, Charles, wishes for $500, which ominously comes true after the tragic death of their son, Herbert, in a factory accident. Grieving, the family decides to use the paw again to wish for Herbert's return, but the consequences of their wishes lead to horror as they realize he cannot return in the way they hoped. In a desperate attempt to undo their mistake, they make a final wish that seals their tragic fate. LIMITED DISTRIBUTION. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1132 Monkey's PawHorrorClassic FilmWishesFateFamily ReunionSuspenseMorrisHerbertTravels https://avgeeks.videonest.co/videos/372634/smpte-color-television-test-1965 https://img.videonest.org/gamma/372634_thumbnail_resized_v2.webp https://gamma.videonest.org/372634_video_v3.mp4 SMPTE Color Television Test (1965) Ironically the color has faded for this film. The SMPTE Color Television Test (1965) film serves two main purposes: it helps in achieving color balance for color television transmission and allows for subjective evaluation of color television systems. The film showcases various scenes under different lighting conditions to ensure proper color reproduction on monitors. It emphasizes the importance of correctly adjusted color monitors for optimal viewing and highlights potential issues with color uniformity in both color and black-and-white displays. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 228 SMPTEColor TelevisionTest Film1965Color BalanceTelevision Test https://avgeeks.videonest.co/videos/372635/stitchery-1969 https://img.videonest.org/gamma/372635_thumbnail_resized_v2.webp https://gamma.videonest.org/372635_video_v3_360.mp4 Stitchery (1969) The film "Stitchery" explores the art of decorating fabric using yarn and thread, known as embroidery. It discusses how embroidery resembles drawing, allowing for the creation of lines, shapes, and patterns. The film highlights different techniques, including heavy yarn stitching, knotting for color spots, needlepoint on canvas, and appliqué with cloth shapes. It emphasizes the importance of texture in embroidery, which is influenced by the choice of yarn, stitches, and arrangement. 2025-04-07T00:00:00.000Z yes A/V Geeks 16mm Films no 852 EmbroideryStitcheryNeedleworkEmbroidery TechniquesACI ProductionsStelios RoccosKaren RosenErnest Ziegefeld https://avgeeks.videonest.co/videos/372636/av-geeks-16mm-lunch-4-7-2025 https://img.videonest.org/gamma/372636_thumbnail_resized_v2.webp https://gamma.videonest.org/372636_video_v3_360.mp4 AV Geeks 16mm Lunch 4-7-2025 It's a new week and we are going to keep the intense films to a minimum. #avgeeks #16mmfilms Von Braun "Indian Crafts: Hopi, Navajo And Iroquois" Boyhood of Abraham Lincoln, 2nd Understanding Weather - Storms Indonesia - The Land and Its People 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 3699 https://avgeeks.videonest.co/videos/373188/all-about-fire-1976 https://img.videonest.org/gamma/373188_thumbnail_resized_v2.webp https://gamma.videonest.org/373188_video_v3_360.mp4 All About Fire (1976) In this vintage film, a cat named Murphy narrates the misadventures of his owners, Joe and Kathy, who face multiple fire hazards in their home. After a series of careless incidents, including burning trash in the fireplace and improper gasoline storage, they experience several fires, prompting visits from the fire department. Captain Roberts provides safety inspections and advice, but Joe and Kathy struggle to implement the necessary precautions. The film emphasizes the importance of fire safety and prevention in everyday life. Keywords fire safety, prevention, home hazards, fire department, Captain Roberts, Joe and Kathy, Murphy the cat, accidents, negligence LIMITED DISTRIBUTION. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 616 House FireFire DepartmentFire SafetyHomeownersEmergency CallNeighborFire PreventionSafety TipsHome EmergencyRescueFirefighters https://avgeeks.videonest.co/videos/373189/barbara-murray-1976 https://img.videonest.org/gamma/373189_thumbnail_resized_v2.webp https://gamma.videonest.org/373189_video_v3_360.mp4 Barbara Murray (1976) In this educational film, substitute teacher Barbara Murray engages with students at Jackson Junior High about their alcohol project. The discussion revolves around the nature of alcohol, its historical context, and the social pressures associated with drinking. Students express varying opinions on alcohol, including its dangers and cultural significance. Barbara grapples with her personal stance on drinking while encouraging students to explore their own beliefs and experiences regarding alcohol. Keywords alcohol, education, social pressure, student discussion, personal beliefs, historical context, cultural significance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 860 alcohol awarenessalcohol educationclassroom discussionsubstitute teacherJackson Junior Highteen drinkingsubstance abuse preventionhealth educationschool programpublic healthcommunity healthyouth education https://avgeeks.videonest.co/videos/373190/cholesterol-eat-your-heart-out-1975 https://img.videonest.org/gamma/373190_thumbnail_resized_v2.webp https://gamma.videonest.org/373190_video_v3.mp4 Cholesterol: Eat Your Heart Out (1975) The film "Cholesterol: Eat Your Heart Out" explores the impact of diet on heart health through an experiment involving high school students. Participants are divided into two groups: one group follows a low-fat diet aimed at reducing cholesterol, while the other indulges in a high-fat diet. Over four weeks, the students learn how their dietary choices affect their cholesterol levels and overall heart health. The film emphasizes the importance of diet in preventing heart disease, particularly highlighting that poor eating habits can lead to serious health risks even at a young age. Keywords cholesterol, heart health, diet, experiment, teenagers, low-fat, high-fat, blood chemistry, health risks, nutrition 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 797 heart attackheart healthblood chemistrydietrisk factorshigh school students https://avgeeks.videonest.co/videos/373191/child-of-bethlehem-1941 https://img.videonest.org/gamma/373191_thumbnail_resized_v2.webp https://gamma.videonest.org/373191_video_v3.mp4 Child Of Bethlehem (1941) The film narrates the story of the birth of Jesus Christ and his early life as described in the Gospels of Luke and Matthew. It begins with the decree from Emperor Augustus for a census, leading Joseph and Mary to Bethlehem, where Jesus is born in a manger due to lack of room at the inn. The film depicts the angel announcing Jesus' birth to shepherds, the visit of the wise men guided by a star, and King Herod's plot to kill Jesus, which prompts Joseph to flee to Egypt. The story concludes with Jesus at the age of twelve, lost in Jerusalem, discussing profound matters in the temple. Keywords Jesus Christ, birth, Bethlehem, shepherds, wise men, King Herod, Egypt, childhood, Gospels, Mary, Joseph Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1147 Jesus ChristBethlehemcensusEmperor AugustusGospel of LukeGospel of MatthewBiblical HistoryRoman EmpireHistorical DocumentaryReligious Film https://avgeeks.videonest.co/videos/373192/chez-nous-1961 https://img.videonest.org/gamma/373192_thumbnail_resized_v2.webp https://gamma.videonest.org/373192_video_v3.mp4 Chez Nous (1961) The film follows 17-year-old Henry Garnier, who lives in Paris and writes letters to his friend in Chicago. He describes his family, including his parents and two sisters, and shares details about his daily life, school routine, and aspirations to become an engineer. Henry highlights the beauty of Paris, his commuting experiences, and the importance of family dinners. He also mentions his sister Jacqueline's dream of becoming a fashion designer. The narrative captures the essence of a typical day in his life, emphasizing both personal and cultural aspects. Keywords Henry Garnier, Paris, family, daily life, school, aspirations, letters, engineering, fashion, routine Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 670 ParisFrancefamilypen palletter writingFrench CultureDocumentaryHenri GarnierChicagocorrespondencepersonal storycultural exchangetravelogue https://avgeeks.videonest.co/videos/373193/bleacher-feature-1975 https://img.videonest.org/gamma/373193_thumbnail_resized_v2.webp https://gamma.videonest.org/373193_video_v3.mp4 Bleacher Feature (1975) The film features a group of children sharing personal stories about getting into trouble, often during sports or everyday situations. They engage in role-playing to explore alternatives to their conflicts, promoting communication and problem-solving skills. The exercise emphasizes the importance of considering different perspectives and finding peaceful resolutions to disputes. Keywords children, stories, trouble, sports, role-playing, conflict resolution, communication, problem-solving 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 768 classroomrole playchildhood experiencesclassroom dynamicsconsequenceseducationschoollearningbehaviorteachingkidsstudentsteachersget in troublebaseball game https://avgeeks.videonest.co/videos/373194/bombs-will-make-the-rainbow-break-1982 https://img.videonest.org/gamma/373194_thumbnail_resized_v2.webp https://gamma.videonest.org/373194_video_v3_360.mp4 Bombs Will Make The Rainbow Break (1982) Ppresents the fears and anxieties of children regarding nuclear war. Through their reflections, it captures the overwhelming dread of potential destruction, the emotional turmoil of living with the threat of nuclear weapons, and the desire for peace. The children express their feelings of helplessness, the impact of nuclear arms on their futures, and their hopes for a world without violence. They call for adults to take responsibility and prioritize peace over weapons, emphasizing the innocence and vulnerability of youth in the face of global conflict. Keywords nuclear war, children, fear, peace, destruction, responsibility, emotional turmoil, future, innocence, vulnerability 2025-04-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1079 nuclear annihilationnuclear warCold Warchildrendocumentarysocial issuesshort filmTom HurwitzBarbara Zahm https://avgeeks.videonest.co/videos/373195/av-geeks-16mm-lunch-4-8-2025 https://img.videonest.org/gamma/373195_thumbnail_resized_v2.webp https://gamma.videonest.org/373195_video_v3_360.mp4 AV Geeks 16mm Lunch 4-8-2025 Yes we are going to watch 16mm films today. Why do you ask? #avgeeks #16mmfilms Little Angels of Korea Problems of Conservation: Wildlife Stop that Period! Period Stop That. Puff the Magic Dragon in the Land of Living Lies 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 4376 https://avgeeks.videonest.co/videos/377160/scotts-new-old-friend-1983 https://img.videonest.org/gamma/377160_thumbnail_resized_v2.webp https://gamma.videonest.org/377160_video_v3_360.mp4 Scott's New Old Friend (1983) Tells the story of a boy named Scott who struggles with changes in his family dynamics after his mother switches to a second shift job. Feeling lonely, he befriends an elderly woman in the park who enjoys reading. They share a secret connection through books, leading Scott to discover the joys of friendship and the importance of understanding and compassion across generations. The film explores themes of loneliness, discrimination, and the bonds formed through shared experiences. Keywords friendship, loneliness, discrimination, elderly, books, family dynamics, compassion, understanding 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 1347 https://avgeeks.videonest.co/videos/377161/hour-of-decision-untitled-1950s https://img.videonest.org/gamma/377161_thumbnail_resized_v2.webp https://gamma.videonest.org/377161_video_v3_360.mp4 Hour Of Decision - Untitled (1950s) Billy Graham. In "Hour of Decision," a pastor reflects on his life and challenges after leaving his ministry due to physical limitations. Struggling to find hope while working at a packing plant, he is uplifted by a poem his wife places in his lunchbox, inspiring him to compose a song about God's love. The sermon draws parallels between biblical teachings and contemporary issues, emphasizing that reliance on wealth, knowledge, pleasure, morality, or philanthropy is insufficient for true security and salvation. The pastor urges viewers to place their faith in Jesus Christ for assurance and eternal peace. Keywords faith, salvation, God's love, pastor, sermon, poem, security, Jesus Christ, hope, morality Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 936 Billy GrahamHour of DecisionChristianityReligionCliff BarrowsGeorge Beverly SheaTedd SmithPaul MickelsonChristian TelevisionInspirationalClassicBlack and WhiteSouthern CaliforniaHistorical FootageEvangelism https://avgeeks.videonest.co/videos/377162/toute-la-bande-la-rentree-french-1970 https://img.videonest.org/gamma/377162_thumbnail_resized_v2.webp https://gamma.videonest.org/377162_video_v3.mp4 Toute La Bande: La Rentree (French, 1970) The film "Toute La Bande: La Rentree" follows the excitement and preparations of students as they get ready for the new school year. It begins with a trip to a bookstore to buy school supplies, where a series of humorous interactions take place between customers and the shopkeeper. The narrative then shifts to a pharmacy where a girl purchases makeup, leading to playful banter about beauty products. The story culminates in a classroom setting where students interact with their teacher and each other, highlighting the social dynamics of school life. Keywords school, supplies, bookstore, makeup, students, classroom, interactions, humor 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 903 back to schoolschool suppliesstationerybookstoreshoppinghaulbesteducationretail https://avgeeks.videonest.co/videos/377163/computer-graphics-for-communication-1982 https://img.videonest.org/gamma/377163_thumbnail_resized_v2.webp https://gamma.videonest.org/377163_video_v3.mp4 Computer Graphics For Communication (1982) The film discusses the evolution of graphic design through computer technology, highlighting how computers enhance the efficiency and creativity of graphic artists. It contrasts traditional graphic art production with modern computer-generated methods, showcasing the tools and processes involved in creating various graphics, including charts and animations. The narrative emphasizes that while computers automate tedious tasks, they ultimately serve as tools that empower artists to focus on design and innovation. Keywords graphic design, computer technology, creativity, art production, automation, tools, efficiency, animation, graphic artist 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 1046 Graphic DesignComputer GraphicsFlow ChartDesign ProcessPie ChartsGraphic Art https://avgeeks.videonest.co/videos/377164/aggression-assertion-1972 https://img.videonest.org/gamma/377164_thumbnail_resized_v2.webp https://gamma.videonest.org/377164_video_v3.mp4 Aggression - Assertion (1972) The film depicts a family's morning routine filled with typical household dynamics, including sibling rivalry and parental authority. The dialogue reveals the tension between a father who expects his son to complete chores and the son's desire to avoid responsibility. A discarded radio becomes a focal point of conflict, showcasing various approaches to problem-solving among the children. The narrative emphasizes themes of responsibility, conflict resolution, and the importance of communication within a family. Keywords family dynamics, sibling rivalry, parental authority, responsibility, problem-solving, communication, chores, conflict 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 454 Family ConflictConflict ResolutionMoral Decision MakingParenting SkillsAggression AssertionParentingHousehold ChoresOxford Films https://avgeeks.videonest.co/videos/377165/dividing-with-fractions-missing-factor-method-1970 https://img.videonest.org/gamma/377165_thumbnail_resized_v2.webp https://gamma.videonest.org/377165_video_v3.mp4 Dividing with Fractions: Missing Factor Method (1970) The film features a muskox named Lola who struggles with dividing fractions despite being intelligent in other areas of math. Her friend, Arthur the Arctic Fox, teaches her how to approach dividing fractions by transforming it into a multiplication problem. Through various examples, Lola learns to find missing factors and successfully divides fractions by renaming products and using multiplication strategies. By the end, Lola feels confident in her ability to divide any two fractions. Keywords muskox, Lola, fractions, division, multiplication, Arctic Fox, Arthur, math education, learning, missing factor 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 660 fractionsdivisionmissing factormathematicselementary matheducational videomath problemslearn mathschoolkidsLolaelementary school math https://avgeeks.videonest.co/videos/377166/we-explore-the-woodland-1957 https://img.videonest.org/gamma/377166_thumbnail_resized_v2.webp https://gamma.videonest.org/377166_video_v3.mp4 We Explore The Woodland (1957) This is what real film damage looks like! Pam and her brother Ken go on a hike with their grandpa to explore the woodland. They learn about various types of woodlands, the plants and animals that inhabit them, and the importance of not disturbing the ecosystem. Throughout their adventure, they discover wildflowers, trees like oaks and maples, and various woodland creatures, including a raccoon and a blue jay. The day culminates in finding ripe blackberries, which they collect responsibly, ensuring they leave enough for the wildlife. The experience deepens their appreciation for nature and its interconnectedness. Keywords Pam, Ken, grandpa, woodland, hike, plants, animals, ecosystem, blackberries, nature, exploration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 636 woodlandhikeblack-eyed Susanschipmunkwoodpeckernatureanimalswildlifedocumentaryoutdoorhikingwildflowers https://avgeeks.videonest.co/videos/377167/the-bear-and-the-dragon-1969a https://img.videonest.org/gamma/377167_thumbnail_resized_v2.webp https://gamma.videonest.org/377167_video_v3.mp4 The Bear And The Dragon (1969)a "The Bear and The Dragon" explores the tumultuous history between China and Russia from ancient times through the rise of communism. It details China's decline, the establishment of the Republic under Sun Yat-sen, and the subsequent rise of Mao Zedong and the Communist Party. The film chronicles Mao's Long March, the Sino-Japanese War, and the eventual proclamation of the People's Republic of China in 1949. It also covers the initial alliance between China and the Soviet Union, which later deteriorated into conflict over ideological differences and territorial disputes, culminating in rising tensions along their shared border. Keywords China, Russia, communism, Mao Zedong, Sun Yat-sen, Long March, People's Republic of China, Sino-Japanese War, Sino-Soviet relations, territorial disputes LIMITED DISTRIBUTION. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 845 ChinaChinese HistoryHistoryDocumentaryMao ZedongChiang Kai-shekCommunist RevolutionKublai KhanGreat WallMarco Polo https://avgeeks.videonest.co/videos/377168/housing-problems-1935 https://img.videonest.org/gamma/377168_thumbnail_resized_v2.webp https://gamma.videonest.org/377168_video_v3.mp4 Housing Problems (1935) The film "Housing Problems" addresses the dire conditions of slum housing in England and the struggles faced by families living in these environments. It features testimonies from residents who describe overcrowded, unsanitary, and unsafe living conditions, highlighting issues like vermin, inadequate facilities, and poor maintenance. The film also discusses the efforts of public authorities to clear slums and replace them with new housing developments, showcasing modern construction techniques aimed at improving living standards. The narrative emphasizes the importance of providing decent homes to foster community pride and cleanliness. Keywords slums, housing, living conditions, overcrowding, public authorities, slum clearance, sanitation, community, construction, residents' testimonies 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 935 Housing CrisisSlum ClearanceOvercrowdingLack of WaterBadly Designed HousesHousing ProblemsUrban HousingSocial InequalityUrban DevelopmentPovertyPublic HealthDocumentary FilmSocial Documentary https://avgeeks.videonest.co/videos/377169/i-think-im-having-a-baby-1981 https://img.videonest.org/gamma/377169_thumbnail_resized_v2.webp https://gamma.videonest.org/377169_video_v3.mp4 I Think I'm Having A Baby (1981) Features Jennifer Jason Leigh, Helen Hunt, Tracy Gold. "I Think I'm Having a Baby" explores the challenges and complexities of teenage life, particularly the topics of love, sexuality, and the potential consequences of early relationships. The narrative follows a group of teenagers navigating their feelings, peer pressure, and the reality of unexpected pregnancy, highlighting the importance of communication and responsible decision-making regarding sexual health. Keywords teenage pregnancy, sexuality, love, relationships, peer pressure, communication, responsibility, adolescence Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. LIMITED DISTRIBUTION. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 1744 https://avgeeks.videonest.co/videos/377170/mathematics-of-a-honeycomb-1964 https://img.videonest.org/gamma/377170_thumbnail_resized_v2.webp https://gamma.videonest.org/377170_video_v3.mp4 Mathematics Of A Honeycomb (1964) The film explores the intricate relationship between mathematics and the construction of honeycomb by bees. It highlights how bees utilize geometric shapes, particularly hexagons, to create an efficient structure that minimizes the use of wax while maximizing strength. The film discusses historical mathematical discoveries related to honeycomb design, including the work of ancient and modern mathematicians, and emphasizes the importance of mathematics in understanding natural phenomena. It concludes by asserting that the study of such natural structures can lead to advancements in engineering and science. Keywords honeycomb, bees, mathematics, geometry, hexagon, efficiency, bionics, engineering, natural structures, science 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 788 honeycombhexagongeometrymathematicsbeehoneynaturescienceeducationalpatternshapestructureinsectdesignarchitecture https://avgeeks.videonest.co/videos/377171/ill-buy-that-1972 https://img.videonest.org/gamma/377171_thumbnail_resized_v2.webp https://gamma.videonest.org/377171_video_v3.mp4 I'll Buy That (1972) Features Meredith MacRae. The film revolves around a sales seminar where participants learn the importance of understanding customer needs in order to make successful sales. Through humorous interactions and practical advice, characters explore the correlation between selling techniques and personal relationships, emphasizing empathy and attentiveness to the desires of others. The story highlights various sales strategies and the significance of focusing on the customer's perspective rather than one's own. Keywords sales, seminar, customer needs, empathy, selling techniques, relationships, practical advice, humor 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 1780 https://avgeeks.videonest.co/videos/377172/boating-safety-and-rescues-1974 https://img.videonest.org/gamma/377172_thumbnail_resized_v2.webp https://gamma.videonest.org/377172_video_v3.mp4 Boating Safety And Rescues (1974) The film emphasizes the importance of boating safety and water rescue techniques. It highlights the necessity of wearing life jackets, the ability to swim, and maintaining balance in small crafts. It also discusses emergency procedures, proper equipment, and regulations for safe boating. The film stresses that even inexperienced boaters can perform rescues effectively by following safety protocols and using appropriate techniques. Keywords boating safety, water rescue, life jackets, swimming, emergency procedures, personal flotation devices, balance, equipment, regulations 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 647 life jacketwater safetyboating safetyAmerican Red Crossswimmingboatwater sports safetypersonal flotation devicePFDdrowning preventionsafe boating practicesnautical safetyaquatic safetywater rescueswimming safety https://avgeeks.videonest.co/videos/377173/dividing-with-decimals-1970 https://img.videonest.org/gamma/377173_thumbnail_resized_v2.webp https://gamma.videonest.org/377173_video_v3.mp4 Dividing With Decimals (1970) The film follows a yellow-bellied fore flusher who migrates from Ireland to the south of France. Before his journey, he meticulously plans his route and learns to divide distances into equal parts. However, after losing his luggage and map in a storm, he encounters a new challenge: the distances are now in decimals, which he doesn't know how to divide. The fore flusher uses estimation and multiplication to solve his problems, ultimately figuring out how to divide decimals to determine his travel plans. The story combines a whimsical adventure with educational lessons on math, particularly focusing on division and decimals. Keywords fore flusher, migration, Ireland, south of France, decimals, division, estimation, math education, adventure, storm 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 520 Rational NumbersDecimalsMathematicsEducationKidsAnimatedChildren's ProgrammingMapIrelandFranceMigrationStory https://avgeeks.videonest.co/videos/377174/the-innovators-1970s https://img.videonest.org/gamma/377174_thumbnail_resized_v2.webp https://gamma.videonest.org/377174_video_v3.mp4 The Innovators (1970s) Features Tom Harmon. The film discusses the evolution of innovation in various fields, particularly focusing on the automotive replacement parts industry and the National Automotive Parts Association (NAPA). It highlights NAPA's role as a leader in the industry, emphasizing its commitment to quality, efficiency, and support for jobbers (automotive parts dealers). The film outlines NAPA's innovative systems, such as classification programs, distribution centers, and management services, which have set it apart from competitors. It stresses that NAPA's success stems from its ability to adapt and innovate, ensuring jobbers achieve greater profitability and market security. Keywords innovation, automotive, National Automotive Parts Association, NAPA, jobbers, distribution, classification, management services, leadership, profitability Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 1583 https://avgeeks.videonest.co/videos/377175/anatomy-of-life-1975 https://img.videonest.org/gamma/377175_thumbnail_resized_v2.webp https://gamma.videonest.org/377175_video_v3.mp4 Anatomy Of Life (1975) The film "Anatomy of Life" explores the definition of life, examining characteristics that distinguish living organisms from non-living entities. It discusses the biochemical basis of life, focusing on DNA as the genetic blueprint and the processes of growth and reproduction. The documentary highlights the adaptability of various life forms to extreme environmental conditions and speculates on the possibility of life existing on other planets, particularly Mars. It emphasizes the importance of evolution and adaptation as fundamental traits of life. Keywords life, definition, DNA, evolution, adaptation, extraterrestrial life, Mars, environmental conditions, biochemistry, reproduction Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 816 Saturn's moon Titanextraterrestrial lifespace probesScience Screen Reportspace explorationscience documentaryTitanplanetsmoonsbiologyparameciumsoap bubble https://avgeeks.videonest.co/videos/377176/banana-fever-short-division-1975 https://img.videonest.org/gamma/377176_thumbnail_resized_v2.webp https://gamma.videonest.org/377176_video_v3.mp4 Banana Fever: Short Division (1975) In a tropical forest, a monkey named Max loves bananas but discovers that some are mysteriously disappearing. After suspecting his friends, Max learns that an invisible thief is taking his bananas based on a specific pattern of division. With the help of his friends, they devise a plan to catch the thief by gathering a number of bananas that cannot be evenly divided. Ultimately, they find that 11 bananas are safe from theft, leading to a humorous resolution when Max's cousin reveals his own troubles with coconut theft. Keywords monkey, bananas, invisible thief, division, friendship, tropical forest, adventure, humor LIMITED DISTRIBUTION. 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 682 Maxmonkeybananastropical foresteducational cartoonanimatedkidsshort divisionEncyclopaedia Britannicaadventurechildren's showlearningjungleprimatescartoon https://avgeeks.videonest.co/videos/377177/beginning-mathematics-division-2nd-ed-1987 https://img.videonest.org/gamma/377177_thumbnail_resized_v2.webp https://gamma.videonest.org/377177_video_v3.mp4 Beginning Mathematics: Division (2nd ed, 1987) The film is an educational video that introduces the concept of division through practical examples. It illustrates how to divide a group of students for gym activities and explains division as repeated subtraction and its relationship with multiplication. The video covers various scenarios involving division, including dividing cookies, planting seeds, and dealing with remainders. It emphasizes the importance of understanding the order of division and the properties of dividing by zero. Keywords division, mathematics, education, practical examples, repeated subtraction, multiplication, groups, remainders, properties of division, zero 2025-04-09T00:00:00.000Z yes A/V Geeks 16mm Films no 780 MathEquationElementary SchoolStudentsGroupsDivisionEducationMathematicsSoccerGym Class https://avgeeks.videonest.co/videos/377178/av-geeks-16mm-lunch-4-9-2025 https://img.videonest.org/gamma/377178_thumbnail_resized_v2.webp https://gamma.videonest.org/377178_video_v3.mp4 AV Geeks 16mm Lunch 4-9-2025 Lunch + 16mm films = the perfect combo! #avgeeks #16mmfilms 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 4418 https://avgeeks.videonest.co/videos/378999/library-place-of-discovery-1965 https://img.videonest.org/gamma/378999_thumbnail_resized_v2.webp https://gamma.videonest.org/378999_video_v3.mp4 Library: Place Of Discovery (1965) The story revolves around Paul Bunyan, a legendary figure in American folklore, known for his incredible feats in lumbering and the creation of the Thousand Islands. A group of children is inspired by a library story hour about Paul Bunyan and decides to create a puppet show for a school project on westward expansion. They explore various resources in the library, including books, film strips, and maps, to gather information for their presentation. The narrative emphasizes the importance of libraries as centers of knowledge and creativity, showcasing how they can enrich students' learning experiences. Keywords Paul Bunyan, folklore, library, puppet show, westward expansion, storytelling, education, resources, children, creativity LIMITED DISTRIBUTION. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 957 Paul Bunyanfolk talesstory hourchildren's booksDavis Librarychildren's literaturestorytellinglibrary programkids storiesreadingeducationlibrariesliterature https://avgeeks.videonest.co/videos/379000/av-geeks-16mm-lunch-4-10-2025 https://img.videonest.org/gamma/379000_thumbnail_resized_v2.webp https://gamma.videonest.org/379000_video_v3.mp4 A/V Geeks 16mm Lunch 4-10-2025 Grab your sandwich and join us for vintage film vibes! #avgeeks #16mmfilms Compilation of Castle silent shorts The Donkey's Barley Ration Understanding Weather: Why Weather Changes Metropolitan Cats 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 3898 https://avgeeks.videonest.co/videos/380346/food-from-the-sun-1966 https://img.videonest.org/gamma/380346_thumbnail_resized_v2.webp https://gamma.videonest.org/380346_video_v3.mp4 Food From The Sun (1966) This film explains how plants and animals obtain energy from food, highlighting the energy needs of various creatures like geese, caterpillars, and squirrels. It demonstrates that while animals derive energy from consuming other organisms, plants create their own food using sunlight, air, water, and minerals. The film illustrates the vital role of the sun in sustaining life on Earth, showing that all living things ultimately depend on solar energy for growth and survival. Keywords energy, plants, animals, food, sunlight, growth, survival, ecosystems, dependence LIMITED DISTRIBUTION. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 544 plant energyanimal energyfood energyplant eaterswild geeseenergynaturefood chainbiologyplantsanimalsecosystemwildlifescienceeducation https://avgeeks.videonest.co/videos/380347/compilation-of-nasa-launch-footage-silent-1960s https://img.videonest.org/gamma/380347_thumbnail_resized_v2.webp https://gamma.videonest.org/380347_video_v3.mp4 Compilation of NASA launch Footage (silent, 1960s) This film offers an in-depth, behind-the-scenes view of NASA’s Mission Control during a 1960s spaceflight, likely part of the Apollo program. It captures the intense, methodical environment of the control room as engineers and specialists—many in white shirts and ties—monitor spacecraft data, communicate via headsets, and coordinate every phase of the mission. We see astronauts being transported to the launch pad, entering elevators, and preparing for launch, while mission controllers observe monitors and graphical readouts. The footage follows the countdown, launch, and flight stages, revealing the calm urgency, collaboration, and concentration required during a live space mission. Scenes of Neil Armstrong interacting with personnel underscore the human element in space exploration. Without narration, the film immerses viewers in the process, from mop-wielding maintenance workers to engineers watching the rocket's trajectory on wall-sized displays—an authentic snapshot of Cold War-era spaceflight operations at their peak. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 2245 https://avgeeks.videonest.co/videos/380348/plant-through-the-seasons-the-apple-tree-1966 https://img.videonest.org/gamma/380348_thumbnail_resized_v2.webp https://gamma.videonest.org/380348_video_v3.mp4 Plant Through The Seasons: The Apple Tree (1966) This film explores the seasonal changes of an apple tree, detailing how it adapts to the heat of summer and the cold of winter. It explains the life cycle of the apple tree, including how it slows down in autumn, prepares for winter, and revives in spring. The film also discusses the process of seed germination, the importance of leaves, and how trees conserve water during harsh conditions. It emphasizes the cyclical nature of life as the tree prepares for the next season. Keywords apple tree, seasons, adaptation, germination, leaves, winter, spring, life cycle, water conservation, cyclical nature LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 644 Basic Life Scienceseasonal changeschildren playingwinter activitiessummer activitiesbiologyscienceeducationnaturechild developmentoutdoor activitiesseasons https://avgeeks.videonest.co/videos/380349/discovering-the-forest-1966 https://img.videonest.org/gamma/380349_thumbnail_resized_v2.webp https://gamma.videonest.org/380349_video_v3.mp4 Discovering The Forest (1966) Without narration, the 11-minute film captures the mood and atmosphere of the forest through visuals and ambient sound—rustling leaves, birdsong, insect calls, and the whisper of wind through the trees. Viewers are invited to observe the diverse forms of life within the forest, from towering trees and undergrowth to wildlife in motion. The film encourages a contemplative and observational experience, fostering appreciation for the complexity and serenity of forest environments without the need for words. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 692 Forest ecosystemWildlifePlant lifeInsect lifeWhite-tailed deerForestNaturePark ranger https://avgeeks.videonest.co/videos/380350/if-you-could-see-the-earth-1967 https://img.videonest.org/gamma/380350_thumbnail_resized_v2.webp https://gamma.videonest.org/380350_video_v3.mp4 If You Could See The Earth... (1967) The film takes us on a journey through humanity’s evolving view of our home planet—from ancient beliefs that the Earth was flat and supported by gigantic elephants and turtles, to the scientific discovery that Earth is a spherical body spinning on an invisible axis. It contrasts earlier myths with modern observations, such as ships vanishing over the horizon and the predictable cycle of day and night caused by Earth’s rotation. By comparing Earth to a spinning orange, the film explains how our planet’s rotation creates the diurnal cycle and how gravity pulls everything toward its center, ensuring that objects fall toward the ground. Ultimately, the film uses both historical context and simple experiments with globes and models to illustrate why we experience seasons, why certain regions remain cold, and how this all fits into the larger mechanics of our solar system—all driven by the constant interplay of rotation and gravitational forces. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 567 Flat EarthAncient GreeceIndiaEarth shapeSunSunsetCartographyHistory of ScienceCosmologyAncient BeliefsGeographic Theories https://avgeeks.videonest.co/videos/380351/fish-that-nearly-drowned https://img.videonest.org/gamma/380351_thumbnail_resized_v2.webp https://gamma.videonest.org/380351_video_v3.mp4 Fish That Nearly Drowned A whimsical and educational story told from the perspective of a talking fish named Sylveris, who lives in a diverse aquarium. The film follows Cochril, a special fighting fish from Asia who breathes air and builds bubble nests to care for his eggs. After raising his young, Cochril returns to the community tank, only to encounter another fighting fish, leading to a territorial conflict. The heart of the story occurs when Cochril becomes trapped under a glass pane in the tank and is unable to reach the surface for air. As fish like Cochril depend on atmospheric oxygen, he nearly suffocates—until David, the aquarium caretaker, returns just in time to save him. The film creatively highlights unique adaptations of air-breathing fish and reinforces the importance of understanding animal needs in captivity. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 614 aquariumfishdrowningSouth AmericaAsiaNature Documentaryunderwaterwildlifeconservationaquatic lifeeducationaldocumentaryanimal documentaryfish documentarySouth American wildlife https://avgeeks.videonest.co/videos/380352/flowering-plants-and-their-parts-1966 https://img.videonest.org/gamma/380352_thumbnail_resized_v2.webp https://gamma.videonest.org/380352_video_v3.mp4 Flowering Plants And Their Parts (1966) Explores the structure and function of green plants, focusing on their three main parts: roots, stems, and leaves. Roots anchor the plant and absorb water and minerals through root hairs. Stems transport this water upward through internal tubes and support the plant’s structure. Leaves, arranged to capture maximum sunlight, contain chlorophyll which enables photosynthesis—a process that converts sunlight, water, and carbon dioxide into food (starch) and releases oxygen. The film also highlights the role of flowers as specialized leaves that produce seeds, and discusses plant adaptations to different environments. For example, water hyacinths float and keep their leaves above changing water levels, while desert cacti store water and minimize evaporation through narrow spines instead of leaves. Together, these features help plants survive in diverse habitats while fulfilling their roles in the ecosystem. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 936 botanyplant partsrootsstemsleavesflowering plantsbotanical gardenEncyclopaedia Britannica Filmsplantseducational filmscience documentaryeducational videoplant biologybritannicaplant anatomy https://avgeeks.videonest.co/videos/380353/what-makes-the-wind-blow-1965 https://img.videonest.org/gamma/380353_thumbnail_resized_v2.webp https://gamma.videonest.org/380353_video_v3.mp4 What Makes The Wind Blow? (1965) What Makes the Wind Blow explains the fundamental forces behind wind and air movement using real-world and laboratory demonstrations. The film shows that wind is caused by differences in air pressure, which result from unequal heating of land and water by the sun. Since land heats up faster than water, warmer, lighter air over land rises, and cooler, heavier air from over water moves in to replace it—creating wind. Experiments illustrate how heated air expands, becomes less dense, and rises, while cooler air sinks. The film also demonstrates how large-scale weather patterns, like cold air masses from inland regions, can override local conditions and shift wind direction dramatically. These processes connect local breezes to global air circulation, driven entirely by solar energy and the Earth's rotation, making wind a constant and essential part of Earth’s climate system. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 948 windair pressureocean windscience experimentsmoke bombmeteorologyphysicseducationpressureexperimentwind blow https://avgeeks.videonest.co/videos/380354/the-desert-community-1965 https://img.videonest.org/gamma/380354_thumbnail_resized_v2.webp https://gamma.videonest.org/380354_video_v3.mp4 The Desert Community (1965) Explores how plants and animals survive in one of Earth's harshest environments—deserts, where annual rainfall is less than 10 inches and temperature extremes are common. The film shows how desert life adapts to dryness, heat, and sudden floods: plants like cacti store water in their stems and grow far apart to maximize water absorption, while others like the creosote bush tap into underground sources. Animals use different strategies—some drink daily, others extract moisture from food or store it in their bodies. Many species are nocturnal to avoid daytime heat. The desert's food web is delicately balanced, with producers, herbivores, carnivores, and scavengers all playing a role. But as humans alter desert environments, the film raises important questions about how these changes may disrupt the fragile balance of desert ecosystems. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 669 Desert LifePlant AdaptationsAnimal AdaptationsWater ScarcityExtreme HeatDesert CommunityEncyclopaedia Britannica Filmsdesertplantsanimalssurvivaladaptationecosystemenvironmentecology https://avgeeks.videonest.co/videos/380355/trees-and-their-importance-1966 https://img.videonest.org/gamma/380355_thumbnail_resized_v2.webp https://gamma.videonest.org/380355_video_v3_360.mp4 Trees And Their Importance (1966) Trees and Their Importance explores the vital role trees have played from early American settlement to modern life, emphasizing their ecological, economic, and societal value. It explains how trees function—from roots that absorb water and minerals, to leaves that produce oxygen and food via photosynthesis. Trees regulate climate, prevent soil erosion, provide habitats, and offer critical resources like timber and cellulose for over 5,000 products. The film differentiates between broadleaf deciduous trees and evergreen conifers, and discusses sustainable forestry practices such as tree farming, selective cutting, and reforestation. With a growing population and rising demands for timber and recreation, it calls for increased conservation awareness and proactive forest management to ensure forests thrive for future generations. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 741 deforestationforest firesoil erosionplant growthtreesforestwater collectionwoodenvironmental impactearly settlersecosystemconservationnatureecologyimpact https://avgeeks.videonest.co/videos/380356/beach-a-river-of-sand-1965 https://img.videonest.org/gamma/380356_thumbnail_resized_v2.webp https://gamma.videonest.org/380356_video_v3_360.mp4 Beach: A River Of Sand (1965) The film Beach: A River of Sand explores the natural processes that shape and move sand along coastlines, portraying the beach as a dynamic, flowing system akin to a river. Sand originates from the erosion of rocks in the mountains and is carried to the coast by streams. Once at the beach, wave energy—especially from waves approaching at an angle—drives the sand both back and forth and alongshore through a process called longshore transport. Seasonal wave patterns cause sand to shift between the beach face and offshore bars, while longshore currents move sand down the coast. Man-made structures like breakwaters and dams disrupt this flow, causing buildup or erosion in unexpected places. The film uses models, time-lapse footage, and real-life examples (like Santa Barbara and Santa Monica) to illustrate how human interference in this delicate system requires ongoing maintenance—such as dredging—to prevent harbors from clogging or beaches from disappearing altogether. Ultimately, it emphasizes that when nature’s balance is disrupted, humans must step in to replicate the work nature once handled. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 1209 https://avgeeks.videonest.co/videos/380357/information-revolution-1982 https://img.videonest.org/gamma/380357_thumbnail_resized_v2.webp https://gamma.videonest.org/380357_video_v3_360.mp4 Information Revolution (1982) The 1982 documentary Information Revolution explores the rapid transformation of society through the rise of microcomputers, satellites, and global data networks. It highlights how a tiny silicon chip—the microprocessor—revolutionized everything from home appliances to international communication. From weather forecasting and law enforcement to military defense and airline control, computers and satellites enabled faster data processing, real-time information sharing, and automation. The film illustrates how satellite communications shrunk time and distance, bringing live broadcasts and global data access into homes and businesses. It also emphasizes the profound impact on education, medicine, and commerce—enabling global collaboration and improved quality of life. Ultimately, the film predicts a new societal divide: not between the haves and have-nots, but between the “knows” and “know-nots,” underscoring information as the new wealth in a digitally connected world. LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 837 Information Revolutionmicroprocessorcommunications satelliteslong-distance callscomputer technologyGlen Penniston https://avgeeks.videonest.co/videos/380358/claymation-1978 https://img.videonest.org/gamma/380358_thumbnail_resized_v2.webp https://gamma.videonest.org/380358_video_v3_360.mp4 Claymation (1978) The film explores the art of clay animation, showcasing the meticulous process behind creating animated characters and scenes using clay. It highlights the techniques and tools used by animators, the importance of lighting and sound, and the detailed planning required to bring characters to life frame by frame. The film also discusses the evolution of clay as a serious animation medium and the collaborative efforts involved in production. Keywords clay animation, animators, filmmaking, techniques, character design, stop-motion, production process, lighting, sound, Academy Award LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 1055 ClaymationWill VintonAcademy AwardStop Motion Animation3D animationBob GardnerDocumentaryAward Winning FilmsAnimationFilmArts & CraftsClose Mondays https://avgeeks.videonest.co/videos/380359/ugly-little-boy-1977 https://img.videonest.org/gamma/380359_thumbnail_resized_v2.webp https://gamma.videonest.org/380359_video_v3_converted.mp4 Ugly Little Boy (1977) In "Ugly Little Boy," a pediatric nurse named Miss Fellows is assigned to care for a Neanderthal child, who is part of a groundbreaking scientific experiment. The facility aims to study the child before sending him back to his time, but as Miss Fellows grows attached to him, she struggles with the ethical implications of the experiment and the impending release that could separate them forever. The film explores themes of emotional detachment in scientific work and raises questions about humanity and the moral responsibilities of caretakers. Keywords Neanderthal, science fiction, nurse, ethical dilemmas, emotional attachment, time travel, experiment, humanity LIMITED DISTRIBUTION. 2025-04-11T00:00:00.000Z yes A/V Geeks 16mm Films no 1511 https://avgeeks.videonest.co/videos/380360/the-civil-war-postwar-period-1964 https://img.videonest.org/gamma/380360_thumbnail_resized_v2.webp https://gamma.videonest.org/380360_video_v3_360.mp4 The Civil War: Postwar Period (1964) The film discusses the aftermath of the Civil War, focusing on the devastation in the South and the challenges faced by returning Confederate and Union veterans. It highlights the political conflict between President Andrew Johnson's conservative approach to Reconstruction and the radical Republicans in Congress who sought to enforce civil rights and reshape Southern governance. The film details the implementation of the Freedmen's Bureau, the introduction of the 14th and 15th Amendments, and the eventual rise of resentment from Southern whites, culminating in the emergence of groups like the Ku Klux Klan. It underscores the ongoing struggles with civil rights and the complexities of reintegrating the South into the Union. Keywords Civil War, Reconstruction, Andrew Johnson, radical Republicans, Freedmen's Bureau, 14th Amendment, 15th Amendment, Ku Klux Klan, Southern politics, civil rights Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 966 Civil WarReconstructionPostwar PeriodConfederate VeteransAbraham LincolnAndrew JohnsonSouthern CitiesNational EconomyAmerican Civil WarPost-Civil WarReconstruction Era19th Century AmericaUnited States History https://avgeeks.videonest.co/videos/380361/division-1960s https://img.videonest.org/gamma/380361_thumbnail_resized_v2.webp https://gamma.videonest.org/380361_video_v3_360.mp4 [Division, 1960s] The film is an educational tutorial on division aimed at helping a student named Bob understand the concept of division using place value, dividends, divisors, and quotients. It explains how to divide numbers, check answers, and handle remainders through practical examples. The tutorial emphasizes the relationship between multiplication and division, illustrating how multiplication facts can assist in solving division problems. Keywords division, place value, dividend, divisor, quotient, remainder, educational, tutorial, multiplication, examples Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 660 long divisiondivisionmath lessonvisual aideducationalelementary schoolmathematicslearningeducationNorthwestern University https://avgeeks.videonest.co/videos/380362/right-on-be-free-1971 https://img.videonest.org/gamma/380362_thumbnail_resized_v2.webp https://gamma.videonest.org/380362_video_v3_360.mp4 Right On / Be Free (1971) The film "Right On Be Free" emphasizes the importance of art and community in the African American experience. It calls for black individuals to engage with their heritage through artistic expression, highlighting the necessity of creating positive images and fostering a sense of accomplishment among the youth. The narrative stresses the need for unity and collaboration between black men and women in the pursuit of justice and liberation for all. The film showcases the transformative power of art in building awareness and pride within the community. Keywords African American art, community, artistic expression, unity, liberation, youth empowerment, positive imagery, cultural heritage 2025-04-10T00:00:00.000Z yes A/V Geeks 16mm Films no 908 Black artAfrican American artsocial justiceartistic expressionDavid BradfordDocumentaryInterviewsAfrican American StudiesArt HistoryCultural StudiesVisual Arts https://avgeeks.videonest.co/videos/380363/av-geeks-16mm-lunch-4-11-2025 https://img.videonest.org/gamma/380363_thumbnail_resized_v2.webp https://gamma.videonest.org/380363_video_v3_360.mp4 A/V Geeks 16mm Lunch 4-11-2025 Old films, new eyes. Let’s roll some 16mm! #avgeeks #16mmfilms SILVER- HEIRLOOMS OF TOMORROW reel 2 Tomorrow May Be Judgement Day Tomorrow's Railroading Today (partial) Tomorrow's Transit Today Pick Your Tomorrow 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 3950 https://avgeeks.videonest.co/videos/391297/behind-the-wheel-1974 https://img.videonest.org/gamma/391297_thumbnail_resized_v2.webp https://gamma.videonest.org/391297_video_v3.mp4 Behind The Wheel (1974) The film presents a series of driving scenarios where the viewer assumes the role of the driver. Each segment features various situations, such as driving on a clear freeway, showcasing a new motorcycle to a girlfriend, encountering an accident, dealing with traffic delays, and deciding whether to attend a party or go to the movies. The interactive narrative encourages viewers to make choices as the driver, emphasizing the thrill and responsibility of driving. Keywords driving, motorcycle, freeway, interactive, choices, accident, traffic, party, movie, adventure 2025-04-14T00:00:00.000Z yes A/V Geeks 16mm Films no 533 Honda 750ccMotorcycle RideFreeway DrivingUnexpected EncounterTraffic Trigger FilmsNew VehiclesVintage MotorcycleFreeway TrafficMotorcycle TripHonda750ccMotorcyclingAutomotiveTransportationProduct https://avgeeks.videonest.co/videos/391298/working-with-older-people-1977 https://img.videonest.org/gamma/391298_thumbnail_resized_v2.webp https://gamma.videonest.org/391298_video_v3.mp4 Working With Older People (1977) The film "Working With Older People (1977)" depicts the daily interactions and challenges faced by elderly individuals in a senior citizens center. It highlights the loneliness experienced by some seniors, such as Mr. Allison, who frequently calls for attention after losing his wife. The film also addresses issues like financial struggles with Medicaid and the reluctance of seniors like Mrs. White to move into nursing homes. Community support and friendship among seniors are emphasized, showcasing their efforts to maintain independence and social connections despite health and mobility challenges. Keywords senior citizens, loneliness, community support, Medicaid, nursing home, independence, friendship, elderly care 2025-04-14T00:00:00.000Z yes A/V Geeks 16mm Films no 599 Older Americans ActSenior Citizen1977Mrs. BrownleeMr. Allisonphone callDocumentarySocial SciencesGerontologyElderlyLife in 1977American SocietySocial HistoryOral HistoryTelephone Calls https://avgeeks.videonest.co/videos/391299/northeast-gateway-for-a-nation-1966 https://img.videonest.org/gamma/391299_thumbnail_resized_v2.webp https://gamma.videonest.org/391299_video_v3.mp4 Northeast: Gateway For A Nation (1966) The film depicts the logistical challenges faced by the MS Republic of Ecuador, a freighter delayed by fog while transporting cargo from various U.S. states to New York. It highlights the importance of the Northeast as a transportation hub, detailing the coordination required to ensure timely delivery of goods, such as copper ingots and transformers, under tight deadlines. The narrative emphasizes the interconnectedness of shipping, railroads, and air transport in facilitating trade and the potential consequences of delays. Keywords logistics, shipping, Northeast, transportation, cargo, delays, freight, MS Republic of Ecuador, customs, air transport LIMITED DISTRIBUTION. 2025-04-14T00:00:00.000Z yes A/V Geeks 16mm Films no 624 MS RepublicaEcuadorcargo shipsheavy seasfogshippingmaritimetransportationlogisticsNew Yorkcargooceanseavesselvoyage https://avgeeks.videonest.co/videos/391300/man-incredible-machine-1975 https://img.videonest.org/gamma/391300_thumbnail_resized_v2.webp https://gamma.videonest.org/391300_video_v3.mp4 Man - Incredible Machine (1975) The film explores the complexities of the human body, highlighting its evolutionary heritage, unique functions, and the intricate systems that sustain life. It delves into the anatomy and physiology of the skin, eyes, ears, respiratory and circulatory systems, and the brain, showcasing how these components work together to create the human experience. The documentary emphasizes the marvels of human capabilities, both physical and mental, and the ongoing advancements in medical science aimed at repairing and enhancing bodily functions. Keywords human body, anatomy, physiology, evolution, skin, senses, hearing, vision, respiration, circulation, brain, medical advancements, health LIMITED DISTRIBUTION. 2025-04-14T00:00:00.000Z yes A/V Geeks 16mm Films no 1679 https://avgeeks.videonest.co/videos/391301/discovering-the-music-of-japan-1966 https://img.videonest.org/gamma/391301_thumbnail_resized_v2.webp https://gamma.videonest.org/391301_video_v3.mp4 Discovering The Music Of Japan (1966) Discovering the Music of Japan (1966), written and produced by Bernard Wilets, provides an engaging introduction to Japan’s rich musical traditions. This 22-minute educational film explores the history, construction, and performance techniques of Japan’s three major traditional instruments: the koto, shamisen, and shakuhachi. Through demonstrations and contextual explanations, viewers gain insight into how these instruments are used in both historical and modern settings. The film also highlights traditional Japanese singing and dancing, offering a well-rounded glimpse into the country’s cultural expressions through music and performance. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 1196 KotoShakuhachiShamisenJapanese musicJapanese CultureTraditional Japanese MusicDocumentaryJapanAsian MusicWorld MusicInstrumental MusicBFA Educational Media https://avgeeks.videonest.co/videos/391302/infectious-hazards-of-bacteriological-techniques-1950s https://img.videonest.org/gamma/391302_thumbnail_resized_v2.webp https://gamma.videonest.org/391302_video_v3.mp4 Infectious Hazards of Bacteriological Techniques (1950s?) "Infectious Hazards of Bacteriological Techniques" is a 16mm film that discusses the dangers of infection in bacteriological laboratories and how to minimize them. The film, which is 13 minutes long and in color, covers techniques and procedures used in the lab, highlighting the risks and safety measures. It was produced by the National Medical Audiovisual Center (NMAC). Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 1080 Infectious DiseasesAirborne BacteriaBacteriological TechniquesLaboratory SafetyFort DetrickUS ArmyPublic HealthHistorical FootageScienceMedicineResearchMilitaryBiosecurityGerm WarfareEpidemiology https://avgeeks.videonest.co/videos/391303/creditwise-opportunity-costs-1982 https://img.videonest.org/gamma/391303_thumbnail_resized_v2.webp https://gamma.videonest.org/391303_video_v3.mp4 Creditwise - Opportunity Costs (1982) The film presents a scenario where two friends, Tina and Becky, navigate the complexities of consumer credit and opportunity costs during a shopping trip. Tina, an impulsive spender, struggles with her finances as she prioritizes buying a jacket over fixing her car's brakes. Through various interactions, the film illustrates the concept of opportunity costs—what one sacrifices when making a financial decision—and highlights the responsibilities that come with using credit. Tina's lack of understanding about managing credit leads her into debt, while Becky emphasizes the importance of being financially responsible. Keywords consumer credit, opportunity costs, financial responsibility, debt, impulsive spending, budgeting, credit limits, education, shopping, friendship 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 888 opportunity costconsumer behaviorcredit cardshopping tripeconomicsfinancial literacyspending habitsdecision makingpersonal financebudgetingTina LeelandBecky Houston https://avgeeks.videonest.co/videos/391304/crack-in-the-wall-1971 https://img.videonest.org/gamma/391304_thumbnail_resized_v2.webp https://gamma.videonest.org/391304_video_v3.mp4 Crack In The Wall (1971) The film depicts the post-World War II division of Berlin into East and West, highlighting the struggles and resilience of West Berliners amidst the devastation of war. Following the partition, tensions rise as the Soviet Union imposes a blockade in 1948, leading to the Berlin Airlift. The construction of the Berlin Wall in 1961 symbolizes the ideological divide, trapping East Germans and prompting desperate attempts to flee to the West. The film chronicles the human cost of this division, including tragic stories of those who lost their lives trying to escape. It also touches on international diplomatic efforts to ease tensions and the enduring spirit of the people living under the shadow of the wall. Keywords Berlin, Cold War, division, East Germany, West Berlin, blockade, Berlin Airlift, Berlin Wall, refugees, diplomacy 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 788 World War IIBerlinPost War GermanyHarry TrumanWinston ChurchillJoseph StalinWest BerlinEast BerlinCold WarGermanyAllied PowersSoviet Union https://avgeeks.videonest.co/videos/391305/exploring-the-human-nervous-system-1963 https://img.videonest.org/gamma/391305_thumbnail_resized_v2.webp https://gamma.videonest.org/391305_video_v3_360.mp4 Exploring the Human Nervous System (1963) Exploring the Human Nervous System (1963), produced by Churchill Films in collaboration with the National Committee for Research in Neurological Disorders, presents a detailed introduction to the structure and function of the human nervous system. The 23-minute educational film begins by comparing the simple nerve nets of the hydra and the segmented system of the earthworm to the far more complex human nervous system. Using clear animation, it explains the physiology of reflex arcs, how the body responds to painful stimuli, and the roles of specific brain centers. The film also introduces contemporary neurological research, including early studies on memory, making it both a foundational overview and a glimpse into the evolving field of neuroscience. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 1386 https://avgeeks.videonest.co/videos/391306/an-end-to-darkness-1950 https://img.videonest.org/gamma/391306_thumbnail_resized_v2.webp https://gamma.videonest.org/391306_video_v3_360.mp4 An End To Darkness (1950) The film follows the journey of a young man who reflects on his childhood in a village steeped in tradition and fear of the supernatural. He experiences a transformative encounter with a stranger named David, who introduces him to the power of words and Christianity, challenging the village's beliefs in dark spirits. After facing personal tragedy and illness in his family, he learns the value of humility, faith, and education through his relationship with David. Ultimately, he dedicates himself to serving his community, embracing a new path that leads him from his village to a mission station, and eventually to a promising future in government service, all while remaining committed to helping his people. Keywords village, tradition, transformation, Christianity, words, humility, faith, education, community, service Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 1527 https://avgeeks.videonest.co/videos/391307/safety-in-the-home-3rded-1965 https://img.videonest.org/gamma/391307_thumbnail_resized_v2.webp https://gamma.videonest.org/391307_video_v3.mp4 Safety In The Home (3rdEd , 1965) The film emphasizes the importance of safety at home, illustrating that most accidents occur in familiar environments where people feel secure. It showcases various scenarios involving children making choices that can lead to safe or dangerous outcomes. Through examples, it encourages viewers to think ahead and make wise decisions to prevent accidents, highlighting that safety is often about making the right choices in everyday situations. Keywords safety, home accidents, decision-making, children's choices, prevention, awareness, risk, household safety, education LIMITED DISTRIBUTION. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 683 Home SafetyAccident PreventionSafety in the HomeEncyclopaedia Britannica FilmsDocumentaryEducationhome safety https://avgeeks.videonest.co/videos/391308/eight-parts-of-a-business-letter-1944 https://img.videonest.org/gamma/391308_thumbnail_resized_v2.webp https://gamma.videonest.org/391308_video_v3.mp4 Eight Parts Of A Business Letter (1944) The film discusses the significance of letter writing in American business and government, highlighting the vast number of letters sent each year. It emphasizes the standardization of business correspondence, including stationery size, letter structure, and the importance of trained secretaries in maintaining proper form. The eight parts of a business letter are outlined, along with the correct folding and addressing techniques for envelopes, showcasing the meticulous nature of business communication. Keywords letter writing, business correspondence, standardization, stationery, trained secretaries, parts of a letter, addressing, American business, communication Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 650 Business LetterLetter WritingOffice CorrespondenceUS MailAir MailPostal ServiceBusiness CommunicationFormal LetterProfessional WritingWalter O. Gutlohn Inc.William Lewin https://avgeeks.videonest.co/videos/391309/creating-instructional-materials-1963 https://img.videonest.org/gamma/391309_thumbnail_resized_v2.webp https://gamma.videonest.org/391309_video_v3.mp4 Creating Instructional Materials (1963) Creating Instructional Materials (1963) emphasizes the value of well-designed educational aids through a series of realistic classroom scenes. Produced by Centron Corp. and McGraw-Hill Films, the 15-minute film showcases how thoughtfully prepared visual and audio materials can enhance student engagement, reinforce learning, and improve teaching effectiveness. The film presents various examples of instructional media in use, demonstrating their role in clarifying complex concepts and accommodating diverse learning styles. Aimed at educators, the film underscores the importance of planning and creativity in the development of classroom materials that actively support instruction. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 872 Instructional MaterialsAudio VisualTape RecorderMicroscopesHands-on learningStudent projectsEducationClassroomTeaching Methods https://avgeeks.videonest.co/videos/391310/the-hoja-tries-to-please-all-1950s https://img.videonest.org/gamma/391310_thumbnail_resized_v2.webp https://gamma.videonest.org/391310_video_v3.mp4 The Hoja Tries To Please All (1950s) The film features a narrative about Nasr-ed-din Hoja, who learns a valuable lesson about the futility of trying to please everyone. As he and his son travel to deliver a letter, they encounter various people who criticize their choices, leading to confusion and ultimately the loss of their donkey. The story highlights the idea that attempting to satisfy everyone can result in failing to please anyone, including oneself. Keywords Nasaredin Hocha, lesson, donkey, travel, cooperation, criticism, wisdom, pleasing others Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 520 Nasreddin Hojaanimated filmshort filmcoffeehousedonkeycooperationanimated shortcomedyfolk taleTurkeyhumorfamily filminternational relationsshort animationclassic tale https://avgeeks.videonest.co/videos/391311/focus-on-berlin-1961 https://img.videonest.org/gamma/391311_thumbnail_resized_v2.webp https://gamma.videonest.org/391311_video_v3.mp4 Focus On Berlin (1961) The film chronicles the history of Berlin from 1939 to the 1960s, highlighting the rise and fall of Nazi Germany, the onset of World War II, and the subsequent division of the city during the Cold War. It depicts the devastation of Berlin, the post-war reconstruction of West Berlin, and the tensions between East and West, culminating in the construction of the Berlin Wall. The narrative emphasizes the resilience of the people of West Berlin and the ideological struggle between democracy and communism, as well as the ongoing refugee crisis. Keywords Berlin, World War II, Nazi Germany, Cold War, reconstruction, East Berlin, West Berlin, Berlin Wall, refugees, communism, democracy 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 932 World War IINazi GermanyAdolf HitlerBerlin19391945Red ArmyGermanyNazismHolocaustSecond World WarEuropean TheatreMilitary HistoryHistorical DocumentaryWar Crimes https://avgeeks.videonest.co/videos/391312/animals-in-autumn-1957 https://img.videonest.org/gamma/391312_thumbnail_resized_v2.webp https://gamma.videonest.org/391312_video_v3.mp4 Animals In Autumn (1957) The film explores how various animals prepare for winter during autumn. It highlights the migration of birds like robins and geese to warmer climates, the hibernation habits of turtles, frogs, and ground squirrels, and the food-gathering behaviors of other animals like raccoons and muskrats. The film illustrates the changes in fur color and body preparation that animals undergo, emphasizing the diverse strategies they employ to survive the harsh winter months. Keywords autumn, animals, winter preparation, migration, hibernation, food storage, fur changes, nature, survival LIMITED DISTRIBUTION. 2025-04-13T00:00:00.000Z yes A/V Geeks 16mm Films no 623 MigrationWinterAnimalWildlifeHibernationNatureAnimalsAutumnCocoon https://avgeeks.videonest.co/videos/391313/our-post-office-revised-ed-1965 https://img.videonest.org/gamma/391313_thumbnail_resized_v2.webp https://gamma.videonest.org/391313_video_v3.mp4 Our Post Office (Revised Ed, 1965) In this educational film, siblings Susan and Jimmy Gray prepare to send a birthday gift to their mother through the mail. They learn how to properly address an envelope, obtain a money order, and purchase stamps at the post office. The film details the process of mail sorting and delivery, explaining how letters and packages are handled by postal workers and transported via various means, including trains and airplanes. Ultimately, the film highlights the importance of the postal service in helping the children surprise their mother. Keywords postal service, mail delivery, envelope addressing, money order, stamps, sorting process, birthday gift, educational film LIMITED DISTRIBUTION. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 604 Money orderPost officeMilwaukeeWisconsinMiddle West Specialty Co.HistoryDocumentaryEvanstonIllinoisFinancial HistoryPostal HistoryMidwest1900sBusiness HistoryAmerican History https://avgeeks.videonest.co/videos/391314/the-donkeys-barley-ration-1950s https://img.videonest.org/gamma/391314_thumbnail_resized_v2.webp https://gamma.videonest.org/391314_video_v3.mp4 The Donkey's Barley Ration (1950s) Marionettes! The film follows a donkey named Slowfoot and his owner, Nasr-ed-din Hoja, in a quaint town where they visit a coffee house to hear stories. The villagers discuss the importance of cooperation with American farmers for better food production, but Hoja presents a misguided theory that suggests cutting down on his donkey's food can save grain. His plan initially receives praise, but ultimately leads to disaster when the donkey dies from starvation, illustrating the necessity of proper nourishment for health and prosperity. Keywords donkey, Nasaredin Hocha, village, food production, cooperation, economy, starvation, health, prosperity, folly Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 627 Nasreddin Hodjapuppet showdonkeycoffeehousetalesfolklorecomedyanimationshort filmTurkish folklorehumortraditional storiespuppet animationfarmersAmerican aid https://avgeeks.videonest.co/videos/391315/puerto-rico-votes-to-keep-commonwealth-status-1967 https://img.videonest.org/gamma/391315_thumbnail_resized_v2.webp https://gamma.videonest.org/391315_video_v3.mp4 Puerto Rico Votes to Keep Commonwealth Status (1967) In 1967, the Puerto Rican Legislative Assembly enacted the Plebiscite Act, enabling a referendum on the island's political status, which resulted in 60.4% of voters choosing the commonwealth option. However, subsequent legislative efforts in the 1970s to address Puerto Rico's status stalled in congressional committees. Additionally, the Partido Estadista Republicano boycotted the referendum, contributing to its decline and the rise of the new Partido Nuevo Progresista (PNP). Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 116 Puerto RicoPlebiscite1967votingelectionpolitical statusCommonwealthStatehoodIndependenceSan Juanballot https://avgeeks.videonest.co/videos/391316/pauahi-crater-eruption-silent-1979 https://img.videonest.org/gamma/391316_thumbnail_resized_v2.webp https://gamma.videonest.org/391316_video_v3.mp4 Pauahi Crater Eruption (silent, 1979) Pauahi Crater, located in Hawaii Volcanoes National Park, is a significant volcanic feature measuring 2,000 feet long, 1,300 feet wide, and 300 feet deep. It is situated approximately 3 miles from the Chain of Craters Road on the Big Island of Hawaii. The crater has experienced three notable eruptions: the first in May 1973, followed by a longer eruption from November 10 to December 9, 1973, which produced extensive fissures, and a brief eruption on November 16, 1979 of which this footage documents. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 1755 https://avgeeks.videonest.co/videos/391317/rally-in-support-of-the-vietnam-war-in-wakefield-massachusetts-silent-1967 https://img.videonest.org/gamma/391317_thumbnail_resized_v2.webp https://gamma.videonest.org/391317_video_v3.mp4 Rally in Support of the Vietnam War in Wakefield, Massachusetts (silent, 1967) The film depicts a pro-Vietnam War rally in Wakefield, Massachusetts, organized by high school senior Paul Christopher, Jr. This event was a reaction to the October 16, 1967, protest in Boston, where more than 280 men publicly burned their draft cards. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 55 Vietnam WarAnti-WarProtestDraft CardBurningDemonstrationSoldiersUnited States1960sCivil Disobedience https://avgeeks.videonest.co/videos/391318/usa-write-my-boy-1957 https://img.videonest.org/gamma/391318_thumbnail_resized_v2.webp https://gamma.videonest.org/391318_video_v3.mp4 U.S.A. - Write My Boy (1957) The film highlights the immigrant experience in America, focusing on the contributions of diverse communities during wartime. It showcases a program in New York City where volunteers help non-English speaking parents write letters to their soldier sons overseas, emphasizing the emotional significance of these communications. Additionally, it features the invention and development of helicopters by Igor Sikorsky, illustrating their potential military applications and future civilian uses. The narrative also humorously portrays the training of a dog in the army, emphasizing the bond between soldiers and their canine companions. Keywords immigrants, letters, soldiers, volunteers, Igor Sikorsky, helicopter, wartime, training, dogs, military Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 880 Armed ForcesNew York Cityletter writingWorld War IIsoldierscorrespondencesocial impactDocumentaryHistoryWarUnited FilmsScreen Magazinetranslation servicemilitaryletters https://avgeeks.videonest.co/videos/391319/olympic-the-incredible-wilderness-1973 https://img.videonest.org/gamma/391319_thumbnail_resized_v2.webp https://gamma.videonest.org/391319_video_v3.mp4 Olympic: The Incredible Wilderness (1973) The film explores the breathtaking landscapes of Olympic National Park, showcasing its diverse environments, including snow-capped mountains, lush rainforests, and serene lakes. It highlights various outdoor activities such as hiking and camping, while emphasizing the park's natural beauty and wildlife. Visitors can experience stunning views from Hurricane Ridge, enjoy the tranquility of Lake Crescent, and explore the rich ecosystems of the rainforest. The film encourages viewers to appreciate the park's unique flora and fauna, as well as its rugged coastline. Keywords Olympic National Park, landscapes, hiking, camping, wildlife, Hurricane Ridge, Lake Crescent, rainforest, ecosystems, coastal scenery Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 541 Olympic National ParkMount OlympusHurricane RidgePacific Oceanalpine meadowsrainforestglacierswildlifenature documentarytravel documentarynational parkwashington stateolympic peninsulahikingscenery https://avgeeks.videonest.co/videos/391320/the-donkey-broker-1950s https://img.videonest.org/gamma/391320_thumbnail_resized_v2.webp https://gamma.videonest.org/391320_video_v3.mp4 The Donkey Broker (1950s?) Marionettes! The film presents a dialogue between two candidates during an election, highlighting the typical dynamics of political discourse. One candidate focuses on empty promises of a bright future, while the other emphasizes understanding local issues. The story of Nasr-ed-din Hoja and his stubborn donkey serves as a metaphor for the importance of discerning between genuine advice and mere rhetoric. Ultimately, the Hoja learns a lesson about trusting those who offer honest counsel rather than those who merely speak loudly. Keywords election, candidates, political discourse, Nasreddin Hocha, donkey, wisdom, advice, empty promises, local issues, metaphor Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 506 puppet showelectionpolitical satirecandidatesvotingargumentpoliticalcomedypuppetssatireelection humorshort film https://avgeeks.videonest.co/videos/391321/serenade-to-a-maid-1930s https://img.videonest.org/gamma/391321_thumbnail_resized_v2.webp https://gamma.videonest.org/391321_video_v3.mp4 Serenade To A Maid (1930s?) Made by an amateur cinema club. "Serenade to a Maid" features a whimsical musical performance where the singer expresses deep affection through poetic lyrics. The song captures a playful contrast between heights and depths, using imagery of the moon and snow to convey love and admiration. The ensemble contributes to the lively atmosphere, emphasizing the theme of devotion. Keywords musical, love, poetry, ensemble, affection, whimsical, performance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 187 Dottie DeForresttheatrical performancecomedyClassic FilmSerenade to a MaidAmateur Movie SocietyVan JenkinsBergen County https://avgeeks.videonest.co/videos/391322/project-head-start-in-arizona-1970s https://img.videonest.org/gamma/391322_thumbnail_resized_v2.webp https://gamma.videonest.org/391322_video_v3.mp4 Project Head Start in Arizona (1970s) The film explores the lives of the Havasupai Indians living in the Grand Canyon, highlighting their remote lifestyle and connection to the land. It focuses on the educational efforts of Mr. and Mrs. Steven Hurst, who teach English to local children through Project Head Start. Utilizing tools like Polaroid cameras and language masters, the children learn the English language by associating words with images, bridging the gap between their traditional culture and modern education. Keywords Havasupai Indians, Grand Canyon, education, Project Head Start, English language, Polaroid cameras, learning, remote lifestyle Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-12T00:00:00.000Z yes A/V Geeks 16mm Films no 328 Grand CanyonHavasupaiArizonaPolaroid cameraphotographyHead StartteachingchildrenNative American CultureDocumentaryTravelEducation https://avgeeks.videonest.co/videos/395792/the-little-angels-of-korea-korean-1960s https://img.videonest.org/gamma/395792_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395792/the-little-angels-of-korea-korean-1960s The Little Angels of Korea (Korean, 1960s) The film features a Korean children's dance troupe, consisting of 25 girls and one boy, who toured the United States, performing in 62 cities across 25 states. Their performances included traditional dances and were particularly memorable in Washington D.C. and Houston, where they attracted large audiences. Highlights of their trip included visits to Disneyland and meeting celebrities like John Wayne. They also performed at a hospital for veterans, which deeply moved both the performers and the audience. Keywords Korean dance troupe, children's performance, United States tour, Washington D.C., Houston, Disneyland, John Wayne, veterans, cultural exchange Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.560Z yes A/V Geeks 16mm Films no 637 https://avgeeks.videonest.co/videos/395793/heritage-of-the-chesapeake-1964 https://img.videonest.org/gamma/395793_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395793/heritage-of-the-chesapeake-1964 Heritage of the Chesapeake (1964) The film "Heritage of the Chesapeake," produced in 1964 and released in 1965, showcases the traditional practice of oyster dredging under sail in the Chesapeake Bay near Cambridge, Maryland. It highlights the continuity of this fishing tradition passed down through generations. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 950 https://avgeeks.videonest.co/videos/395794/the-city-time-of-decision-1967 https://img.videonest.org/gamma/395794_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395794/the-city-time-of-decision-1967 The City Time of Decision (1967) The film "The City: Time of Decision," produced and directed by Tibor Hirsch in 1967, addresses the escalating challenges faced by U.S. cities and the strategies implemented to tackle these issues. Key topics include slum clearance, urban renewal, traffic congestion, electric transport, pollution control, and the development of new towns, with narration provided by Jim Jensen. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 1579 https://avgeeks.videonest.co/videos/395795/hour-of-decision-untitled-1950s https://img.videonest.org/gamma/395795_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395795/hour-of-decision-untitled-1950s Hour Of Decision - Untitled (1950s) In this episode of "Hour of Decision," Billy Graham discusses the theme of God's pursuit of humanity, emphasizing that individuals often search for God in vain while He is actively seeking them. The message highlights the love of God, the need for salvation, and the importance of surrendering to Jesus Christ. Through personal anecdotes and reflections, the speaker encourages listeners to recognize God's presence in their lives and to accept His invitation for a relationship. Keywords God, salvation, Jesus Christ, seeking, love, surrender, faith, prayer Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 898 https://avgeeks.videonest.co/videos/395796/the-westward-movement-texas-and-the-mexican-war-1966 https://img.videonest.org/gamma/395796_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395796/the-westward-movement-texas-and-the-mexican-war-1966 The Westward Movement: Texas And The Mexican War (1966) The film "The Westward Movement: Texas And The Mexican War" explores the historical context of Texas' colonization by American settlers after Mexico gained independence from Spain. It details the tensions between the American colonists, who brought slavery and sought economic opportunities, and the Mexican government, which sought to maintain control over the territory. As American settlers flooded into Texas, they clashed with Mexican laws and governance, leading to the Texas Revolution and ultimately the annexation of Texas by the United States. This annexation triggered the Mexican-American War and intensified the national debate over slavery, contributing to the eventual outbreak of the Civil War. Keywords Texas, Mexican War, American settlers, colonization, slavery, Texas Revolution, annexation, Manifest Destiny, Civil War LIMITED DISTRIBUTION. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 1057 https://avgeeks.videonest.co/videos/395797/chemical-changes-all-about-us-special-version-1960 https://img.videonest.org/gamma/395797_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395797/chemical-changes-all-about-us-special-version-1960 Chemical Changes All About Us (Special Version, 1960) The film explores the concept of chemical changes by comparing everyday kitchen activities, like baking a cake, to laboratory experiments. It explains how elements such as sulfur and iron can undergo chemical transformations when heated or mixed with other substances, resulting in new compounds. The film highlights various examples, including the formation of iron sulfide, calcium hydroxide, and magnesium oxide, and discusses the role of energy in these changes. It emphasizes that chemical changes occur constantly in our lives, from cooking to biological processes and even in machines. Keywords chemical changes, kitchen chemistry, baking, sulfur, iron, compounds, energy, oxidation, photosynthesis, digestion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 849 https://avgeeks.videonest.co/videos/395798/hoja-and-the-camels-head-1950s https://img.videonest.org/gamma/395798_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395798/hoja-and-the-camels-head-1950s Hoja and the Camel's Head (1950s) The film depicts a narrative set in a peaceful city where a donkey carries the protagonist to meet a wise figure, the shake. The shake shares stories of Nasr-ed-din Hoja, emphasizing the importance of education and critical thinking in solving societal problems. A debate ensues between the shake and a young troublemaker, Hamid, about progress and tradition, illustrating the tension between modernity and cultural heritage. Through a story about Nasaredine Hocha's cleverness, the film conveys lessons about wisdom, the value of questioning, and the dangers of deceit. Keywords Nasaredine Hocha, education, tradition, progress, wisdom, storytelling, cultural heritage, critical thinking, societal problems Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 538 https://avgeeks.videonest.co/videos/395799/building-an-outline-1948 https://img.videonest.org/gamma/395799_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395799/building-an-outline-1948 Building An Outline (1948) In this educational video, two students, Jim and Bill, navigate the process of writing reports for their American history class. Jim learns the importance of creating outlines to organize his thoughts and materials effectively, while Bill struggles without one. As Jim develops his outline, he finds it helps him understand his topic better and saves him time in the writing process. Ultimately, Jim's well-organized report earns him a better grade than Bill's disorganized effort, highlighting the value of outlining in academic work. Keywords outlining, report writing, organization, study skills, education, American history, Jim, Bill Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 592 https://avgeeks.videonest.co/videos/395800/building-typing-skill-1947 https://img.videonest.org/gamma/395800_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/395800/building-typing-skill-1947 Building Typing Skill (1947) The film discusses the process of improving typing skills, focusing on increasing speed while maintaining control. It follows George as he practices typing faster, initially losing control and tension. The film emphasizes the importance of foundational techniques such as relaxation, precise control, and uniform stroking power. George learns to analyze and rebuild his skills by focusing on weaknesses and practicing proper posture and technique. Through consistent practice, he gains confidence and improves his typing speed. Keywords typing skills, speed, control, relaxation, technique, practice, posture, confidence, foundational techniques Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T14:42:14.561Z yes A/V Geeks 16mm Films no 621 https://avgeeks.videonest.co/videos/395801/av-geeks-16mm-lunch-4-14-2025 https://img.videonest.org/gamma/395801_thumbnail_resized_v2.webp https://gamma.videonest.org/395801_original_360.mp4 AV Geeks 16mm Lunch 4-14-2025 Let's watch those films! They aren't going to watch themselves! #avgeeks #16mmfilms Carpenter of Nazareth (silent) Art and Life in Italy Basic Typing Skill English Influence In The United States On Impact Bike-wise To Be Sure 2025-04-15T14:42:14.671Z yes A/V Geeks 16mm Films no 4637 https://avgeeks.videonest.co/videos/398070/av-tape-record-a-play-flim-and-tape-splice-silent-1950s https://img.videonest.org/gamma/398070_thumbnail_resized_v2.webp https://gamma.videonest.org/398070_video_v3.mp4 AV Tape Record a Play Flim and Tape Splice (silent, 1950s?) This silent film showcases techniques for splicing film and magnetic tape, both by hand and using a splicer. A reviewer expresses nostalgia for the content, highlighting the impressive visuals and the depiction of vintage industrial classroom equipment, including a record player and a tape recorder. The reviewer emphasizes the charm and historical significance of these devices, recommending the video as a must-see for those interested in audio-visual technology. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 425 film splicingmotion picturemagnetic taperecord playertape recorderGriswold film splicerColumbia RecordsInstructional Media ProductionsRevere 3MScotch recording tapeaudio recording1950s https://avgeeks.videonest.co/videos/398071/california-baptists-at-work-silent-1940s https://img.videonest.org/gamma/398071_thumbnail_resized_v2.webp https://gamma.videonest.org/398071_video_v3.mp4 California Baptists At Work (silent, 1940s?) "California Baptists At Work," which primarily showcases the activities of Baptists in California. The film features scenes of church gatherings and highlights the hours of operation for various Baptist churches. Overall, it provides a glimpse into the community's religious practices. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 977 California BaptistsSouthern Baptist ConventionMissionary workCaliforniaVintage carsSouthern Baptist ChurchSan FranciscoGolden Gatevintage footagearchitectureCity Skylinechurchgoersreligious gatheringchurch gatheringchildren https://avgeeks.videonest.co/videos/398072/hodja-shares-his-yoghurt-1950s https://img.videonest.org/gamma/398072_thumbnail_resized_v2.webp https://gamma.videonest.org/398072_video_v3.mp4 Hodja Shares His Yoghurt (1950s) This Hoja installment has his named spelled differently and is done with hand puppets and not marionettes. The film features a storyteller sharing humorous tales about the character Hoja and his experiences with friends in a coffee shop. In a light-hearted narrative, Hoja attempts to auction off his stubborn donkey, only to end up buying it back. The story touches on themes of friendship, sharing, and the quirks of human nature, particularly through the dialogue between Hoja and his friends, including Hammed, who has unconventional ideas about sharing. Keywords storyteller, Hoja, donkey, coffee shop, friendship, humor, sharing, auction, narrative Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 483 The Hodjadonkey auctionpuppet showold manchildren's storycoffee houseTurkishHojjaYogurtSharingFriendshipHumorNarrative https://avgeeks.videonest.co/videos/398073/laredo-to-panama-the-inter-american-highway-1964 https://img.videonest.org/gamma/398073_thumbnail_resized_v2.webp https://gamma.videonest.org/398073_video_v3.mp4 Laredo to Panama: The Inter American Highway (1964) The film explores the significance of the Inter-American Highway, highlighting its role as a symbol of hope, progress, and connection for Central America. It details the historical journey of the highway from its inception in the 1880s to its completion, emphasizing its impact on commerce, education, and community development. The road facilitates trade, fosters unity among neighboring countries, and improves the quality of life for the local population. The documentary conveys the ongoing dreams of further connectivity and progress, envisioning a future where the road continues to enhance lives and cultures across the Americas. Keywords Inter-American Highway, Central America, progress, commerce, education, community development, trade, unity, historical journey, future dreams Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 1059 LaredoPanamaInter-American HighwayCentral AmericaRoad constructioneconomic developmentinfrastructurecultural exchangetourismtransportationtradeBureau of Public RoadsDepartment of CommercePan-American Highwaytraffic https://avgeeks.videonest.co/videos/398074/democracy-at-work-in-puerto-rico-1942 https://img.videonest.org/gamma/398074_thumbnail_resized_v2.webp https://gamma.videonest.org/398074_video_v3.mp4 Democracy At Work in Puerto Rico (1942) The film "Democracy At Work in Puerto Rico" explores the agricultural and social life of Puerto Rico under American governance. It highlights the island's rich history, economic reliance on sugar cane, and the challenges faced by farmers. The film showcases efforts by the University of Puerto Rico to improve agricultural practices through extension services, promoting better farming techniques, and supporting home industries. It emphasizes the resilience and hard work of the Puerto Rican people as they strive for a better future while maintaining their cultural traditions. Keywords Puerto Rico, agriculture, sugar cane, American governance, University of Puerto Rico, extension services, home industries, resilience, cultural traditions, economic reliance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 1200 Puerto Ricoagricultureagricultural extensionUniversity of Puerto Ricofarmingrural agriculture4H Clubhomemakingrural youthvanilla beansbamboo furniturewinter vegetablesSea Island cottonraising cattlepapaya https://avgeeks.videonest.co/videos/398075/laging-handa-always-prepared-1960 https://img.videonest.org/gamma/398075_thumbnail_resized_v2.webp https://gamma.videonest.org/398075_video_v3.mp4 Laging Handa - Always Prepared (1960) The film documents a visit by journalists to the USS Hancock, an aircraft carrier of the US 7th Fleet, showcasing its defensive capabilities in the Southeast Pacific. The crew provides insights into the carrier's specifications, including its size, speed, and armament. The film highlights the operational procedures of launching and landing aircraft, emphasizing the skill required for pilots and crew to manage these high-speed maneuvers. Keywords USS Hancock, US 7th Fleet, aircraft carrier, Southeast Pacific, military, aviation, journalists, flight operations, defense capabilities Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T00:00:00.000Z yes A/V Geeks 16mm Films no 315 USS HancockUS Navyaircraft carrierSoutheast Pacificmilitaryaviationflight operationsjet planeaerial viewWorld War IImilitary historyvintage footageSangley PointPhilippine https://avgeeks.videonest.co/videos/398076/beyond-the-valley-1959 https://img.videonest.org/gamma/398076_thumbnail_resized_v2.webp https://gamma.videonest.org/398076_video_v3.mp4 Beyond The Valley (1959) The film "Beyond the Valley," produced in 1959, highlights the swift industrial growth and improving living standards in Puerto Rico, attributing these changes to private foreign investment, specific tax exemptions, and government support. It is a production by John Bransby, presented by the Esso Standard Oil Company, and directed by Jack Campbell. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T00:00:00.000Z yes A/V Geeks 16mm Films no 1662 https://avgeeks.videonest.co/videos/398077/and-of-course-you-1968 https://img.videonest.org/gamma/398077_thumbnail_resized_v2.webp https://gamma.videonest.org/398077_video_v3.mp4 And Of Course You (1968) The film "And Of Course You," produced in 1968 by Murakami Wolf Films, Inc., showcases the global benefits derived from innovations of the U.S. space program. Utilizing a combination of motion pictures, still photography, and animation, it highlights advancements in various fields such as food production, education, communications, navigation, meteorology, and resource exploration, all without narration. Directed by Jimmy Murakami and featuring music by Chico Hamilton, the film emphasizes the impact of space-related technologies on everyday life. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-15T00:00:00.000Z yes A/V Geeks 16mm Films no 795 Space ProgramSpace explorationWeather Satellitesatellite technologyAir TravelNatural ResourcesHurricaneAnimationInfrared TechnologyForecastingWeather Warningmoon photographycommunicationEarthexploration https://avgeeks.videonest.co/videos/398078/av-geeks-16mm-lunch-4-15-2025 https://img.videonest.org/gamma/398078_thumbnail_resized_v2.webp https://gamma.videonest.org/398078_video_v3.mp4 AV Geeks 16mm Lunch 4-15-2025 It's film o'clock somewhere… and lunchtime here! #avgeeks #16mmfilms Home Movie Birds We've Got It Discovering Texture It's Your Move, Seargant 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 4281 16mm filmvintage footagebirdsCoca Colatexturepolice traininghome moviesbird feedinglaw enforcementMiami Policeadvertisingeducational marketsales strategypolice officerA/V Geeks https://avgeeks.videonest.co/videos/407452/the-rustlers-1960s https://img.videonest.org/gamma/407452_thumbnail_resized_v2.webp https://gamma.videonest.org/407452_video_v3.mp4 The Rustlers (1960s?) In this comedic cartoon, characters discuss their struggles with rustlers in a valley while humorously navigating their own quirks and personalities. The dialogue reveals their intent to protect their livestock, particularly pigs, from the rustlers, showcasing a mix of humor and tension as they prepare for a confrontation. Keywords comedy, rustlers, livestock, pigs, valley, humor, confrontation, characters Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 390 Los Cuatreroscattle rustlingwestern cartoonanimated filmWesternComedyAnimationCartoonsTom McDonaldCarlos Sandoval https://avgeeks.videonest.co/videos/407453/av-geeks-16mm-lunch-4-16-2025 https://img.videonest.org/gamma/407453_thumbnail_resized_v2.webp https://gamma.videonest.org/407453_video_v3.mp4 AV Geeks 16mm Lunch 4-16-2025 Take a break, watch some reels! #16mmfilms #avgeeks #16mmfilms 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 4301 https://avgeeks.videonest.co/videos/408485/animals-are-different-and-alike-2nd-ed-1990 https://img.videonest.org/gamma/408485_thumbnail_resized_v2.webp https://gamma.videonest.org/408485_video_v3.mp4 Animals Are Different And Alike (2nd Ed, 1990) Presents an interactive game where viewers identify what's wrong with various animal pictures, emphasizing how animals are different and alike. It discusses differences in size, habitat, and dietary needs among animals, explaining concepts like gills in fish, the dietary habits of predators and prey, and the various body coverings of mammals and birds. The film also highlights parental care among different species, contrasting the nurturing of young mammals with the independence of frog tadpoles. Through observation, viewers learn about animal characteristics and behaviors. us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 788 AnimalsAlikeDifferentNatureEducationScienceChildren'sCoronetMTTI FilmRobert WilleyVirginia Kaufman https://avgeeks.videonest.co/videos/408486/among-your-souvenirs-1967 https://img.videonest.org/gamma/408486_thumbnail_resized_v2.webp https://gamma.videonest.org/408486_video_v3.mp4 Among Your Souvenirs (1967) "Among Your Souvenirs" highlights the excitement of collecting souvenirs during foreign travels while cautioning travelers about the hidden risks of pests and diseases that may accompany these items. The film emphasizes the importance of being aware of agricultural quarantine regulations, as certain souvenirs like plants, fruits, and meats can harbor harmful pests. It showcases the role of agricultural inspectors in safeguarding the nation's food supply and provides tips for travelers to ensure their souvenirs are safe and compliant with import regulations. Keywords souvenirs, travel, pests, quarantine, agriculture, inspection, regulations, safety, customs Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 808 foreign traveltravelerairportairplaneshipsouvenirsMediterraneanvoyageMediterranean fruit flypest controlpublic health https://avgeeks.videonest.co/videos/408487/the-box-1970 https://img.videonest.org/gamma/408487_thumbnail_resized_v2.webp https://gamma.videonest.org/408487_video_v3.mp4 The Box (1970) The Box (1970) is a non-narrative, observational film that follows the journey of a single package through the intricate workings of the U.S. Postal Service. Without dialogue or narration, the film captures the mechanical rhythms, logistical choreography, and human touches involved in sorting, transporting, and delivering mail. From post office conveyor belts and mail trucks to neighborhood delivery, the box’s path reveals the behind-the-scenes effort that brings a simple parcel to a household doorstep. The film’s minimalistic style emphasizes motion, process, and infrastructure, offering a quiet tribute to an everyday yet complex system. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 324 United States Post Officemail sortingmailing packageconveyor beltspostal workerspostal servicemail deliveryUSPSdocumentary filmhistory documentaryAmerican historylogisticspackage handlingmail processingUnited States https://avgeeks.videonest.co/videos/408488/marriage-1971 https://img.videonest.org/gamma/408488_thumbnail_resized_v2.webp https://gamma.videonest.org/408488_video_v3.mp4 Marriage (1971) The film depicts a couple, Sandy and her husband, navigating the challenges of early married life, including financial struggles, parental influence, and the shift in their social lives post-wedding. They discuss their dreams and frustrations, revealing the tension between personal desires and familial expectations. The dialogue captures the realities of marriage, including the need for compromise and the impact of external pressures on their relationship. Keywords marriage, couple, financial struggles, parental influence, social life, early married life, compromise, relationship dynamics 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 677 weddingmarriagebudgetingfinancial constraintsfinancial planningcouplewedding planningmarriage advicerelationshipsnew outfitbudget weddingaffordable weddingcheap weddingwedding tipsfinancial tips https://avgeeks.videonest.co/videos/408489/lost-puppy-1969 https://img.videonest.org/gamma/408489_thumbnail_resized_v2.webp https://gamma.videonest.org/408489_video_v3.mp4 Lost Puppy (1969) Lost Puppy (1969), produced by Churchill Films, is a gentle morality tale that explores themes of responsibility, rules, and the reasons behind them. In the story, a young girl named Lauren searches for her missing puppy, a journey that becomes a vehicle for learning about the consequences of ignoring rules and the value of caring for others. With a tone and structure similar to The Bike, the film blends realism with emotional depth, making it a relatable and meaningful experience for young viewers. Through Lauren’s actions and reflections, Lost Puppy encourages thoughtful conversations about growing up, making choices, and understanding why rules matter. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 901 Lost PuppyChurchill FilmShort FilmFamilyChildrenMichael MooreCaleb DeschanelGeorge McQuilkin https://avgeeks.videonest.co/videos/408490/marriage-what-kind-for-you-1967 https://img.videonest.org/gamma/408490_thumbnail_resized_v2.webp https://gamma.videonest.org/408490_video_v3.mp4 Marriage: What Kind For You? (1967) Features Gordon Jump! The film explores the anxieties and realities of marriage through a conversation between a couple, who reflect on the challenges and disappointments they see in other marriages around them. As they prepare for a New Year's Eve party, they discuss their fears of divorce, the loss of excitement in their relationship, and the need to appreciate and understand each other. The narrative highlights the importance of communication, compromise, and the shared journey of marriage, emphasizing that while challenges exist, the rewards of a committed relationship can be significant. Keywords marriage, divorce, relationships, New Year's Eve, communication, compromise, couples, expectations, challenges, appreciation LIMITED DISTRIBUTION. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 1454 https://avgeeks.videonest.co/videos/408491/meat-cookery-1981 https://img.videonest.org/gamma/408491_thumbnail_resized_v2.webp https://gamma.videonest.org/408491_video_v3.mp4 Meat Cookery (1981) The film discusses the history and techniques of meat cookery, emphasizing the importance of cooking methods and meat quality for achieving tenderness and flavor. It explains the differences between dry and moist heat cooking, detailing various techniques such as roasting, broiling, pan frying, and braising. The film also covers the significance of using a meat thermometer, the role of marinating and tenderizing, and the process of making gravies and sauces from cooking liquids. Overall, it highlights that while cooking meat has evolved, the fundamental principles remain valuable for delicious results. Keywords meat cookery, cooking techniques, tenderness, dry heat, moist heat, roasting, broiling, pan frying, tenderizing, gravies, sauces, meat thermometer Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 1087 Rib RoastMeat CookeryDry Heat CookingMoist Heat CookingMeat ThermometerCooking TechniquesRoast BeefBeef RecipesCooking MethodsFood RecipeCulinary SkillsRecipeGourmet CookingPerfect RoastDelicious Food https://avgeeks.videonest.co/videos/408492/six-who-fled-1972 https://img.videonest.org/gamma/408492_thumbnail_resized_v2.webp https://gamma.videonest.org/408492_video_v3.mp4 Six Who Fled (1972) The film, directed by Tibor Hirsch, portrays the experiences of six refugees who escaped from Communist bloc countries, representing the broader plight of nearly thirty million individuals who have fled communism since 1945. Produced in 1972, it serves as a poignant exploration of the challenges faced by these refugees. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 885 Berlin WallEast GermanywildlifeanimalsdeerbirdsgoatszooHistory of East GermanyGerman WildlifeEast German Animals https://avgeeks.videonest.co/videos/408493/a-lesson-from-the-hoja-1950s https://img.videonest.org/gamma/408493_thumbnail_resized_v2.webp https://gamma.videonest.org/408493_video_v3.mp4 A Lesson from the Hoja (1950s) Marionettes! The film features a conversation in a coffee house where patrons discuss the teachings of Nasr-ed-din Hoja. It highlights the folly of radical ideas that lack long-term experience, illustrated through a story where three boys, overconfident in their knowledge, fail to describe an elephant based on limited experience. The moral emphasizes that true wisdom comes from experience and encourages skepticism towards new radical ideas without thorough understanding. Keywords Nasreddin Hocha, wisdom, experience, radical ideas, coffee house, story, moral lesson, overconfidence, elephant, villagers Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-17T00:00:00.000Z yes A/V Geeks 16mm Films no 636 Nasr-ed-din Hojapuppet showanimatedfolktalescoffee houseideal statefree enterprisepolitical partiesclassic literaturecomedysatire https://avgeeks.videonest.co/videos/408494/atomic-tests-in-nevada-the-story-of-aecs-continental-proving-ground-1955 https://img.videonest.org/gamma/408494_thumbnail_resized_v2.webp https://gamma.videonest.org/408494_video_v3.mp4 Atomic Tests in Nevada: The Story of AEC's Continental Proving Ground (1955) The film discusses the routine occurrence of atomic tests at the Nevada Test Site, viewed from the perspective of residents in St. George, Utah. It explains the necessity of these tests for national defense and the safety measures taken to protect the public from radiation exposure. The narrative covers the operational aspects of the tests, including the scientific and military personnel involved, the technology used, and the monitoring systems in place to ensure public safety. The film emphasizes the importance of these tests in maintaining the United States' atomic capabilities and concludes with a reassurance about the minimal risk posed to nearby communities. Keywords atomic tests, Nevada Test Site, St. George, national defense, public safety, radiation exposure, military, scientific research, monitoring systems, Cold War Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 1480 https://avgeeks.videonest.co/videos/408495/happy-marriage-maligayang-pagsasama-1966 https://img.videonest.org/gamma/408495_thumbnail_resized_v2.webp https://gamma.videonest.org/408495_video_v3.mp4 Happy Marriage (Maligayang Pagsasama) - 1966 The film highlights the collaboration between the Philippine government and its citizens to improve daily life through civic action and the U.S. Food for Peace program. It showcases various community projects, such as infrastructure improvements, irrigation systems, and educational facilities, all driven by local leadership and collective effort. The initiative emphasizes self-help and community pride, leading to enhanced living conditions and sustainable development in numerous barangays. Keywords Philippines, civic action, Food for Peace, community projects, self-help, infrastructure, local leadership, sustainable development Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-16T00:00:00.000Z yes A/V Geeks 16mm Films no 618 PhilippinesLand ReformCivic ActionCommunity DevelopmentZamboanga Air BaseSpiegel FarmsFood for PeaceDocumentaryHistorySocial IssuesInternational Relations https://avgeeks.videonest.co/videos/408496/av-geeks-16mm-lunch-4-17-2025 https://img.videonest.org/gamma/408496_thumbnail_resized_v2.webp https://gamma.videonest.org/408496_video_v3.mp4 AV Geeks 16mm Lunch 4-17-2025 Bringing classroom nostalgia to your lunch hour! #avgeeks #16mmfilms General Pershing and Party Go to France, June 1917 (111-h-1320a) Building An Outline 1939 Newsreels - pre-WWI history Unto Thyself Be True 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 4437 https://avgeeks.videonest.co/videos/412671/biomes-temperate-deciduous-forest-1989 https://img.videonest.org/gamma/412671_thumbnail_resized_v2.webp https://gamma.videonest.org/412671_video_v3.mp4 Biomes: Temperate Deciduous Forest (1989) Discusses the temperate deciduous forest biome, highlighting its seasonal changes and the interdependence of plant and animal life. It explains the characteristics of the forest, including its layers of vegetation and the life cycles of various species. The video details how trees, particularly deciduous ones, influence the ecosystem, how animals adapt to seasonal changes, and the cyclical nature of life in this biome, from spring growth to winter dormancy. Keywords temperate deciduous forest, biome, ecosystem, seasonal changes, plant life, animal life, interdependence, life cycles, vegetation layers, biodiversity Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-20T00:00:00.000Z yes A/V Geeks 16mm Films no 789 Temperate ForestForest BiomeDeciduous Forestplant lifeanimal lifegrowing seasonbiomeecologybiologynature documentarywildlifeecosystemtemperate biomeplantsanimals https://avgeeks.videonest.co/videos/412672/why-not-try-1972 https://img.videonest.org/gamma/412672_thumbnail_resized_v2.webp https://gamma.videonest.org/412672_video_v3.mp4 Why Not Try? (1972) The film emphasizes the importance of trying new experiences, whether it's tasting unfamiliar foods or meeting new people. It encourages viewers to overcome their fears and embrace the unknown, highlighting that trying something new can lead to delightful discoveries and friendships. Keywords trying new things, overcoming fear, food, friendship, exploration, personal growth LIMITED DISTRIBUTION. 2025-04-20T00:00:00.000Z yes A/V Geeks 16mm Films no 211 diverse childrenPlaytimeFood explorationChildhood experiencesTrying new things https://avgeeks.videonest.co/videos/412673/just-joking-1973 https://img.videonest.org/gamma/412673_thumbnail_resized_v2.webp https://gamma.videonest.org/412673_video_v3.mp4 Just Joking (1973) The film features a playful exchange among children discussing their hobby projects for school. They share their creations, but the conversation takes a turn when jokes lead to misunderstandings and mild chaos, particularly when one child plays a prank that ruins another's breakfast. The narrative emphasizes the fun of joking while also highlighting the potential consequences of humor when it goes too far. It concludes with a reflection on how jokes can be perceived differently depending on the context and the feelings of those involved. Keywords children, jokes, pranks, hobby day, misunderstandings, humor, consequences, playful exchange, school projects 2025-04-20T00:00:00.000Z yes A/V Geeks 16mm Films no 841 sibling interactionbrothersistermodel airplanehobby dayfamily videokids activitiesoutdoor funtoysplaytime https://avgeeks.videonest.co/videos/412674/why-55-1979 https://img.videonest.org/gamma/412674_thumbnail_resized_v2.webp https://gamma.videonest.org/412674_video_v3.mp4 Why 55? (1979) The film "Why 55?" discusses the importance of the 55 mph speed limit established by the National Speed Limit Act of 1974, which has reportedly saved over 45,000 lives and conserved billions of gallons of gasoline. The film presents various perspectives on the speed limit, highlighting its benefits in reducing accidents and fuel consumption, while also addressing the controversy surrounding its enforcement. It emphasizes that driving at 55 mph increases reaction time and decreases stopping distance, ultimately making roads safer. The film concludes by urging viewers to adhere to the speed limit to save lives and energy. Keywords 55 mph, speed limit, National Speed Limit Act, safety, fuel conservation, accidents, driving behavior, enforcement, energy crisis, public health 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 934 National Speed Limit Actspeed limit55 mphenergy conservationtraffic safetygasolineCongresstransportation policyfuel efficiencyroad safetylegislationhistorypoliticsenergy crisisautomotive https://avgeeks.videonest.co/videos/412675/the-mailman-1964 https://img.videonest.org/gamma/412675_thumbnail_resized_v2.webp https://gamma.videonest.org/412675_video_v3.mp4 The Mailman (1964) Showcases the daily operations of the United States Postal Service, highlighting the journey of letters and parcels as they are sorted, routed, and delivered by dedicated mailmen. It follows mailman Fred Nelson as he prepares and delivers mail, demonstrating how postal workers ensure that correspondence reaches its destination efficiently. The narrative emphasizes the importance of communication between friends and family, illustrated through letters exchanged between two girls, Anne and Linda, who live far apart. The film also touches on the various types of mail, including registered letters and air mail, and the role of rural mailmen in serving isolated communities. Keywords United States Postal Service, mailman, letters, parcels, delivery, communication, sorting, rural mail, registered mail, air mail, friendship LIMITED DISTRIBUTION. 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 645 US MailPost OfficeMail DeliverySorting MailLetterPennsylvaniaLos AngelesMailmanAmerican Postal ServiceHistoryDocumentaryFred Nelson https://avgeeks.videonest.co/videos/412676/when-your-parent-drinks-too-much-1987 https://img.videonest.org/gamma/412676_thumbnail_resized_v2.webp https://gamma.videonest.org/412676_video_v3.mp4 When Your Parent Drinks Too Much (1987) Features Alan Thicke. The film explores the struggles faced by children of alcoholic parents, highlighting the emotional turmoil and chaos within seemingly normal families. It emphasizes the importance of recognizing alcoholism as a disease and the impact it has on family dynamics. The narrative provides insights into the feelings of loneliness, shame, and frustration experienced by children, while also offering coping strategies such as the "three C's": you didn't cause it, you can't control it, and you can't cure it. The film encourages open communication and seeking support from others, like counselors or peer groups, to navigate the challenges of living with an alcoholic parent. Keywords alcoholism, children, family dynamics, emotional turmoil, coping strategies, three C's, communication, support groups Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 1629 https://avgeeks.videonest.co/videos/412677/puppets-dream-1967 https://img.videonest.org/gamma/412677_thumbnail_resized_v2.webp https://gamma.videonest.org/412677_video_v3.mp4 Puppet's Dream (1967) An abstract, experimental short that enters the surreal dream world of a puppet. Through a striking visual palette of color, form, texture, pattern, and line, the film explores imaginative inner landscapes without conventional narrative structure. Likely intended as a sensory or conceptual art experience, the film aligns with the 1960s educational and experimental film movement. The aesthetic is described as “reddish,” suggesting a bold, warm visual tone. Keywords: puppets, dreams, abstraction, visual design, 1960s educational film, non-narrative, Sigma Educational Films 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 523 animated filmabstract artsurreal imagerypuppet dreamshifting shapesexperimental animationsurreal animationabstract animationdreamlike animationexperimental filmabstract art filmpuppetryanimation filmsurreal artabstract https://avgeeks.videonest.co/videos/412678/man-with-a-stick-1954 https://img.videonest.org/gamma/412678_thumbnail_resized_v2.webp https://gamma.videonest.org/412678_video_v3.mp4 Man with a Stick (1954) The film follows Joe, a young blind man who learns to navigate the world independently with the help of Keen, a guide. Initially frustrated and reliant on his chair, Joe gradually gains confidence as he learns to use a cane and understand his surroundings through sound, smell, and touch. He faces challenges like crossing streets and riding public transport but ultimately embraces his journey towards independence, discovering that life still holds familiar experiences despite his blindness. Keywords blindness, independence, navigation, cane, public transport, confidence, learning, self-discovery, mentorship Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 820 blindnessdisabilityNew York CityBrooklynwhite canenavigatingindependent livingsocial supportvisual impairmentaccessibilityDocumentarySocial IssuesMax ArmanJohn DalyDr. Gregor Ziemer https://avgeeks.videonest.co/videos/412679/sanitation-why-all-the-fuss-1969 https://img.videonest.org/gamma/412679_thumbnail_resized_v2.webp https://gamma.videonest.org/412679_video_v3.mp4 Sanitation: Why All The Fuss? (1969) The film "Sanitation: Why All The Fuss?" emphasizes the critical importance of sanitation in food handling for public health. It explains how bacteria, which can multiply rapidly and cause illness, are often transferred by people, pests, and contaminated tools. To prevent foodborne illnesses, food handlers must adhere to strict hygiene practices, including frequent handwashing, maintaining proper food temperatures, and ensuring cleanliness in food preparation areas. The film highlights that while heating food kills bacteria, it does not eliminate toxins that may have already formed, making prompt refrigeration essential. Keywords sanitation, public health, bacteria, food safety, hygiene, food handling, contamination, refrigeration, illness prevention, food temperature 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 439 food safetysanitationfood handlingfood servicebacteriagermspublic healthhygienefoodborne illnessprevention https://avgeeks.videonest.co/videos/412680/biomes-tropical-rainforest-1989 https://img.videonest.org/gamma/412680_thumbnail_resized_v2.webp https://gamma.videonest.org/412680_video_v3.mp4 Biomes: Tropical Rainforest (1989) The tropical rainforest is the most biodiverse biome on Earth, housing an astonishing variety of species due to its unique climate, characterized by abundant rainfall and sunlight. Despite its reduction to equatorial regions, rainforests still offer a rich ecosystem with four distinct layers: the emergent layer, the canopy, the understory, and the forest floor. Each layer supports various habitats and life forms, from birds and mammals to insects and decomposers. The rainforest's intricate ecological relationships, such as those between ants and fungi, highlight its role in nutrient recycling. However, deforestation threatens this vital biome, which serves as an irreplaceable genetic reservoir. Keywords tropical rainforest, biodiversity, climate, ecosystems, emergent layer, canopy, understory, forest floor, nutrient recycling, deforestation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 819 tropical rainforestbiomerainforest plantsspeciesclimate regionwater repellentsolar energyecologybiologyecosystemplant lifewildlifeenvironmental sciencenature documentaryconservation https://avgeeks.videonest.co/videos/412681/community-helpers-postal-workers-1980 https://img.videonest.org/gamma/412681_thumbnail_resized_v2.webp https://gamma.videonest.org/412681_video_v3.mp4 Community Helpers: Postal Workers (1980) The film explores the community role of postal workers, detailing the journey of a letter from mailing to delivery. It highlights various jobs within the postal service, including city carriers, window clerks, postal clerks, distribution clerks, supervisors, maintenance technicians, and mail carriers. Each worker plays a crucial role in ensuring that mail is sorted, stamped, and delivered efficiently, illustrating the teamwork required in the postal system. Keywords postal workers, community, mail delivery, letter sorting, distribution clerks, teamwork, postal service, jobs Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 650 postal workersmail deliverypost officemail sortingcity carrierswindow clerk https://avgeeks.videonest.co/videos/412682/whyd-the-beetle-cross-the-road-1984 https://img.videonest.org/gamma/412682_thumbnail_resized_v2.webp https://gamma.videonest.org/412682_video_v3.mp4 Why'd The Beetle Cross The Road? (1984) The film features a whimsical classroom discussion centered around the classic question, "Why did the beetle cross the road?" A student named Dolores suggests it was to be with his girlfriend, prompting a lighthearted conversation filled with music and playful banter. The setting is informal, emphasizing the joy of learning and sharing ideas. Keywords beetle, cross the road, classroom, discussion, Dolores, girlfriend, music, playful, learning 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 429 beachoceanbicycleroller skatingsandbeetlenatureoutdoor activitiescoastalsummersportsinsectsanimalswildliferecreation https://avgeeks.videonest.co/videos/412683/dead-serious-1987 https://img.videonest.org/gamma/412683_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/412683/dead-serious-1987 Dead Serious (1987) Explores the struggles of teenagers dealing with depression, rejection, and the pressures of adolescence. It highlights the alarming rates of suicide among youth, emphasizing the importance of communication and support among friends. The narrative reveals personal stories of young individuals grappling with feelings of loneliness, family issues, and societal expectations. It stresses that many who contemplate suicide do so as a cry for help and that friends can play a crucial role in providing support and understanding. The film encourages viewers to take mental health seriously and to recognize warning signs in themselves and others. Keywords teenage depression, suicide, mental health, friendship, support, rejection, family issues, communication, warning signs, adolescence Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1481 https://avgeeks.videonest.co/videos/412684/hoppy-the-bunny https://img.videonest.org/gamma/412684_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/412684/hoppy-the-bunny Hoppy the Bunny Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-18T00:00:00.000Z yes A/V Geeks 16mm Films no 618 Hoppy Bunnychildren's storystorytellingraccoonowlwoodskidsanimalseducationkids showbunnyforestadventureshort filmanimated https://avgeeks.videonest.co/videos/412685/av-geeks-16mm-lunch-4-18-2025 https://img.videonest.org/gamma/412685_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/412685/av-geeks-16mm-lunch-4-18-2025 AV Geeks 16mm Lunch 4-18-2025 Actually it's a Great Friday.. to watch old 16mm films. #avgeeks #16mmfilms Oof.. this show was a mess due to a delivery that happened right at the beginning of the show.. Easter Season Can 2 (silent) First Easter Bunny a gap as Skip races home... Easter Parade Hats Newsreel segment 1981 Easter Egg Roll at the White House (silent) Hoppy the Bunny (corrupted file!) Tom Jones for Easter Seals. 2025-04-19T00:00:00.000Z yes A/V Geeks 16mm Films no 3611 https://avgeeks.videonest.co/videos/414065/my-mother-is-the-most-beautiful-woman-in-the-world-1968 https://img.videonest.org/gamma/414065_thumbnail_resized_v2.webp https://gamma.videonest.org/414065_video_v3_360.mp4 My Mother Is The Most Beautiful Woman In The World (1968) The story follows a young girl named Varya, who is excited about a village feast but becomes lost while playing in the fields. As she searches for her mother, she encounters strangers who try to help her. Varya describes her mother as "the most beautiful woman in the world," which leads the villagers to search for her. After a long and anxious wait, Varya is joyfully reunited with her mother, proving that love makes a person beautiful in the eyes of those who care for them. Keywords Varya, lost girl, village feast, mother, beauty, love, reunion, childhood, community LIMITED DISTRIBUTION. 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 504 Animated FilmFolk TaleHarvesting WheatVillage FeastAnimationChildren'sFolkloreShort FilmsStephen Bosustow https://avgeeks.videonest.co/videos/414066/mucho-macho-1962 https://img.videonest.org/gamma/414066_thumbnail_resized_v2.webp https://gamma.videonest.org/414066_video_v3.mp4 Mucho Macho (1962) The film depicts a tense train journey where passengers are warned about potential attacks from the notorious Red Mask gang. As they prepare for the journey, characters express their reluctance to get involved in any conflict, emphasizing their neutral stance. However, chaos ensues when bandits attempt to rob the train, leading to a confrontation that tests the passengers' resolve and their claims of neutrality. Keywords train, bandits, Red Mask gang, payroll, conflict, neutral, passengers, robbery, confrontation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 417 cartoonanimationwesterntrain robberybanditspassengersMexicoactionadventurewild west https://avgeeks.videonest.co/videos/414067/av-geeks-16mm-lunch-4-21-2025 https://img.videonest.org/gamma/414067_thumbnail_resized_v2.webp https://gamma.videonest.org/414067_video_v3.mp4 AV Geeks 16mm Lunch 4-21-2025 Is it just like every other Monday? Not when there's 16mm films involved? #avgeeks #16mmfilms "Beginning Responsibility: Learning To Follow Instructions (2nd Ed) " Reading Self-Improvement: Interpreting What You Read Field Burnout Tests in Apartment Units 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 3165 https://avgeeks.videonest.co/videos/414068/who-shall-feed-the-donkey-1950s https://img.videonest.org/gamma/414068_thumbnail_resized_v2.webp https://gamma.videonest.org/414068_video_v3.mp4 Who Shall Feed The Donkey? (1950s) The film presents a story about Nasr-ed-din Hoja and his stubbornness, illustrating the dangers of ignoring clear threats. As he and his wife argue about feeding their donkey, a burglar takes advantage of their distraction and robs their home. Through this tale, the film conveys the importance of being vigilant and responsive to dangers in life, rather than remaining obstinate and passive. Keywords Nasr-ed-din Hoja, stubbornness, danger, vigilance, donkey, burglar, lesson, life, caution 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 642 Nasreddin Hojapuppet showTurkish folktalesstorytellingcomedyTurkeyHamidpolicetraditional storiespuppetrycoffee houseanimationhumorculture https://avgeeks.videonest.co/videos/414069/why-we-use-money-1970 https://img.videonest.org/gamma/414069_thumbnail_resized_v2.webp https://gamma.videonest.org/414069_video_v3.mp4 Why We Use Money (1970) The film tells the story of a fisherman who, in a time before money existed, attempts to trade his catch for various items he needs, such as a knife and a hat. He faces challenges as each tradesman he encounters requires different goods in exchange. Eventually, they come up with the idea of using precious metals as a common medium of exchange, leading to the creation of coins. This new system simplifies trading, allowing the fisherman to sell his fish for money and easily purchase what he needs. Keywords fisherman, trade, barter, knife maker, hat maker, baker, potter, precious metals, coins, money LIMITED DISTRIBUTION. 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 461 barteringtradefishermananimationshort filmchildren'seducationalknifehatbread https://avgeeks.videonest.co/videos/414070/space-science-an-introduction-1964 https://img.videonest.org/gamma/414070_thumbnail_resized_v2.webp https://gamma.videonest.org/414070_video_v3.mp4 Space Science: An Introduction (1964) This film introduces viewers to the fundamentals of space science, exploring how humans have long pondered the effects of the Sun on Earth's atmosphere and the formation of planets. It explains different regions of space, such as cislunar, interplanetary, interstellar, and intergalactic spaces. The film details how rockets overcome Earth's gravity through thrust, the concept of orbital and escape velocities, and the mechanics of satellites in orbit. It also illustrates the forces acting on objects in motion, including G-forces experienced during rocket launches and the condition of weightlessness in orbit. Keywords space science, gravity, rockets, thrust, orbital velocity, escape velocity, satellites, weightlessness, interplanetary, interstellar Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 814 NASASpace ExplorationCislunar SpaceInterplanetary SpaceInterstellar SpaceLunar SpaceSpace ScienceGoddard InstituteCoronet FilmsRobert JastrowEducational FilmDocumentaryPhysicsScienceAstronomy https://avgeeks.videonest.co/videos/414071/the-american-short-story-1977 https://img.videonest.org/gamma/414071_thumbnail_resized_v2.webp https://gamma.videonest.org/414071_video_v3.mp4 The American Short Story (1977) The film discusses the significance of the American short story as a unique literary form that captures the essence of human experience in a compressed format. It emphasizes the relatable nature of short story protagonists, who reflect the struggles of everyday life. The adaptation of these stories into film aims to make classic literature accessible to modern audiences, encouraging them to engage with the emotional depth of characters and themes. The film series seeks to rekindle interest in short stories, bridging the gap between literature and film while fostering a communal experience of shared feelings and reflections. Keywords American short story, film adaptation, literature, human experience, relatable characters, emotional depth, accessibility, modern audiences, communal experience 2025-04-21T00:00:00.000Z yes A/V Geeks 16mm Films no 1436 https://avgeeks.videonest.co/videos/414072/tomorrow-may-be-judgment-day-1950s https://img.videonest.org/gamma/414072_thumbnail_resized_v2.webp https://gamma.videonest.org/414072_video_v3.mp4 Tomorrow May Be Judgment Day (1950s) In a quiet twilight hour, Aendi Hamid uses dark humor to illustrate the fate of officials who opposed foreign control, showing a stark contrast in perceptions of justice. He recounts a story about Nasr-ed-din Hoja, who is tricked into believing the world is ending, leading to the loss of his beloved pet lamb. The tale highlights the folly of double standards in justice and the importance of peaceful coexistence despite differing beliefs. Keywords Aendi Hamid, justice, foreign control, Nasr-ed-din Hoja, double standards, peace, humor, rebellion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-20T00:00:00.000Z yes A/V Geeks 16mm Films no 602 puppet animationshort filmpolitical satirerebellionjusticefreedomjudgmentpoliticalanimationsatirecommentaryshortfilmpuppetartistic https://avgeeks.videonest.co/videos/414073/just-one-place-1973 https://img.videonest.org/gamma/414073_thumbnail_resized_v2.webp https://gamma.videonest.org/414073_video_v3.mp4 Just One Place (1973) "Just One Place" is an educational film that follows a group of children, particularly Kevin, as they reflect on their experiences in a community garden. The film highlights the contrast between the beauty of nature and the neglect seen in urban areas. Kevin, inspired by his friends, decides to take on the challenge of improving a neglected space. Despite their efforts to create a vibrant garden, they face setbacks when their work is destroyed by vandalism. Ultimately, the film emphasizes the importance of community involvement and caring for one's environment. Keywords community garden, environmental care, urban neglect, teamwork, vandalism, youth empowerment, nature, educational film 2025-04-20T00:00:00.000Z yes A/V Geeks 16mm Films no 874 Kingman Boys ClubWashington DCboys tripfishingCoca-ColaDocumentaryTravelKidsFamilyAdventureTripBoysClubDC https://avgeeks.videonest.co/videos/415396/the-hoja-takes-a-wife-1954 https://img.videonest.org/gamma/415396_thumbnail_resized_v2.webp https://gamma.videonest.org/415396_video_v3.mp4 The Hoja Takes A Wife (1954) The film features a conversation between two characters, Hamid and Bhan, as they ride a gentle donkey named Slowfoot. They discuss the nature of work and freedom in different countries, leading to a storytelling session about Nasr-ed-din Hoja. The tale reveals how Hocha was tricked into marrying an unattractive woman, yet he cleverly turns the situation around by pretending to be grateful, leading others to believe she is beautiful. The story highlights the themes of perception, deception, and the importance of questioning narratives. Keywords Nasr-ed-din Hoja, donkey, storytelling, deception, perception, friendship, work, freedom, humor, wisdom Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 601 Nasr-ed-din Hojapuppet showpuppettalesanimationfolklorecomedycoffeeworkersjugspolitical commentarytraditional storiesshort filmhumor https://avgeeks.videonest.co/videos/415397/pennsylvania-dutch-friends-1970 https://img.videonest.org/gamma/415397_thumbnail_resized_v2.webp https://gamma.videonest.org/415397_video_v3.mp4 Pennsylvania Dutch Friends (1970) The film features Leanne Mock, who introduces viewers to Pennsylvania Dutch country, highlighting its historical significance and cultural heritage. Set in a historic village, she describes the lifestyle of the Pennsylvania Deutsch, descendants of German settlers who sought religious freedom in the 18th century. The film contrasts the traditional lives of the "plain people," who avoid modern technology, with those who adopt contemporary lifestyles. It also showcases local traditions, such as plowing contests and the use of horses for transportation. Keywords Pennsylvania Dutch, Leanne Mock, cultural heritage, German settlers, religious freedom, plain people, traditional lifestyle, historic village, plowing contest 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 209 Pennsylvania DutchSchafferstownIndian KellerPennsylvaniaHistoryCultureGerman1763Fountain ParkRyan MarkDocumentaryTravelUnited Statesheritagefolklore https://avgeeks.videonest.co/videos/415398/pravda-prado-kindergarten-1954 https://img.videonest.org/gamma/415398_thumbnail_resized_v2.webp https://gamma.videonest.org/415398_video_v3.mp4 Pravda Prado: Kindergarten (1954) Depicts a satirical view of a school environment where indoctrination replaces education. The teacher emphasizes obedience and conformity, discouraging critical thinking and questioning. Students are taught to regurgitate party-approved information without understanding, illustrating the dangers of authoritarianism in education. Keywords indoctrination, education, satire, authoritarianism, conformity, critical thinking, obedience Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 395 first dayschoolChildren'sAnimationCartoonsEducationalPravda PradoJardín de Niños https://avgeeks.videonest.co/videos/415399/friends-in-st-louis-mo-1970 https://img.videonest.org/gamma/415399_thumbnail_resized_v2.webp https://gamma.videonest.org/415399_video_v3.mp4 Friends in St Louis MO (1970) The film features Rovin Hill, who introduces viewers to St. Louis, Missouri, highlighting its significant location where the Mississippi and Missouri rivers converge. It discusses river transportation, particularly the construction and use of steel barges for transporting goods like sand, cement, chemicals, and coal. The film also showcases Forest Park and includes a segment on boxing training, emphasizing sportsmanship and technique. Keywords St. Louis, Missouri, river transportation, steel barges, Forest Park, boxing, sportsmanship 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 208 St. LouisMississippi RiverMissouriRiver TransportationSteel IndustryForest ParkRobin HillCity LifeDocumentaryTravelGeographyIndustrial HistoryUrban ExplorationRiverfrontMissouri History https://avgeeks.videonest.co/videos/415400/av-geeks-16mm-lunch-4-22-2025 https://img.videonest.org/gamma/415400_thumbnail_resized_v2.webp https://gamma.videonest.org/415400_video_v3.mp4 AV Geeks 16mm Lunch 4-22-2025 Forget the news – watch some 16mm with us! #avgeeks 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 4755 https://avgeeks.videonest.co/videos/417351/beginning-responsibility-rules-are-for-gorillas-too-2nd-ed-1983 https://img.videonest.org/gamma/417351_thumbnail_resized_v2.webp https://gamma.videonest.org/417351_video_v3.mp4 Beginning Responsibility: Rules Are For Gorillas Too (2nd Ed, 1983) The film explores the concept of rules through the perspective of a gorilla who escapes from a zoo and tries to navigate human society. It highlights the importance of rules for safety, fairness, and organization in various settings, such as schools and games. The gorilla learns that rules help people interact positively, ensure safety, and maintain order, while also noting that different places may have different rules. Ultimately, it emphasizes that rules are created by people and are essential for a harmonious society. Keywords gorilla, rules, safety, fairness, games, society, organization, education, interaction Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-23T00:00:00.000Z yes A/V Geeks 16mm Films no 705 gorillazoo escapesafety rulesCoronet Filmschildren's cartoonkids cartoonsafety tipsanimal escapeeducational cartoonchildren's safetycartoon for kidskids educationcoronet films cartoonescapedisguise https://avgeeks.videonest.co/videos/417352/the-secrets-to-making-good-grades-1983 https://img.videonest.org/gamma/417352_thumbnail_resized_v2.webp https://gamma.videonest.org/417352_video_v3.mp4 The Secrets To Making Good Grades (1983) This film provides insights and strategies for students to excel in their academic pursuits, emphasizing the importance of understanding the learning process as a game. It shares tips from successful students on effective note-taking, active participation in class, and efficient reading techniques. The film encourages students to engage with their teachers, review notes regularly, and adopt a structured study approach to prepare for exams confidently. Ultimately, it highlights that a proactive attitude and the right strategies can lead to academic success. Keywords academic success, study strategies, note-taking, class participation, reading techniques, exam preparation, learning game, student tips 2025-04-23T00:00:00.000Z yes A/V Geeks 16mm Films no 934 LearningSchoolLectureClassroomStudentsGood GradesEducationStudy SkillsAcademic SuccessExam PreparationStudy StrategiesLearning TechniquesEffective StudyingSchool SuccessClassroom Learning https://avgeeks.videonest.co/videos/417353/footage-of-gemini-v-arriving-at-hazuke-fukuoka-march-18-1966-silent https://img.videonest.org/gamma/417353_thumbnail_resized_v2.webp https://gamma.videonest.org/417353_video_v3.mp4 Footage of Gemini V Arriving at Hazuke, Fukuoka - March 18, 1966 (silent) Gemini V, launched on August 21, 1965, was a crucial mission in NASA's Gemini program, focusing on long-duration spaceflight and its effects on astronauts, as it lasted eight days. The mission also highlighted international collaboration, particularly between the United States and Japan, during the Cold War, fostering goodwill through space exploration. The public's fascination with space travel in the 1960s is reflected in the excitement surrounding the mission, which has significant documentary value for historians and educators. Ultimately, Gemini V contributed to the legacy of the Gemini program, laying the groundwork for the Apollo missions, including the landmark Apollo 11 moon landing in 1969, and bolstering confidence in NASA's capabilities. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-23T00:00:00.000Z yes A/V Geeks 16mm Films no 157 Gemini 4NASAspacecrafttransportingmissionM-70full scaleUS Air Forcecargodelivery https://avgeeks.videonest.co/videos/417354/puerto-rican-american-friends-1970 https://img.videonest.org/gamma/417354_thumbnail_resized_v2.webp https://gamma.videonest.org/417354_video_v3.mp4 Puerto Rican-American Friends (1970) The film features a Puerto Rican-American sharing insights about their life in New York City, particularly in the Bronx. It highlights the history of Puerto Rican migration to the city since the U.S. annexation of Puerto Rico in 1898, the cultural significance of the Bronx, and local markets established by Mayor LaGuardia. The narrator also mentions the ease of travel between Puerto Rico and New York City today. Keywords Puerto Rican American, New York City, Bronx, migration, culture, LaGuardia, markets, travel 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 209 Puerto RicanNew York CityYankee StadiumLa Marqueta1975Educational FilmNew YorkHistoryCultureDocumentary FilmCommunityLife in NYC https://avgeeks.videonest.co/videos/417355/sally-at-13-1978 https://img.videonest.org/gamma/417355_thumbnail_resized_v2.webp https://gamma.videonest.org/417355_video_v3.mp4 Sally At 13 (1978) "Sally At 13" is a coming-of-age film that captures the experiences of a teenage girl navigating the complexities of adolescence, including crushes, body image, and peer relationships. The film features conversations among girls about boys, dating, and their bodies, as well as humorous and awkward moments typical of growing up. Themes of curiosity about sexuality and the challenges of fitting in are prevalent throughout the dialogue. Keywords coming-of-age, adolescence, teenage girls, crushes, body image, peer relationships, sexuality, humor Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-22T00:00:00.000Z yes A/V Geeks 16mm Films no 1097 teenage girlfamily dinnerschoolboyfriendsfamilyfriendscoming-of-agedramahigh schoolrelationshipsteen lifePat RussellIrene ArrangaLowell Marks https://avgeeks.videonest.co/videos/420181/philadelphia-pennsylvania-friends-1970 https://img.videonest.org/gamma/420181_thumbnail_resized_v2.webp https://gamma.videonest.org/420181_video_v3.mp4 Philadelphia Pennsylvania Friends (1970) The film features Stephanie Rosenbomb discussing her hometown, Philadelphia, highlighting its historical significance. She mentions key events such as the founding of the city by William Penn, the meetings of the Continental Congress, and the signing of the Declaration of Independence and the Constitution. Philadelphia is portrayed as a city of firsts, being home to the first hospital, bank, newspaper, and zoo in the United States. Keywords Philadelphia, history, William Penn, Declaration of Independence, Constitution, Benjamin Franklin, firsts, Eastern Pennsylvania LIMITED DISTRIBUTION. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 209 PhiladelphiaPennsylvaniaDeclaration of IndependenceBenjamin FranklinFriends Select School17761681History of PhiladelphiaAmerican HistoryEducational DocumentaryTravel DocumentaryStephanie Rosenblum https://avgeeks.videonest.co/videos/420182/msc-the-second-step-houston-smog-mathematician-freeway-traffic-silent-raw-footage-1966 https://img.videonest.org/gamma/420182_thumbnail_resized_v2.webp https://gamma.videonest.org/420182_video_v3.mp4 MSC - "The Second Step" / Houston Smog / Mathematician / Freeway Traffic (silent raw footage, 1966) a series of silent moving images related to "The Second Step," Houston smog, a mathematician and a chalkboard, and freeway traffic, recorded between December 27 and December 29, 1966. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 896 HoustonTexassmogtime-lapsecity skylinehighway drivingcityscapestraveldocumentaryTexas time-lapseHouston skylinesmog timelapsehighwaydrivingcity https://avgeeks.videonest.co/videos/420183/fha-public-service-films-muppets-second-series-1964 https://img.videonest.org/gamma/420183_thumbnail_resized_v2.webp https://gamma.videonest.org/420183_video_v3.mp4 FHA PUBLIC SERVICE FILMS - MUPPETS - SECOND SERIES (1964) Jim Henson's Muppets! Features a humorous dialogue between a dog and a homeowner discussing the need for home improvements. The homeowner is advised to obtain a free consumer bulletin from the FHA to learn about financing options for home improvements and purchasing a home. The conversation highlights the benefits of FHA insured loans and encourages viewers to seek assistance for their housing needs. Keywords home improvements, FHA, consumer bulletin, home financing, home purchase, loans Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 103 FHAHome ImprovementHome PurchasesWashington, D.C.Consumer BulletinLoansHousing FinancingHomeownership https://avgeeks.videonest.co/videos/420184/happy-birthday-usa-bicentennial-parade-1976 https://img.videonest.org/gamma/420184_thumbnail_resized_v2.webp https://gamma.videonest.org/420184_video_v3.mp4 HAPPY BIRTHDAY USA: BICENTENNIAL PARADE (1976) The "Happy Birthday USA: Bicentennial Parade," produced in July 1976, features a vibrant display of military units from the Army, Navy, Marines, Air Force, and Coast Guard, alongside civilian marching bands and colorful floats. The event showcases a large crowd of spectators enjoying the parade, celebrating the United States' bicentennial. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1883 https://avgeeks.videonest.co/videos/420185/voyager-82-7-early-1980s https://img.videonest.org/gamma/420185_thumbnail_resized_v2.webp https://gamma.videonest.org/420185_video_v3.mp4 Voyager 82-7 (early 1980s) In February 1979, scientists and engineers at NASA's Jet Propulsion Laboratory prepared for the exploration of Jupiter and Saturn using the Voyager spacecraft. The Voyagers transmitted thousands of photographs revealing the complex atmospheres and surfaces of these planets and their moons. Key discoveries included Jupiter's faint ring system, volcanic activity on Io, and the intricate structure of Saturn's rings. The missions provided unprecedented insights into the outer planets and their moons, laying a scientific legacy for future generations. Keywords Voyager, NASA, Jupiter, Saturn, space exploration, Jet Propulsion Laboratory, moons, photography, scientific discoveries, planetary atmospheres Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1513 https://avgeeks.videonest.co/videos/420186/toward-a-better-life-no-2-educational-television-window-on-learning-arabic-1979 https://img.videonest.org/gamma/420186_thumbnail_resized_v2.webp https://gamma.videonest.org/420186_video_v3.mp4 Toward a Better Life No. 2: Educational Television, Window on Learning - (Arabic, 1979) The film discusses the transformative role of television in education, particularly in the Arab world. It highlights the development of educational television programs, such as "Open Sesame," which aims to blend entertainment with learning for children. The program is inspired by the American "Sesame Street" and focuses on teaching language and cultural heritage through engaging content. Experts from various Arab countries collaborate to produce this program, ensuring it meets the educational needs of Arabic-speaking children. The film also outlines the impact of technology and satellite communication in enhancing educational opportunities, demonstrating how television can effectively deliver knowledge across diverse regions. Keywords television, education, Open Sesame, Sesame Street, Arab world, children, language learning, cultural heritage, technology, satellite communication Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1719 https://avgeeks.videonest.co/videos/420187/simple-machines-working-together-1984 https://img.videonest.org/gamma/420187_thumbnail_resized_v2.webp https://gamma.videonest.org/420187_video_v3.mp4 Simple Machines: Working Together (1984) Explains how simple machines, such as levers, pulleys, wheels and axles, and inclined planes, work together to make tasks easier by trading force for distance or vice versa. It illustrates the concept of work, defined as the product of force and distance, and how mechanical advantage is achieved by combining these machines. By manipulating the lengths of levers and the configurations of compound machines, one can significantly increase the output force, demonstrating the effectiveness of simple machines in everyday applications. Keywords simple machines, mechanical advantage, compound machines, work, levers, pulleys, wheels and axles, inclined planes, force, distance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 794 Simple Machinesinput workoutput workmechanical partsmechanical engineeringphysicseducationscienceCoronet Filmseducational videoworkenergymachinesmechanicstechnology https://avgeeks.videonest.co/videos/420188/reading-self-improvement-interpretation-1979 https://img.videonest.org/gamma/420188_thumbnail_resized_v2.webp https://gamma.videonest.org/420188_video_v3.mp4 Reading Self - Improvement - Interpretation (1979) Discusses the importance of interpreting what you read by identifying both stated and unstated meanings. It explores concepts such as connotation versus denotation, assumptions, and figurative language. The viewer is encouraged to practice these skills by analyzing conversations, literature, and advertisements to uncover deeper meanings and intentions behind words. The process involves reading between, behind, and beyond the lines to enhance comprehension and critical thinking. Keywords reading skills, interpretation, connotation, denotation, assumptions, figurative language, critical thinking, unstated meanings, analysis, comprehension Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 759 teenagerscommunicationbody languageimplied meaningconversationnonverbal communicationsocial skillsteen interactionyouth communicationeducational videoteen psychologysocial cuesinterpreting body languageunderstanding teenseffective communication https://avgeeks.videonest.co/videos/420189/biomes-desert-1989 https://img.videonest.org/gamma/420189_thumbnail_resized_v2.webp https://gamma.videonest.org/420189_video_v3.mp4 Biomes: Desert (1989) Discusses desert biomes, highlighting their unique characteristics, such as extreme temperatures, lack of water, and diverse adaptations of plants and animals. It explains how deserts are formed by global wind patterns and the scarcity of rainfall, leading to a variety of desert landscapes, including sandy, stony, and mountainous regions. The adaptations of desert flora, like cacti and succulents, are crucial for water retention, while fauna, including nocturnal mammals and reptiles, have evolved behaviors to survive the harsh conditions. The impact of climate change and human activities on desertification is also addressed. Keywords desert biomes, climate, adaptations, flora, fauna, water scarcity, temperature extremes, desertification, human impact Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 792 desert biomesNamib DesertSahara Desertdesert landscapesdesert plantsanimal lifewildlifeecosystemgeologygeographynature documentaryarid environments https://avgeeks.videonest.co/videos/420190/american-summer-1973 https://img.videonest.org/gamma/420190_thumbnail_resized_v2.webp https://gamma.videonest.org/420190_video_v3.mp4 American Summer (1973) The film explores the experiences of 30 university students from Abidjan, Ivory Coast, who serve as counselors at American summer camps. It highlights their cultural exchanges with American children through games, songs, and dances. The counselors teach the children about their African traditions while also learning about American customs. The film emphasizes the importance of cultural understanding and friendship, showcasing moments of joy, discovery, and the breaking down of stereotypes about race and culture. Keywords summer camp, cultural exchange, American children, African counselors, friendship, traditions, music, dance, stereotypes, race relations Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1710 https://avgeeks.videonest.co/videos/420191/vision-usa-no-72-1978 https://img.videonest.org/gamma/420191_thumbnail_resized_v2.webp https://gamma.videonest.org/420191_video_v3.mp4 VISION USA, NO 72 (1978) The film explores the rise of skateboarding as a popular sport facilitated by new urethane wheels, leading to the establishment of skateboard parks and competitions. It also highlights advancements in art restoration using laser technology to clean and preserve valuable artworks, and the work of Failure Analysis Associates in investigating accidents to determine their causes. Additionally, it showcases the innovative safety features of a new community, The Woodlands, Texas, which boasts a two-way communication system for emergency response and community engagement. Keywords skateboarding, urethane wheels, skateboard parks, art restoration, laser technology, Failure Analysis Associates, accident investigation, The Woodlands, community safety, emergency response Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1595 https://avgeeks.videonest.co/videos/420192/beginning-responsibility-learning-to-follow-instructions-2nd-ed-1983 https://img.videonest.org/gamma/420192_thumbnail_resized_v2.webp https://gamma.videonest.org/420192_video_v3.mp4 Beginning Responsibility: Learning To Follow Instructions (2nd Ed, 1983) The film follows Sinbad, a young man who struggles to follow instructions, which leads to various mishaps. After receiving a magic carpet, he learns the importance of paying attention, understanding instructions, and following steps in order. Through trial and error, he discovers how to comprehend and execute tasks correctly, eventually passing his test to become a sailor. The story emphasizes the skills necessary for effective instruction-following, including focusing on the speaker, identifying key information, and visualizing steps. Keywords Sinbad, instructions, attention, understanding, steps, sailor, learning, mistakes, visualization, comprehension Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-23T00:00:00.000Z yes A/V Geeks 16mm Films no 698 Sinbadmagic carpetanimatedchildren'seducationalcartooninstructionfollowing instructions https://avgeeks.videonest.co/videos/420193/biomes-an-introduction-1989 https://img.videonest.org/gamma/420193_thumbnail_resized_v2.webp https://gamma.videonest.org/420193_video_v3.mp4 Biomes: An Introduction (1989) Provides an introduction to Earth's biomes, explaining how they are communities of living organisms shaped by climate and geography. Key factors influencing biomes include light and water availability. It discusses various biomes such as the Arctic tundra, coniferous forest, deciduous forest, tropical rainforest, grasslands, and deserts, detailing their characteristics, flora, and fauna. The film also highlights the interconnectedness of biomes and the impact of human activity on these ecosystems, emphasizing the importance of preserving biodiversity for the health of the planet. Keywords biomes, ecosystems, climate, tundra, coniferous forest, deciduous forest, tropical rainforest, grasslands, deserts, biodiversity, human impact Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-23T00:00:00.000Z yes A/V Geeks 16mm Films no 802 Arctic Tundrabiomesclimateplant lifeanimal lifepermafrostwatersun's energyecosystemwildlifepolarenvironmentnature documentaryscience documentaryecology https://avgeeks.videonest.co/videos/420194/av-geeks-16mm-lunch-4-25-2025 https://img.videonest.org/gamma/420194_thumbnail_resized_v2.webp https://gamma.videonest.org/420194_video_v3.mp4 AV Geeks 16mm Lunch 4-25-2025 Pre-packaged! Presweetened! Nutritious! Convenient! 16mm! #16mmfilms #avgeeks 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 3922 https://avgeeks.videonest.co/videos/420195/av-geeks-16mm-lunch-4-24-2025 https://img.videonest.org/gamma/420195_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/420195/av-geeks-16mm-lunch-4-24-2025 AV Geeks 16mm Lunch 4-24-2025 16mm refers to the width of the film. #16mmfilms #avgeeks NYC Subway footage Reaching your Reader, 2nd Hoja Takes A Wife Get That Job: Choosing A Career On Your Own: Preparing for a Standardized Test 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 4382 https://avgeeks.videonest.co/videos/420196/av-geeks-16mm-lunch-4-23-2025 https://img.videonest.org/gamma/420196_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/420196/av-geeks-16mm-lunch-4-23-2025 AV Geeks 16mm Lunch 4-23-2025 16mm films for you! No fuss, no bother. #avgeeks #16mmfilms Where the Fordson Shines Trailer for Flash Gordon's Trip to Mars Biomes: An Introduction VISION, episode 72 2025-04-24T00:00:00.000Z yes A/V Geeks 16mm Films no 3838 https://avgeeks.videonest.co/videos/420218/fha-home-financing-public-service-announcement-spot-12-collapsing-house-1960s https://img.videonest.org/gamma/420218_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/420218/fha-home-financing-public-service-announcement-spot-12-collapsing-house-1960s FHA HOME FINANCING PUBLIC SERVICE ANNOUNCEMENT SPOT #12: COLLAPSING HOUSE (1960s) Jim Henson's Muppets have a conversation about obtaining an FHA insured home improvement loan, highlighting the possibility of self-repairing a home while suggesting the audience reach out to the FHA for more information. Keywords FHA, home improvement, loan, self-repair, consumer bulletin, Department of Housing and Urban Development Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 37 FHAHome Improvement LoanHUDWashington D.C.Public Service Announcement1960sPuppetAnimatedHome RepairConsumer Bulletin https://avgeeks.videonest.co/videos/420219/hojas-pupils https://img.videonest.org/gamma/420219_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/420219/hojas-pupils Hoja's Pupils Propaganda Puppets! The film depicts the challenges of running a coffee house where locals gather to discuss daily events, including rumors about the chief of police's corruption. Through a story about Nasr-ed-din Hoja and his pupils, it explores themes of gossip and the spread of falsehoods, emphasizing the importance of questioning accusations and seeking truth rather than blindly believing rumors. Keywords coffee house, community, gossip, police corruption, Nasr-ed-din Hoja, rumors, truth, storytelling Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 598 Nasr-ed-din Hojamarionettescoffeehousestorytellinganimated folkloreshort filmChief of PoliceHamidanimationfolk talestraditional stories https://avgeeks.videonest.co/videos/420220/vice-versos-1962 https://img.videonest.org/gamma/420220_thumbnail_resized_v2.webp https://gamma.videonest.org/420220_video_v3.mp4 Vice Versos (1962) Animated propaganda film! The film presents a satirical take on the struggles of an aspiring poet in a regimented society. It juxtaposes the ideals of creativity and intellectualism against the harsh realities of labor and conformity. The protagonist grapples with the demands of a structured life, ultimately questioning the value of his artistic pursuits within a system that prioritizes productivity over creativity. Keywords poet, satire, conformity, creativity, labor, intellectualism, struggle, society, productivity Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-25T00:00:00.000Z yes A/V Geeks 16mm Films no 430 animated cartoonfarm animalsdonkeyroostercornfieldcomedypoetrywork ethicclassic cartoonanimationshort filmfamily film https://avgeeks.videonest.co/videos/423324/peter-and-the-magic-egg-1984 https://img.videonest.org/gamma/423324_thumbnail_resized_v2.webp https://gamma.videonest.org/423324_video_v3.mp4 Peter And The Magic Egg (1984) Narrated by Ray Bolger, "Peter and the Magic Egg" is a whimsical tale set in Pennsylvania Dutch country, where a farmer named Papa Doppler and his wife, Mama Doppler, struggle to save their farm from the greedy Tobias Tin Whiskers. With the help of magical animals and a special egg contract with the Easter Bunny, they aim to produce colorful eggs to pay off their debts. Peter, a unique creature who ages rapidly, becomes central to their plan but falls into a deep sleep after an accident. The animals rally to hatch a mysterious egg that holds the key to awakening Peter and saving the farm. Ultimately, laughter proves to be the magic ingredient that restores joy and prosperity to the community. Keywords Peter, Magic Egg, Pennsylvania Dutch, farmer, Tobias Tin Whiskers, Easter Bunny, colorful eggs, animals, laughter, community, wonderment 2025-04-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1461 PeterMagic EggPennsylvania DutchfarmerEaster Bunnycolorful eggsanimalslaughtercommunitywonderment https://avgeeks.videonest.co/videos/423325/the-loan-of-a-cauldron https://img.videonest.org/gamma/423325_thumbnail_resized_v2.webp https://gamma.videonest.org/423325_video_v3.mp4 The Loan of a Cauldron In a quiet coffee house, two friends discuss the state of their government, with one expressing skepticism about positive news. The waiter encourages one of them to share a story about Nasr-ed-din Hoja, who borrowed a cauldron to make a stew but deceived his neighbors with absurd tales about the cauldron giving birth and dying. The story illustrates how people often accept news that aligns with their beliefs rather than seeking the truth, highlighting the importance of discerning fact from fiction. Keywords Nasr-ed-din Hoja, coffee house, government, skepticism, truth, news, deception, story, lesson Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-29T00:00:00.000Z yes A/V Geeks 16mm Films no 519 Nasr-ed-din Hojapuppet showTurkish talesstorytellingcoffee houseTurkish folkloreanimationpuppet animationtraditional storiesTurkish culturecomedyfolk puppetryclassic taleshumoureducational https://avgeeks.videonest.co/videos/423326/by-whose-rules-1975 https://img.videonest.org/gamma/423326_thumbnail_resized_v2.webp https://gamma.videonest.org/423326_video_v3.mp4 By Whose Rules (1975) Follows a group of students advocating for political reform within their school. They propose a platform for student council candidates to promote transparency and representation. Despite facing resistance from the school administration, including a suspension for one student, they persist in their efforts to ensure student voices are heard. The narrative emphasizes the importance of free speech, civic engagement, and the challenges of implementing change in an educational setting. Keywords student rights, political reform, school board, free speech, civic engagement, student council, activism, education, democracy 2025-04-29T00:00:00.000Z yes A/V Geeks 16mm Films no 943 student rightsschool policiespolitical reformschool boardhall passesgrading systemsstudent activismeducation reformpolitical scienceschool governance https://avgeeks.videonest.co/videos/423327/changing-foods-in-changing-times-1976 https://img.videonest.org/gamma/423327_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423327/changing-foods-in-changing-times-1976 Changing Foods In Changing Times (1976) "Changing Foods In Changing Times" explores the evolution of American food culture from the early 20th century through the 1970s. It highlights the shift from traditional family meals to the rise of convenience foods due to changing societal roles, particularly for women. The film discusses the impact of World War II on food production and nutrition, emphasizing the importance of breakfast cereals as a nutritious and convenient option. It addresses common misconceptions about processed foods and the nutritional value of cereals, advocating for informed choices based on accurate information and nutritional labeling. Keywords food culture, convenience foods, women in the workforce, World War II, breakfast cereals, nutrition, processed foods, dietary misconceptions, nutritional labeling Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-29T00:00:00.000Z yes A/V Geeks 16mm Films no 960 World War IWorld War IIrationingfood industryconvenience foodsfamily mealsnutritionhomefrontsocial impacthistorical contextfood shortageswartimedomestic lifecultural changes20th century https://avgeeks.videonest.co/videos/423328/chemistry-solutions-ionic-and-molecular-2nd-ed-1983 https://img.videonest.org/gamma/423328_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423328/chemistry-solutions-ionic-and-molecular-2nd-ed-1983 Chemistry Solutions: Ionic And Molecular (2nd Ed, 1983) The film discusses the importance of solutions in various aspects of life and science. It explains how solutions differ from suspensions and colloids, illustrating the process of dissolving substances like salt in water. The film highlights the roles of solutes and solvents, the significance of water as a universal solvent, and the factors affecting solution concentration, including saturation and temperature. It also touches on the interactions between polar and nonpolar substances, emphasizing the relevance of solutions in biological processes and everyday life. Keywords solutions, mixtures, solute, solvent, water, concentration, saturation, polar, nonpolar, ionic, chemical reactions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1367 solutionsmixturessolutesolventwaterconcentrationsaturationpolarnonpolarionicmolecularchemistryscience https://avgeeks.videonest.co/videos/423329/imagining-a-hidden-world-the-light-microscope-1984 https://img.videonest.org/gamma/423329_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423329/imagining-a-hidden-world-the-light-microscope-1984 Imagining A Hidden World: The Light Microscope (1984) The film explores the fascinating world revealed by microscopes, showcasing how everyday substances like pond water and blood contain a myriad of microorganisms. It details the evolution of microscope design, explaining key components such as lenses, condensers, and the impact of light on image quality. Various techniques, including dark field illumination and polarized light, are demonstrated to enhance visibility and contrast of microscopic subjects. The film emphasizes the importance of using different lighting methods to fully understand the intricate details of living cells and organisms, highlighting the adventure of discovery through microscopy. Keywords microscope, microorganisms, illumination techniques, dark field, polarized light, image resolution, biological stains, microscopy, living cells, scientific exploration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-28T00:00:00.000Z yes A/V Geeks 16mm Films no 938 microscopymicroorganismspond waterblood cellsmicrobiologymicroscopeBioMEDIA Associatesbiology educationscience educationeducational video https://avgeeks.videonest.co/videos/423330/get-that-job-choosing-a-career-1975 https://img.videonest.org/gamma/423330_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423330/get-that-job-choosing-a-career-1975 Get That Job: Choosing A Career (1975) The film discusses the journey of three individuals—Jerry, Susan, and Mitch—as they navigate the process of choosing a career that aligns with their interests and skills. Jerry, an aspiring contractor, learns the importance of gaining experience and knowledge in various building crafts before pursuing his goal. Susan, passionate about art, discovers a broader range of career options within the art field and ultimately secures a position as an assistant artist. Mitch, who loves nature, seeks opportunities in environmental studies and finds entry-level work at a state agency. The film emphasizes the significance of self-awareness, research, and persistence in making informed career choices. Keywords career choice, vocational guidance, self-discovery, job experience, construction, art, environmental studies, persistence, research, Occupational Outlook Handbook Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-28T00:00:00.000Z yes A/V Geeks 16mm Films no 824 career planningjob searchcareer choicevocational guidancehigh schoolconstruction jobscareerjobsplanningguidancevocational trainingCoronet Instructional Mediaeducationalemploymentfuture https://avgeeks.videonest.co/videos/423331/four-seasons-silent-footage-1940s https://img.videonest.org/gamma/423331_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423331/four-seasons-silent-footage-1940s Four Seasons (silent footage, 1940s?) Raw silent footage of the different seasons in a small American town. Features footage of a family and their daily routine. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-28T00:00:00.000Z yes A/V Geeks 16mm Films no 621 ChicagoCityscapesHistoryAbraham Lincolnstatuesmokestacksbeach scenehorseback ridingboatingTravel https://avgeeks.videonest.co/videos/423332/the-civil-war-1863-65-revised-1983 https://img.videonest.org/gamma/423332_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423332/the-civil-war-1863-65-revised-1983 The Civil War, 1863-65 (revised, 1983) The film chronicles the pivotal years of the American Civil War from 1863 to 1865, focusing on key events such as Lincoln's Emancipation Proclamation, the battles of Gettysburg and Vicksburg, and the strategies employed by both the Union and Confederate armies. It highlights the challenges faced by both sides, including military failures, public opinion, and the changing role of African American soldiers. The narrative culminates in Lee's surrender to Grant, marking the end of the Confederate government, and concludes with the assassination of President Lincoln, setting the stage for the Reconstruction era. Keywords Civil War, Emancipation Proclamation, Lincoln, Gettysburg, Vicksburg, Union, Confederacy, Grant, Lee, Reconstruction Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1241 Civil WarAmerican Civil War18631865UnionConfederacyGettysburgVicksburgLincolnGrantLeeEmancipation ProclamationReconstructionMilitary HistoryUS History https://avgeeks.videonest.co/videos/423333/first-twenty-years-part-1 https://img.videonest.org/gamma/423333_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423333/first-twenty-years-part-1 First Twenty Years (Part 1) A selection of turn-of-the-century motion pictures from the Library of Congress’ paper print collection, meticulously restored by preservationist Kemp R. Niver. These rare works, originally produced by the Thomas A. Edison Company and captured by pioneering cinematographer Edwin S. Porter, offer a vibrant glimpse into the birth of American cinema. Highlights include *Elopement on Horseback*, *Uncle Josh’s Nightmare*, *Terrible Teddy, Grizzly King*, *Love by the Light of the Moon*, and *Life of an American Fireman*. Also featured are stunning early panoramas like *Circular Panorama of Electric Tower* and *Panorama of Esplanade by Night*, and the poignant *Martyred President*. Presented with live or recorded musical accompaniment, this program celebrates the visual storytelling innovations of cinema’s earliest years. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1369 https://avgeeks.videonest.co/videos/423334/reaching-your-reader-2nd-1983 https://img.videonest.org/gamma/423334_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/423334/reaching-your-reader-2nd-1983 Reaching Your Reader (2nd, 1983) The film follows Linda Laskkey as she reflects on her trip to the Orient and her attempts to write about it. Initially, she receives a rejection for her article, leading her to share her experiences with friends instead. Through a dialogue, she learns the importance of engaging the reader's senses in writing rather than simply recounting events. The film emphasizes the use of vivid descriptions, strong nouns, active verbs, and sensory details to recreate experiences and evoke emotions in readers. Keywords writing, storytelling, sensory details, engagement, description, travel, experience, creativity, narrative techniques Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 584 traveloguestorytellingwritingfilmorienttraveleducationpublicationarticleshowtell https://avgeeks.videonest.co/videos/423335/the-innkeepers-bill-1950s https://img.videonest.org/gamma/423335_thumbnail_resized_v2.webp https://gamma.videonest.org/423335_video_v3.mp4 The Innkeeper's Bill (1950s) The film explores the slow progress of a community adapting to modern amenities, such as running water and electricity, juxtaposed with a humorous story about Nasr-ed-din Hoja. This tale illustrates the dangers of debt, comparing the merchant's predicament with the potential consequences of relying on foreign aid. The narrative emphasizes caution in international relations, highlighting the importance of ensuring that help does not lead to exploitation. Keywords progress, modernization, Nasr-ed-din Hoja, debt, foreign aid, caution, exploitation, community, humor Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 574 Nasr-ed-din HojaInnkeeper's Billstop motionTurkeyAnimationShort FilmCulturalHistoricalAmerican aid https://avgeeks.videonest.co/videos/423336/chemistry-reaction-rates-and-equilibrium-1983 https://img.videonest.org/gamma/423336_thumbnail_resized_v2.webp https://gamma.videonest.org/423336_video_v3.mp4 Chemistry- Reaction Rates And Equilibrium (1983) Discusses the factors influencing chemical reaction rates and equilibrium. It explains how different reactions occur at varying rates due to factors such as the nature of reactants, surface area, concentration, temperature, and the presence of catalysts. The film illustrates these concepts through various experiments, including the reactions of iron with oxygen, magnesium with hydrochloric acid, and the effects of temperature and concentration on reaction speed. It also covers the concept of equilibrium in chemical reactions and the importance of controlling these factors in industrial processes, particularly in the production of ammonia. Keywords chemical reactions, reaction rates, equilibrium, catalysts, surface area, concentration, temperature, industrial processes, ammonia production Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1298 https://avgeeks.videonest.co/videos/423337/chemistry-elements-compounds-and-mixtures-2nd-ed-1983 https://img.videonest.org/gamma/423337_thumbnail_resized_v2.webp https://gamma.videonest.org/423337_video_v3.mp4 Chemistry: Elements, Compounds And Mixtures (2nd Ed, 1983) Chemistry: Elements, Compounds, and Mixtures (2nd Edition) (1983) is a 20-minute educational film from the *Chemistry Series* by Coronet Instructional Films, distributed by Simon and Schuster. Designed to introduce foundational chemistry concepts, the film demonstrates how compounds and mixtures can be separated into their individual components, ultimately leading to the identification of elements as the basic building blocks of matter. It also explores the structure of molecules and atoms, helping students understand the distinctions between pure substances and combinations of matter. With clear visuals and explanations, this film serves as a useful resource for middle and high school science education. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1251 https://avgeeks.videonest.co/videos/423338/buoyancy-1985 https://img.videonest.org/gamma/423338_thumbnail_resized_v2.webp https://gamma.videonest.org/423338_video_v3.mp4 Buoyancy (1985) *Buoyancy* (1985) is a 15-minute educational film produced by Coronet Film and Video that explores the fundamental principles of buoyancy through a series of clearly demonstrated experiments. The film examines how factors such as weight, volume, shape, and material composition influence whether an object floats or sinks. Designed for physics instruction, it provides visual explanations that help students understand the concepts of density and displacement, making it a valuable resource for teaching dynamics and physical science in the classroom. An accompanying guide is included to support discussion and classroom activities. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-27T00:00:00.000Z yes A/V Geeks 16mm Films no 792 BuoyancyGravityHot Air BalloonsResearch SubmarineScience ExperimentFluid MechanicsPhysicsEducationalBoston UniversityWayland Jr. High School https://avgeeks.videonest.co/videos/423339/a-diestro-y-siniestro-right-and-left-1956 https://img.videonest.org/gamma/423339_thumbnail_resized_v2.webp https://gamma.videonest.org/423339_video_v3.mp4 A Diestro y Siniestro (Right and Left) 1956 The cartoon depicts an intense boxing match between Kid Manoline and his formidable challenger, where both fighters showcase their skills and determination. Despite facing significant adversity, including injuries and exhaustion, Kid Manoline rallies to deliver a stunning performance, ultimately winning the match by a narrow margin. The narrative also touches on the underhanded tactics sometimes used in boxing, highlighting the drama and excitement of the sport. Keywords boxing, Kid Manoline, fight, challenger, knockout, determination, tactics, sports drama Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 451 boxing matchfightcartoonroosterwolfanimationboxingtrainingDibujos AnimadosPat Matthews https://avgeeks.videonest.co/videos/423340/profile-joan-ganz-cooney-promo-clips-1973 https://img.videonest.org/gamma/423340_thumbnail_resized_v2.webp https://gamma.videonest.org/423340_video_v3.mp4 Profile: Joan Ganz Cooney (Promo Clips) - 1973 The film discusses the innovative use of television as a teaching tool for children, particularly through programs like "Sesame Street" and "The Electric Company," created under the leadership of Joan Gans Cooney. It emphasizes the importance of reading and how television can enhance literacy, blending entertainment with educational content. The Children's Television Workshop, headquartered in New York, aims to improve children's reading abilities while also fostering social and emotional development. Cooney's vision combines scientific research with creative production, ensuring that educational programming remains effective and engaging for young audiences. Keywords television, education, literacy, Joan Gans Cooney, Children's Television Workshop, Sesame Street, The Electric Company, children's programming, reading skills, emotional development Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 760 Children's Television WorkshopeducationalchildrenreadingtelevisionJoan Ganz Cooneyschool busLincoln Center https://avgeeks.videonest.co/videos/423341/goddard-madrid-goldstone-canberra-tracking-stations-silent-1970 https://img.videonest.org/gamma/423341_thumbnail_resized_v2.webp https://gamma.videonest.org/423341_video_v3.mp4 Goddard- Madrid, Goldstone, Canberra Tracking Stations. (silent, 1970) This 1970 film documents the operations of NASA's Deep Space Network tracking stations located in Madrid, Spain; Goldstone, California; and Canberra, Australia. It features a combination of exterior and interior shots, showing the large 85-foot tracking antennas, control rooms, and staff operating recording and communication equipment. At the Madrid station, viewers see the antenna set against the city backdrop, technicians at consoles, and monitors displaying images of astronauts. The Goldstone segment highlights the desert landscape with cacti and mountains, providing views of the station's facilities and personnel at work. In Canberra, the film captures the Tidbinbilla station, including signage referencing its operation by the Australian Department of Supply on behalf of NASA and the Jet Propulsion Laboratory. The film emphasizes the coordinated global effort required to support deep space missions, illustrating the essential role of these ground stations in tracking spacecraft and relaying data across continents. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 337 NASADeep Space NetworkFresnedillas Deep Space StationSatellite TrackingMadridSpainDeep Space ExplorationSpace CommunicationSatelliteTracking StationAntennaTelemetrySpacecraftCommunicationTechnology https://avgeeks.videonest.co/videos/423342/on-your-own-preparing-for-a-standardized-test-1982 https://img.videonest.org/gamma/423342_thumbnail_resized_v2.webp https://gamma.videonest.org/423342_video_v3.mp4 On Your Own: Preparing For A Standardized Test (1982) The film provides guidance on preparing for standardized tests, focusing on the SAT and other admissions exams. It emphasizes the importance of understanding the test material, familiarizing oneself with the test format, and managing test anxiety. Experts and students share strategies for effective study habits, including using sample questions and practice tests. The film also highlights the significance of knowing what test scores represent in the context of college admissions. Keywords standardized tests, SAT, test preparation, study strategies, test anxiety, admissions exams, sample questions, practice tests, score interpretation 2025-04-26T00:00:00.000Z yes A/V Geeks 16mm Films no 1578 https://avgeeks.videonest.co/videos/423343/av-geeks-16mm-lunch-4-29-2025 https://img.videonest.org/gamma/423343_thumbnail_resized_v2.webp https://gamma.videonest.org/423343_video_v3.mp4 AV Geeks 16mm Lunch 4-29-2025 Even though Skip is sick, there's still time to watch some vintage 16mm films. #avgeeks #16mmfilms Human Reaction Time Time Romance of Timekeeping Everywhere All The Time 2025-04-30T00:00:00.000Z yes A/V Geeks 16mm Films no 4038 timekeepinghistorywatchesmechanical clockreaction timesciencemeasurementhorologyprecisioneducationengineeringpsychologyastronomyinventionssafety https://avgeeks.videonest.co/videos/423344/av-geeks-4-28-2025 https://img.videonest.org/gamma/423344_thumbnail_resized_v2.webp https://gamma.videonest.org/423344_video_v3.mp4 AV Geeks 4-28-2025 Skip's got the spring crud but still has some films for you! #avgeeks #16mmfilms 2025-04-29T00:00:00.000Z yes A/V Geeks 16mm Films no 4013 https://avgeeks.videonest.co/videos/427156/dick-clark-jiffy-pop https://img.videonest.org/gamma/427156_thumbnail_resized_v2.webp https://gamma.videonest.org/427156_video_v3.mp4 [Dick Clark - Jiffy Pop] Dick Clark shows how to make Jiffy Pop popcorn. It highlights the fun process of removing the top, placing it on the stove, and shaking it until the popcorn pops and the top balloons. The emphasis is on the enjoyable experience of making and eating Jiffy Pop, described as the butteriest and best-tasting popcorn snack. Keywords Jiffy Pop, popcorn, cooking, snack, fun, demonstration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-01T00:00:00.000Z yes A/V Geeks 16mm Films no 29 Jiffy PopPopcornMicrowaveCookingRecipeSnack1960sCommercialRetroFoodButter Flavor https://avgeeks.videonest.co/videos/427157/its-not-where-youre-going-its-how-you-get-there-and-back-1973 https://img.videonest.org/gamma/427157_thumbnail_resized_v2.webp https://gamma.videonest.org/427157_video_v3.mp4 It's Not Where You're Going. It's How You Get There and Back. (1973) The film emphasizes the importance of safe boating practices, particularly focusing on boat trailering. It features insights from notable figures in auto racing and space exploration, highlighting the parallels between safe operation of vehicles and boats. The film discusses the crucial aspects of trailer safety, including the need for proper equipment, training, and adherence to regulations. It underscores the significance of preparation, maintenance, and safe driving techniques to prevent accidents while boating. Keywords boating safety, trailer safety, auto racing, Scott Carpenter, Jerry Grant, Dan Gurney, Coast Guard, accident prevention, equipment maintenance, training Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-01T00:00:00.000Z yes A/V Geeks 16mm Films no 793 boating safetyboat trailerUnited States Coast Guardsafety tipsboatingwater safetytrailer safetyUSCGRecreationPublic Service Announcementboatnauticalmarinecoast guardregulations https://avgeeks.videonest.co/videos/427158/inshallah-1950s https://img.videonest.org/gamma/427158_thumbnail_resized_v2.webp https://gamma.videonest.org/427158_video_v3_360.mp4 Inshallah (1950s) The film presents a philosophical dialogue between two characters discussing the implications of man's creations versus God's creations. The kite symbolizes human achievements, flying higher than birds but being tethered and dependent on its creator. One character argues that society should recognize God, while the other advocates for a godless state, believing in progress through change. The story of Nasr-ed-din Hojaillustrates the importance of humility and faith in God, contrasting the fleeting nature of man's constructs with the enduring presence of divine wisdom. Keywords kite, nature, God, society, progress, Nasr-ed-din Hoja, faith, philosophy, dialogue, human achievement Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-30T00:00:00.000Z yes A/V Geeks 16mm Films no 567 Nasr-ed-din Hojaanimated shortpuppetrykite flyingman vs natureInshallahanimationshort filmfolk talemoral storycomedyculturetraditional animationpuppet animationCentral Asian Folklore https://avgeeks.videonest.co/videos/427159/water-safety-an-introduction-1974 https://img.videonest.org/gamma/427159_thumbnail_resized_v2.webp https://gamma.videonest.org/427159_video_v3_360.mp4 Water Safety: An Introduction (1974) The film "Water Safety: An Introduction" emphasizes the importance of water safety and prevention of accidents. It highlights common mistakes, such as swimming alone and relying on flotation devices, which can lead to dangerous situations. Viewers are encouraged to learn swimming techniques and survival floating to stay safe in water. The film also advises always swimming with a buddy, avoiding risky behavior, and knowing how to assist someone in distress properly. Overall, it aims to educate individuals on water safety practices to prevent accidents. Keywords water safety, swimming, survival floating, accidents, prevention, swimming buddy, rescue techniques, education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-30T00:00:00.000Z yes A/V Geeks 16mm Films no 627 Water Safetyrope bridgeriveroceaninner tubefallsswimmingwater sportssafety tipsadventureoutdoor activitiesextreme sportswater activitiesriver safetyocean safety https://avgeeks.videonest.co/videos/427160/how-animals-discovered-christmas-revised-1983 https://img.videonest.org/gamma/427160_thumbnail_resized_v2.webp https://gamma.videonest.org/427160_video_v3_360.mp4 How Animals Discovered Christmas (revised, 1983) This animated film narrates the heartwarming story of animals in Cozy Valley as they come together to help a bluebird with a broken wing during Christmas time. Velvet the Fawn discovers the injured bird and enlists the help of other animals, including Doc Owl, Buttons the Squirrel, and Mrs. Beaver. They work together to provide a warm home and food for the bluebird, culminating in a joyful Christmas celebration where they all learn the value of kindness and friendship. Keywords Cozy Valley, animals, Christmas, bluebird, Velvet the Fawn, Doc Owl, friendship, kindness, celebration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-30T00:00:00.000Z yes A/V Geeks 16mm Films no 773 ChristmasChristmas treeCozy Valleywinteranimalsbluebirdanimationholiday storyfamily filmkids showcharmingVelvetDoc Owlwinter animalsfestive https://avgeeks.videonest.co/videos/427161/i-am-a-man-1970 https://img.videonest.org/gamma/427161_thumbnail_resized_v2.webp https://gamma.videonest.org/427161_video_v3_360.mp4 I Am A Man (1970) The film explores the evolving identity and empowerment of Black Americans during a period of civil rights activism. It highlights the growing confidence among Black individuals, the historical struggles against racial discrimination, and the importance of political participation. The stories of three leaders—Carl Stokes, Reverend Jesse Jackson, and Ernest Green—illustrate the diverse approaches to achieving equality and the ongoing challenges faced by the community. The film emphasizes the significance of education, economic opportunities, and collective action in the fight for civil rights and social justice. Keywords Black Americans, identity, civil rights, empowerment, Carl Stokes, Reverend Jesse Jackson, Ernest Green, political participation, equality, economic opportunities, social justice Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-04-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1820 Civil Rights MovementBlack AmericansidentityempowermentequalityJesse JacksonCarl Stokespolitical participationsocial justicediscriminationprotestactivismeconomic opportunitiesAfrican American historyUS History https://avgeeks.videonest.co/videos/427162/av-geeks-16mm-lunch-4-30-2025 https://img.videonest.org/gamma/427162_thumbnail_resized_v2.webp https://gamma.videonest.org/427162_video_v3.mp4 AV Geeks 16mm Lunch 4-30-2025 Farewell April.. sorry you'll miss all the great 16mm films we'll be watching in May. #avgeeks #16mmfilms 2025-05-01T00:00:00.000Z yes A/V Geeks 16mm Films no 3893 16mm filmvintage filmnatureinsectsvintage carsmeasurementtraining filmretail shrinkageinventory managementpuppet showstorytellingfilmmakingwildlifeautomotive designprecision https://avgeeks.videonest.co/videos/428477/world-war-ii-the-roots-of-aggression-1985 https://img.videonest.org/gamma/428477_thumbnail_resized_v2.webp https://gamma.videonest.org/428477_video_v3.mp4 World War II: The Roots Of Aggression (1985) he film outlines the events leading up to World War II, starting from the late 1920s when various global powers were recovering from World War I. It discusses key political changes, such as the rise of Adolf Hitler in Germany and the aggressive actions of Japan in Manchuria. The narrative highlights the failures of the League of Nations to maintain peace, the economic turmoil of the Great Depression, and the increasing militarization of Germany and Japan. By 1939, the film depicts the culmination of these tensions as Germany invades Poland, marking the official start of World War II. Keywords World War II, Adolf Hitler, Japan, League of Nations, Manchuria, Great Depression, militarization, invasion, Poland, aggression Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-02T00:00:00.000Z yes A/V Geeks 16mm Films no 826 World War II1929-1939Joseph StalinChiang Kai-shekHerbert HooverCharles LindberghLeninKellogg-Briand PactAndre Magino https://avgeeks.videonest.co/videos/428478/ruined-by-his-wife-1950s https://img.videonest.org/gamma/428478_thumbnail_resized_v2.webp https://gamma.videonest.org/428478_video_v3.mp4 Ruined By His Wife (1950s) The film features Hamid, a young radical, discussing the importance of truth over loudness in a peaceful coffee house setting. He recounts the story of Nasr-ed-din Hoja, who faced false accusations from his wife. Despite her loud claims, the villagers eventually learn the truth, highlighting that the loudest voices are not necessarily the most credible. The narrative emphasizes the lesson that wisdom lies in discerning truth beyond mere noise. Keywords Hamid, Nasr-ed-din Hoja, truth, loudness, accusations, villagers, wisdom, story, coffee house Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-02T00:00:00.000Z yes A/V Geeks 16mm Films no 532 Nasr-ed-din Hojapuppet showTurkish puppet showstorytellingfolk talesTurkeyanimationclassic storiespuppet animationtraditional storiesHamid https://avgeeks.videonest.co/videos/428479/morality-for-youth-1982 https://img.videonest.org/gamma/428479_thumbnail_resized_v2.webp https://gamma.videonest.org/428479_video_v3.mp4 Morality for Youth (1982) "Morality for Youth" emphasizes the importance of moral integrity and self-control, using the metaphor of navigating a river to illustrate life's challenges. It discusses the significance of adhering to the law of chastity, the dangers of sexual immorality, and the impact of peer pressure on decision-making. The speaker encourages young people to maintain strong moral standards, make thoughtful choices, and seek guidance from their faith to navigate life's complexities safely. Keywords morality, youth, sexual purity, self-control, peer pressure, law of chastity, faith, decision-making, river metaphor, guidance 2025-05-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1293 moralityyouthsexual purityself-controlpeer pressurelaw of chastityfaithdecision-makingriver metaphorguidance https://avgeeks.videonest.co/videos/428480/otto-the-auto-buckle-up-1970s https://img.videonest.org/gamma/428480_thumbnail_resized_v2.webp https://gamma.videonest.org/428480_video_v3.mp4 Otto the Auto - Buckle Up (1970s) This animated short film features a conversation between Rachel and Otto about the importance of wearing seat belts. Rachel initially resists using a seat belt, considering it babyish, but during a fun imaginary ride through space, she realizes the necessity of buckling up for safety. The playful dialogue emphasizes the importance of using seat belts in cars to ensure safety during sudden stops. Keywords seat belt, safety, children, imaginary ride, space, conversation, importance, car safety Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-01T00:00:00.000Z yes A/V Geeks 16mm Films no 293 car safetyseatbeltschildrensafetycartooneducationalkidsAAA FoundationOtto the Auto https://avgeeks.videonest.co/videos/428481/av-geeks-16mm-lunch-5-1-2025 https://img.videonest.org/gamma/428481_thumbnail_resized_v2.webp https://gamma.videonest.org/428481_video_v3.mp4 AV Geeks 16mm Lunch 5-1-2025 May Day! #16mmfilms #avgeeks Growth of Flowers (2nd, rev) The Lost Treasure Microbiology: Imaging A Hidden World East Side West Side 2025-05-02T00:00:00.000Z yes A/V Geeks 16mm Films no 4717 16mm filmnaturemicroscopyNew York Cityvintage filmscience educationbotanytime-lapsepuppet showurban lifecity historyhistorical footageanimationstorytellingbiology https://avgeeks.videonest.co/videos/431977/the-next-stop-1950s https://img.videonest.org/gamma/cxr8Oim7gg0_thumbnail_resized_v2.webp https://gamma.videonest.org/cxr8Oim7gg0_video_v3.mp4 The Next Stop (1950s?) The film depicts the journey of Wayne and Esther Dickinson, a young couple who take over a rundown farm. Through hard work and strategic planning, they aim to improve their property step by step, focusing on essential upgrades like running water, better livestock management, and modern facilities. With the help of experienced locals, they tackle plumbing issues, enhance their living conditions, and ultimately transform their farm into a profitable and healthful environment. The film emphasizes the importance of progress and the satisfaction that comes from building a better future. Keywords farming, progress, plumbing, rural life, family, hard work, modernization, agriculture, community support, livestock Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1708 farmingprogressplumbingrural lifefamilyhard workmodernizationagriculturecommunity supportlivestock1950sfarm upgradeswater systemhomesteading https://avgeeks.videonest.co/videos/431984/lunch-money-what-should-i-do-1970 https://img.videonest.org/gamma/JODaEC0AQQY_thumbnail_resized_v2.webp https://gamma.videonest.org/JODaEC0AQQY_video_v3.mp4 Lunch Money, What Should I Do (1970) Explores a situation where a girl named Susie loses her purse containing her lunch money. The narrative unfolds as Susie contemplates accusing her friends Hank and Red, who were the only ones around when the purse went missing. Each character grapples with their thoughts about trust, honesty, and the consequences of their actions. The film emphasizes the importance of making decisions and considering different perspectives in problem-solving. Keywords purse, lunch money, trust, honesty, decision-making, friendship, conflict, problem-solving Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-05T00:00:00.000Z yes A/V Geeks 16mm Films no 358 Walt Disney ProductionsMoral DilemmaDecision MakingChildren's AnimationLost PursePlaygroundSuzieVintage CartoonTechnicolorHonestyFound purseProblem solvingHankRedLunch Money https://avgeeks.videonest.co/videos/431991/av-geeks-16mm-lunch-5-5-2025 https://img.videonest.org/gamma/2ZFhLJ5l6Z8_thumbnail_resized_v2.webp https://gamma.videonest.org/2ZFhLJ5l6Z8_video_v3.mp4 AV Geeks 16mm Lunch 5-5-2025 More 16mm films?! Is that what you want? I'll see what we can do.. #16mmfilms #avgeeks 2025-05-05T00:00:00.000Z yes A/V Geeks 16mm Films no 4966 rose growinggardeningflower shopgreenhouserose gardenrose businessgrowing plantpruning plantHarvesting rosessmall businessBig JoeAngelfamilybeachspace aliens https://avgeeks.videonest.co/videos/432009/fastest-port-in-the-west-1975 https://img.videonest.org/gamma/mQ7_meOgQms_thumbnail_resized_v2.webp https://gamma.videonest.org/mQ7_meOgQms_video_v3.mp4 Fastest Port in the West (1975) The film highlights the Port of Oakland as a premier shipping hub on the West Coast, emphasizing its modern facilities and strategic location. It showcases the port's capabilities in handling containerized and breakbulk cargo, its efficient logistics with access to railroads and highways, and the rapid turnaround times for ships. The Port of Oakland is depicted as a vital link for international trade, offering extensive storage and distribution options while maintaining a commitment to efficiency and expansion. Keywords Port of Oakland, shipping hub, containerized cargo, breakbulk cargo, logistics, railroads, highways, international trade, efficiency, expansion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1225 Port of Oaklandshipping hubcontainerized cargobreakbulk cargologisticsrailroadshighwaysinternational tradeefficiencyexpansion https://avgeeks.videonest.co/videos/432017/commitment-to-challenge-1988 https://img.videonest.org/gamma/LDCmUuHOceo_thumbnail_resized_v2.webp https://gamma.videonest.org/LDCmUuHOceo_video_v3.mp4 Commitment To Challenge (1988?) The film discusses the history and advancements of NASA's Johnson Space Center (JSC), highlighting its role in America's space programs from the Gemini missions to the development of the Space Shuttle and the future of lunar exploration and Mars missions. It emphasizes the importance of meticulous planning, training, and technological development in ensuring mission success. The film also showcases the collaborative efforts between JSC, contractors, and the academic community, and its contributions to the local Houston economy and public education about space exploration. Keywords NASA, Johnson Space Center, Gemini program, Apollo program, Space Shuttle, lunar exploration, Mars missions, space station, technology, training, collaboration, public education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-06T00:00:00.000Z yes A/V Geeks 16mm Films no 811 NASASpace ExplorationAstronaut TrainingSpace Mission OperationsApollo ProgramSpace Shuttle ProgramManned Mars MissionLunar ExplorationPlanetary ScienceSpace StationAerospace TechnologyJohnson Space CenterSpace RoboticsSpacesuit TestingAstronaut Health https://avgeeks.videonest.co/videos/432022/butterfly-1968 https://img.videonest.org/gamma/bQZMwUlHWZ8_thumbnail_resized_v2.webp https://gamma.videonest.org/bQZMwUlHWZ8_video_v3.mp4 Butterfly (1968) A visually detailed study of the swallowtail butterfly’s life cycle, captured entirely through extreme close-up photography. Without narration, the film relies on striking imagery to document the transformation from egg to caterpillar, chrysalis, and finally, the emergence of the fully developed butterfly. This intimate perspective allows viewers to observe the intricate details of each stage, emphasizing the delicate beauty and natural wonder of metamorphosis. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-06T00:00:00.000Z yes A/V Geeks 16mm Films no 536 Swallowtail butterflyMetamorphosisCaterpillarChrysalisButterfly emergenceInsect life cyclePupationButterfly wingscaterpillar hatchinglarva developmentinsect moltingcaterpillar feedingpupation preparationentomologyNature documentary https://avgeeks.videonest.co/videos/432039/education-for-excellence-1964 https://img.videonest.org/gamma/93z5biWRUwc_thumbnail_resized_v2.webp https://gamma.videonest.org/93z5biWRUwc_video_v3.mp4 Education for Excellence (1964) The film "Education for Excellence" highlights the educational programs for gifted children in New York City's public elementary schools. It showcases the success of these programs, including achievements in contests and talent searches. The film emphasizes the holistic approach to selecting students for gifted classes, considering not just test scores but also emotional readiness and creativity. It illustrates various classroom activities, including discussions on mass media, critical thinking, and science, while promoting the development of leadership skills among gifted students. The film ultimately advocates for nurturing children's intellectual and moral growth. Keywords gifted education, New York City, intellectual promise, selection criteria, critical thinking, mass media, leadership skills, classroom activities, emotional readiness, science education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1542 https://avgeeks.videonest.co/videos/432066/a-light-shines-in-the-darkness-1962 https://img.videonest.org/gamma/kWbIVz7jNnY_thumbnail_resized_v2.webp https://gamma.videonest.org/kWbIVz7jNnY_video_v3.mp4 A Light Shines In The Darkness (1962) "A Light Shines in the Darkness" (1962) recounts the life, crucifixion, and resurrection of Jesus Christ, emphasizing his teachings of love and spiritual nourishment. The film portrays key events from Jesus' life, including his miracles, the Last Supper, his trial and crucifixion, and the discovery of his empty tomb by Mary Magdalene and others. It highlights his interactions with his disciples after the resurrection and the promise of the Holy Spirit, culminating in the Pentecost where the apostles speak in various languages. The film conveys themes of hope, faith, and the enduring impact of Jesus' message. Keywords Jesus Christ, crucifixion, resurrection, miracles, disciples, Last Supper, Pentecost, Holy Spirit, faith, love, hope Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1289 https://avgeeks.videonest.co/videos/432078/never-a-bride-1969 https://img.videonest.org/gamma/IFnLogPD5UU_thumbnail_resized_v2.webp https://gamma.videonest.org/IFnLogPD5UU_video_v3.mp4 Never A Bride (1969) "Never A Bride" follows Laura, a young woman working at a summer resort, as she navigates her feelings about love and marriage. Throughout the summer, she interacts with various characters, including her aunt, friends, and potential suitors, while grappling with the pressure of finding the right partner. As she learns to ride horses and helps at the resort, Laura reflects on what it means to be a good partner and the importance of being the right person before seeking love. Ultimately, she resolves to focus on her own growth and happiness, believing that love will come when the time is right. Keywords romance, summer resort, self-discovery, love, relationships, personal growth, marriage, friendship, horses 2025-05-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1243 romancesummer resortself-discoveryloverelationshipspersonal growthmarriagefriendshiphorsesvintage film1960scoming of age https://avgeeks.videonest.co/videos/432104/more-dates-for-kay-1952 https://img.videonest.org/gamma/7SRIll-j8Y8_thumbnail_resized_v2.webp https://gamma.videonest.org/7SRIll-j8Y8_video_v3.mp4 More Dates for Kay (1952) The film revolves around the character Kay, who navigates the ups and downs of dating life. Through conversations with her friends, we learn about the importance of personal grooming, dressing appropriately, and being friendly to attract potential dates. Kay develops a system to overcome her dating slumps by making friends with boys and being helpful, which leads to more dating opportunities. The narrative emphasizes that while looks and cleanliness matter, friendliness and interest in others are key to building connections. Keywords dating, friendship, grooming, personal care, social skills, dating advice, youth, relationships Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-07T00:00:00.000Z yes A/V Geeks 16mm Films no 623 1950s teenagersDating adviceSocial skillsPersonal groomingSelf-confidenceHigh school lifeCoronet FilmsTeenage Dating AdviceMaking FriendsHelpfulnessKayHarryBuzzvintage telephoneblack and white film https://avgeeks.videonest.co/videos/432118/its-your-move-sergeant-1973 https://img.videonest.org/gamma/jumEzYPI6Dg_thumbnail_resized_v2.webp https://gamma.videonest.org/jumEzYPI6Dg_video_v3.mp4 It's Your Move, Sergeant (1973) "It's Your Move, Sergeant" follows Sergeant Jackson as he navigates the challenges of his new role amid personal milestones, including the birth of his son and final exams. The film captures the complexities of police work, showcasing various incidents and interactions that highlight the balance of authority and responsibility. Throughout the narrative, Jackson deals with the pressures of supervising former colleagues, responding to emergencies, and managing his relationships, all while maintaining a sense of humor in the face of adversity. Keywords Sergeant Jackson, police work, authority, responsibility, emergencies, personal milestones, humor, supervision, camaraderie 2025-05-07T00:00:00.000Z yes A/V Geeks 16mm Films no 1424 policesergeantJacksonlaw enforcementauthorityresponsibilityemergenciespersonal milestoneshumorsupervision https://avgeeks.videonest.co/videos/432123/av-geeks-16mm-lunch-5-7-2025 https://img.videonest.org/gamma/iB5ZexCFmqk_thumbnail_resized_v2.webp https://gamma.videonest.org/iB5ZexCFmqk_video_v3.mp4 AV Geeks 16mm Lunch 5-7-2025 Watch old films. Feel new feelings. #16mmfilms #avgeeks 2025-05-08T00:00:00.000Z yes A/V Geeks 16mm Films no 4320 16mm filmvandalismjuvenile delinquencyschool violenceschoolpoliceproperty damagesocial issueseducational filmTaking ResponsibilityWhat's Wrong With Vandalismpublic schoolresponsibilityconsequencesmoral lesson https://avgeeks.videonest.co/videos/432125/cell-wars-1987 https://img.videonest.org/gamma/ySdXggSISIc_thumbnail_resized_v2.webp https://gamma.videonest.org/ySdXggSISIc_video_v3.mp4 Cell Wars (1987) A whimsical adventure unfolds inside a body where germs plot to invade and make it sick. The protagonist, Andy, learns about the battle between germs and the body's defenses, including antibodies and lymphocytes. As the germs attempt to spread illness, Andy, guided by various cells, must engage in a fight against them, showcasing the ongoing struggle between health and disease. The film emphasizes the importance of the immune system and the continual battle against germs. Keywords germs, immune system, antibodies, lymphocytes, adventure, health, disease, battle, infection, body 2025-05-08T00:00:00.000Z yes A/V Geeks 16mm Films no 643 Cell WarsImmune SystemGermsVirusesBacteriaAntibodiesLymphocytesPhagocytesHealth EducationHuman BiologyTime Lapse Cinemicrosopy1986 FilmOrchestral MusicUCLA School of MedicineMusiek Productions https://avgeeks.videonest.co/videos/432128/empire-strikes-back-hoth-micro-collection-playset-1980s https://img.videonest.org/gamma/h6BLvz2VIFU_thumbnail_resized_v2.webp https://gamma.videonest.org/h6BLvz2VIFU_video_v3.mp4 [Empire Strikes Back Hoth Micro Collection Playset, 1980s] The Star Wars Micro Collection line, featuring the Hothworld playset with 19 diecast figures and action poses. It highlights various scenes from the Star Wars universe, including characters like Luke, Chewbacca, Princess Leia, and Darth Vader, as they engage in battles and strategize against the Empire. The playsets are designed to connect and enhance the gameplay experience. Keywords Star Wars, Micro Collection, Hothworld, playsets, diecast figures, Kenner, action poses, Luke Skywalker, Darth Vader, Princess Leia 2025-05-08T00:00:00.000Z yes A/V Geeks 16mm Films no 60 Star WarsHoth WorldKenner Toys1980s CommercialVintage ToysAction FiguresToy PlaysetDie-cast FiguresLuke SkywalkerHan SoloChewbaccaWampaPrincess LeiaStormtroopersScout Walker https://avgeeks.videonest.co/videos/432155/av-geeks-16mm-lunch-5-8-2025 https://img.videonest.org/gamma/giG-RocWBew_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/432155/av-geeks-16mm-lunch-5-8-2025 AV Geeks 16mm Lunch 5-8-2025 Nothing says lunch like flickering film and facts on 16mm! #16mmfilms #avgeeks 2025-05-08T00:00:00.000Z yes A/V Geeks 16mm Films no 2860 https://avgeeks.videonest.co/videos/432166/basic-television-terms-a-video-dictionary-1977 https://img.videonest.org/gamma/WL6MZzFYeNU_thumbnail_resized_v2.webp https://gamma.videonest.org/WL6MZzFYeNU_video_v3.mp4 Basic Television Terms - A Video Dictionary (1977) The film, hosted by Leonard Nimoy, serves as a comprehensive introduction to basic television production terminology and techniques. It distinguishes between big budget and little budget television productions, highlighting the roles of various crew members such as producers, directors, and technical staff. The film explains the steps involved in production, including pre-production planning, live vs. taped production, camera work, and editing processes. It covers different types of shots, camera movements, and editing techniques, providing viewers with a foundational understanding of how television programs are created. Keywords television production, Leonard Nimoy, big budget, little budget, crew roles, pre-production, live production, taped production, camera shots, editing techniques 2025-05-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1061 Leonard NimoyVideo DictionaryVideo ProductionFilmmakingCinematographyVideo EditingTelevision ProductionCamera ShotsShot CompositionTelevision DirectingPost-productionPre-productionVideotape recordingSpecial effectsVideo effects https://avgeeks.videonest.co/videos/435394/northwest-schools-art-training-course-1970s https://img.videonest.org/gamma/435394_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435394/northwest-schools-art-training-course-1970s Northwest Schools Art Training Course (1970s) A commercial for an art training course by Northwest Schools, designed to help individuals develop their artistic skills at home. It offers step-by-step lessons from a distinguished artist, covering both fundamentals and advanced techniques. Participants receive personalized feedback and can progress at their own pace, with support available through mail. Keywords art training, Northwest Schools, artistic skills, step-by-step lessons, distinguished artist, personalized feedback, independent learning Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 49 https://avgeeks.videonest.co/videos/435395/horizons-of-science-thinking-machines-1959 https://img.videonest.org/gamma/435395_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435395/horizons-of-science-thinking-machines-1959 Horizons of Science: Thinking Machines (1959) The film explores the evolution of computing technology and its potential to mimic human intelligence. It discusses how large computing machines are transforming industries by performing complex calculations and making decisions. The film highlights research on "thinking machines," showcasing experiments like Claude Shannon's mechanical mouse that learns through trial and error, and a chess-playing program developed for the IBM 704. It emphasizes the differences between human brains and computers, noting that while machines can process information and learn, they lack imagination and true creativity. The film concludes with the possibility of developing intelligent machines and understanding the complexities of the human brain. Keywords computers, artificial intelligence, learning machines, Claude Shannon, chess, pattern recognition, human brain, technology, research, decision-making 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 1113 https://avgeeks.videonest.co/videos/435396/recorded-live-1975 https://img.videonest.org/gamma/435396_thumbnail_resized_v2.webp https://gamma.videonest.org/435396_video_v4_360.mp4 Recorded Live (1975) This animated short uses surreal humor and visual metaphor to depict a young man’s anxiety and powerlessness during a job interview at a television station. What begins as a typical application quickly turns strange as a massive, living mound of videotape springs to life. The tape creature chases the interviewee through hallways, entangles him in its coils, and ultimately absorbs him completely—an unsettling allegory for the overwhelming nature of media, technology, or corporate culture. LIMITED DISTRIBUTION. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 588 animationsurrealhorrorjob interviewvideotapecreature1970s filmshort filmexperimentalmedia allegory https://avgeeks.videonest.co/videos/435397/strawberry-shortcake-garden-house-playset-1980 https://img.videonest.org/gamma/435397_thumbnail_resized_v2.webp https://gamma.videonest.org/435397_video_v4_360.mp4 Strawberry Shortcake Garden House Playset (1980) The film features the Strawberry Shortcake Garden House, a playset that allows children to host a party for the Strawberry Shortcake character. It includes assembling the garden house and accessories like chairs and refreshments. The Strawberry Shortcake doll is sold separately, and the video concludes with a scene of the doll taking a nap after the party. Keywords Strawberry Shortcake, Garden House, playset, party, doll, Kenner, children’s toys 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 31 Strawberry ShortcakeGarden HouseplaysetpartydollKennerchildrens toys1980s toystoy review https://avgeeks.videonest.co/videos/435398/a-school-boat-1950s https://img.videonest.org/gamma/435398_thumbnail_resized_v2.webp https://gamma.videonest.org/435398_video_v4_360.mp4 A School Boat (1950s) A Best Western TV commercial and then.. In British Columbia, Canada, a unique transportation system using sea buses helps children from remote islands and coastal settlements attend school. The boats, crewed by Mrs. Len Wilkinson and her husband, cover a vast area and have significantly improved school attendance over the past eight years. Each day, 120 children commute via sea bus, navigating various weather conditions. The service costs $70 a day, but local residents view it as a valuable investment in education. The children, primarily from fishing and lumber families, follow strict safety rules while enjoying their journeys. Keywords British Columbia, sea buses, school transportation, education, remote communities, attendance, fishing, lumbering, safety rules Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 176 british columbiasea busschool boateducationremote communitiesschool transportationfishing villagelumberingcoastal settlements1950scanada https://avgeeks.videonest.co/videos/435399/skateboard-safety-1976 https://img.videonest.org/gamma/435399_thumbnail_resized_v2.webp https://gamma.videonest.org/435399_video_v4_360.mp4 Skateboard Safety (1976) This film emphasizes the excitement and expressiveness of skateboarding while highlighting the importance of safety measures to prevent injuries. It discusses necessary protective gear, proper equipment maintenance, and safe skating surfaces. The film also touches on the need for proper training and techniques for beginners and the benefits of safety programs in the community. It encourages young skaters to understand their limits and the importance of skating in safe environments. Keywords skateboarding, safety, protective gear, injuries, techniques, training, community, limits, freestyle, slalom 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 782 skateboardingsafetyprotective gearinjuriestechniquestrainingcommunityfreestyleslalomvintage film1970sextreme sports https://avgeeks.videonest.co/videos/435400/joan-avoids-a-cold-2nd-1964 https://img.videonest.org/gamma/435400_thumbnail_resized_v2.webp https://gamma.videonest.org/435400_video_v4_360.mp4 Joan Avoids A Cold (2nd, 1964) In this educational film, Joan, the fairy queen, learns how to avoid catching a cold while preparing for a school dance program. After getting sick, she follows the advice of her doctor, Dr. Green, to stay warm, wash her hands, and eat nutritious foods. Joan's family also takes precautions to prevent the spread of germs when her father gets sick. Ultimately, Joan successfully avoids a cold and is able to perform in the dance program, demonstrating the importance of health and hygiene. Keywords cold, germs, health, hygiene, education, children, family, prevention, doctor, dance program Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 612 cold preventiongermshealthhygienechildrenfamilydoctordance programeducational film1960s https://avgeeks.videonest.co/videos/435401/snuffys-fire-brigade-1977 https://img.videonest.org/gamma/435401_thumbnail_resized_v2.webp https://gamma.videonest.org/435401_video_v4_360.mp4 Snuffy's Fire Brigade (1977) "Snuffy's Fire Brigade" is an educational film aimed at teaching children about fire safety. The story follows Snuffy, a friendly fire truck, as he guides kids through various fire hazards in their homes, explaining the importance of recognizing "hot spots" that could cause fires. Through engaging songs and interactive lessons, Snuffy emphasizes key safety practices, including how to respond to a fire, the significance of smoke alarms, and the "stop, drop, and roll" technique for extinguishing flames. The film culminates in a fun parade celebrating fire safety awareness. Keywords fire safety, Snuffy, children's education, hot spots, fire hazards, stop drop and roll, smoke alarms, parade, interactive learning 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 810 fire safetychildreneducationSnuffyfire truckhazardssmoke alarmsstop drop rolllearningsafety tipskidsprevent fire https://avgeeks.videonest.co/videos/435402/tv-guide-tv-commercials-1970s https://img.videonest.org/gamma/435402_thumbnail_resized_v2.webp https://gamma.videonest.org/435402_video_v4_360.mp4 TV Guide TV Commercials (1970s) The latest issue of TV Guide covers a variety of topics, including the debate over television violence and its impact on society, the rise of smaller football players, and profiles of notable television personalities like Beverly Archer and Pat Harrington. It also discusses the influence of TV on social behavior, the responsibilities of scriptwriters, and the changing landscape of TV advertising. Additionally, it features reflections on Martin Luther King Jr. and a celebration of CBS's 50 years in news and entertainment. Keywords TV Guide, television violence, Beverly Archer, Pat Harrington, scriptwriters, advertising, Martin Luther King Jr., CBS, social behavior, football players Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 1089 TV Guidetelevision violenceBeverly ArcherPat HarringtonscriptwritersadvertisingMartin Luther King Jr.CBSsocial behaviorfootball players1970sTV commercialsvintage TV https://avgeeks.videonest.co/videos/435403/your-right-to-a-hearing-1972 https://img.videonest.org/gamma/435403_thumbnail_resized_v2.webp https://gamma.videonest.org/435403_video_v4_360.mp4 Your Right To A Hearing (1972) The film presents a courtroom scenario where a young man, Ernie Saltsburg, faces the repossession of his guitar and amplifier due to unpaid debts. He learns about his rights as a tenant and debtor, including the necessity for a court hearing before any property can be taken. The dialogue highlights the importance of communication with creditors and the legal protections available to individuals struggling with financial obligations. The film emphasizes the consequences of ignoring debts and the potential for resolution through legal avenues. Keywords courtroom, tenant rights, repossession, debts, guitar, legal advice, communication, financial obligations, hearing, youth 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 571 courtroomtenant rightsrepossessiondebtsguitarlegal advicedebtor rightsfinancial obligationshearingyouthlegal protection https://avgeeks.videonest.co/videos/435404/more-common-than-measle-and-mumps-1972 https://img.videonest.org/gamma/435404_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435404/more-common-than-measle-and-mumps-1972 More Common Than Measle and Mumps (1972) The film presents a humorous yet educational take on the topic of venereal disease (VD) through the interactions of two students tasked with a research project. They explore the history, symptoms, and treatment of VD, learning that it is primarily transmitted through sexual contact rather than common misconceptions like toilet seats. The film highlights the seriousness of VD, its increasing prevalence, and the importance of medical consultation for diagnosis and treatment. Keywords venereal disease, VD, syphilis, gonorrhea, sexual contact, symptoms, treatment, education, misconceptions, health LIMITED DISTRIBUTION. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 609 https://avgeeks.videonest.co/videos/435405/song-of-the-siren-1962 https://img.videonest.org/gamma/435405_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435405/song-of-the-siren-1962 Song of the Siren (1962) The film employs cartoon characters to critique communist propaganda regarding worker exploitation. It follows the character Manolin, who is misled by Lios but ultimately saved by Burrito. The central moral emphasizes the importance of not being deceived by appearances or swayed by misinformation and temptation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.299Z yes A/V Geeks 16mm Films no 489 https://avgeeks.videonest.co/videos/435406/hot-ones-tv-commercial-1981 https://img.videonest.org/gamma/435406_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435406/hot-ones-tv-commercial-1981 Hot Ones TV Commercial (1981) A vintage advertisement for Kenner's Fast Ones toy cars, showcasing the excitement of trading and collecting these miniature vehicles. Each car features unique plates representing all 50 states and comes with a cutout certificate of ownership, emphasizing their collectible nature. Keywords Kenner, Fast Ones, toy cars, advertisement, collectible, trading, miniature vehicles 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 32 https://avgeeks.videonest.co/videos/435407/basic-computer-terms-1976 https://img.videonest.org/gamma/435407_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435407/basic-computer-terms-1976 Basic Computer Terms (1976) The film features Harry, a business person overwhelmed by his back orders and unfamiliar with computers. Jane, a computer expert, explains basic computer concepts, including hardware, software, input, processing, memory, and output. She reassures Harry that computers are not to be feared, as they simply process information faster than humans. Through their conversation, Harry learns how to use a computer to manage his business more efficiently, ultimately leading to improvements in his work. Keywords computers, basic terms, hardware, software, input, output, processing, memory, programming, data, Jane, Harry, education, technology 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 945 https://avgeeks.videonest.co/videos/435408/school-vandalism-1972 https://img.videonest.org/gamma/435408_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435408/school-vandalism-1972 School Vandalism (1972) The film depicts a group of teens who engage in school vandalism and face the consequences of their actions. As they navigate their mischievous plans, tensions rise when the police become involved, and they confront the reality of their poor decisions. The narrative highlights themes of peer pressure, parental responsibility, and the struggles of adolescence, particularly in relation to academic performance and personal accountability. Keywords teens, school vandalism, peer pressure, consequences, adolescence, parental responsibility, academic struggles 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 561 https://avgeeks.videonest.co/videos/435409/glamour-gals-beauty-salon-tv-ad-1982 https://img.videonest.org/gamma/435409_thumbnail_resized_v2.webp https://gamma.videonest.org/435409_video_v3.mp4 Glamour Gals Beauty Salon TV Ad (1982) The film features a playful setting at The Glamour Gal's beauty salon, where viewers can engage in pretend hair styling with characters Shara and Danny. The salon includes interactive elements like swivel chairs and a water sink for washing hair, encouraging imaginative play. Each character is sold separately, emphasizing the fun of creating different hairstyles. Keywords Glamour Gal, beauty salon, pretend play, hair styling, dolls, interactive toys, imaginative play 2025-05-09T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Glamour Galsbeauty salonpretend playhair stylingdollsinteractive toysimaginative playKenner1980svintage commercialSharaDanny https://avgeeks.videonest.co/videos/435410/vd-questions-and-vd-answers-1972 https://img.videonest.org/gamma/435410_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435410/vd-questions-and-vd-answers-1972 VD Questions and VD Answers (1972) Animated by Ralph McQuarrie (artist for Star Wars) The film "VD Questions and VD Answers" addresses the epidemic of venereal diseases (VD), specifically gonorrhea and syphilis, emphasizing the importance of awareness, prevention, and treatment. It dispels common myths about how these diseases are transmitted and highlights the serious consequences of untreated infections. The film urges individuals to seek medical help promptly if they suspect they have VD, as both diseases can be easily cured but can lead to severe health complications if left untreated. It also stresses that anyone can be affected, regardless of their background, and encourages open communication about sexual health. Keywords venereal diseases, gonorrhea, syphilis, epidemic, treatment, prevention, sexual health, myths, awareness Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 881 https://avgeeks.videonest.co/videos/435411/skateboarding-to-safety-1976 https://img.videonest.org/gamma/435411_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435411/skateboarding-to-safety-1976 Skateboarding To Safety (1976) The film discusses the growing popularity of skateboarding in America, emphasizing the skills, challenges, and dangers associated with the sport. It highlights the importance of safety precautions, such as choosing safe locations, wearing protective gear, and practicing proper falling techniques. The film advises skaters to be aware of their surroundings, understand local laws, and skate within their abilities to avoid serious injuries. Keywords skateboarding, safety, injuries, protective gear, common sense, local laws, practice, hazards, skills Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 592 https://avgeeks.videonest.co/videos/435413/best-western-hotel-tv-ads-1970s https://img.videonest.org/gamma/435413_thumbnail_resized_v2.webp https://gamma.videonest.org/435413_video_v4_360.mp4 Best Western Hotel TV Ads (1970s) This film features a promotional jingle for Best Western hotels, emphasizing their reputation for quality service and hospitality. The repetitive lyrics highlight the brand's commitment to ensuring guests have a pleasant experience. Keywords Best Western, hotel, hospitality, service, jingle, promotion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 105 Best Westernhotelhospitalityjingle1970svintage advertisementtravel https://avgeeks.videonest.co/videos/435414/thats-stealing-1985 https://img.videonest.org/gamma/435414_thumbnail_resized_v2.webp https://gamma.videonest.org/435414_video_v4_360.mp4 That's Stealing (1985) The film follows two friends, Kathy and Heather, as they navigate the complexities of trust and stealing. Kathy reflects on their friendship after Heather begins taking items that don't belong to her, leading to a breakdown in their trust. As Kathy grapples with the implications of Heather's actions, she struggles with whether to confront her friend or distance herself. Ultimately, the story emphasizes the importance of trust in friendships and the consequences of stealing, no matter how small the item. Keywords friendship, trust, stealing, consequences, honesty, moral lessons, childhood, peer pressure 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 977 https://avgeeks.videonest.co/videos/435415/change-the-music-1962 https://img.videonest.org/gamma/435415_thumbnail_resized_v2.webp https://gamma.videonest.org/435415_video_v4_360.mp4 Change the Music (1962) Animated vaudeville show that serves as a satire on the shifting policies of various national communist parties as they attempt to align with the international party line. It highlights how, as the orchestra changes the music, the performers are compelled to alter their actions to conform to these new directives, illustrating the pressure to adapt to changing political demands. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 360 animationvaudevillesatirecommunismpolitical cartoon16mm filmcommunist party https://avgeeks.videonest.co/videos/435416/crimes-in-progress-patrol-procedures-1973 https://img.videonest.org/gamma/435416_thumbnail_resized_v2.webp https://gamma.videonest.org/435416_video_v4_360.mp4 Crimes In Progress - Patrol Procedures (1973) Explores the complexities and procedures of law enforcement during various crimes in progress. It emphasizes the importance of communication, coordination, and adherence to protocols to ensure officer safety and effective crime management. The narrative reveals the tension between officers and criminals, highlighting the unpredictable nature of urban crime and the ethical responsibilities of police officers. The film aims to illustrate the challenges law enforcement faces while maintaining public trust and safeguarding lives. Keywords law enforcement, crime in progress, police procedures, communication, coordination, urban crime, officer safety, ethical responsibilities, crime management, emergency response 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 1433 Law enforcementPolice proceduresCrime in progressOfficer safetyUrban crimeCoordinationCommunicationEmergency responseCrime managementEthical responsibilities https://avgeeks.videonest.co/videos/435417/empire-strikes-back-toys-1980s https://img.videonest.org/gamma/435417_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435417/empire-strikes-back-toys-1980s Empire Strikes Back Toys (1980s) A promotional advertisement for new action figures from the Star Wars: The Empire Strikes Back collection by Kenner. It highlights the Tonton and Wampa figures, showcasing their features and the excitement of playtime with these toys. Keywords Star Wars, action figures, Kenner, Tonton, Wampa, The Empire Strikes Back, toys, advertisement 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 31 https://avgeeks.videonest.co/videos/435418/communicable-diseases-they-just-go-around-1972 https://img.videonest.org/gamma/435418_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435418/communicable-diseases-they-just-go-around-1972 Communicable Diseases - They Just Go Around (1972) This educational film discusses communicable diseases, explaining how they can be transmitted between individuals and affect communities. It covers historical impacts of diseases like the plague and polio, as well as modern diseases such as tuberculosis and mononucleosis. The film emphasizes the importance of hygiene, vaccination, and understanding how infections spread through inhalation, ingestion, and cuts. It encourages viewers to maintain good health practices and seek medical advice when necessary to prevent the spread of diseases. Keywords communicable diseases, infection, hygiene, vaccination, tuberculosis, polio, historical diseases, health practices, pathogens, resistance 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 927 https://avgeeks.videonest.co/videos/435419/steadfast-tin-soldier-1955 https://img.videonest.org/gamma/435419_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435419/steadfast-tin-soldier-1955 Steadfast Tin Soldier (1955) The story follows a steadfast tin soldier who, despite being the only one-legged soldier among twenty-five, falls in love with a beautiful dancer. After a series of adventures, including a dramatic fall from a window and a journey through a gutter, he finds himself back in the same room. Keywords tin soldier, dancer, love, adventure, fate, melting, sacrifice, toys, fairy tale Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 764 https://avgeeks.videonest.co/videos/435420/ancient-greece-rev https://img.videonest.org/gamma/435420_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435420/ancient-greece-rev Ancient Greece (Rev) The film explores the legacy of ancient Greece, highlighting its cultural, political, and artistic achievements. It discusses the importance of city-states like Athens, the development of philosophy and science, and the significance of athletic competitions, particularly the Olympics. The film also emphasizes the role of public architecture, such as the Parthenon, and the contributions of notable figures like Plato and Aristotle to Western civilization. Overall, it illustrates how ancient Greece set the foundation for many aspects of modern society. Keywords Ancient Greece, city-states, Athens, philosophy, science, Olympics, Parthenon, Plato, Aristotle, Western civilization, culture, art, athletics, history. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 568 https://avgeeks.videonest.co/videos/435421/body-defenses-against-disease-1978 https://img.videonest.org/gamma/435421_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435421/body-defenses-against-disease-1978 Body Defenses Against Disease (1978) The film explores the life of David, who must live in a sterile environment due to his lack of immunity against germs. It explains how the human body naturally develops defenses against diseases, including barriers like mucus and skin, as well as the roles of blood, phagocytes, and lymphocytes in fighting infections. The film also highlights the importance of antibodies in identifying and destroying specific germs. Through animations and microscopy, it illustrates how our bodies combat various germs encountered in daily life. Keywords David, sterile room, immunity, germs, bacteria, viruses, body defenses, mucus, skin, phagocytes, lymphocytes, antibodies, infection, disease LIMITED DISTRIBUTION. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 498 https://avgeeks.videonest.co/videos/435422/our-countrys-emblem-1956 https://img.videonest.org/gamma/435422_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435422/our-countrys-emblem-1956 Our Country's Emblem (1956) Discusses the significance of the Great Seal of the United States, explaining its history and the meanings behind its symbols. The Great Seal, established in 1782, represents the country and its values, featuring the American Eagle, which symbolizes freedom, and a shield that reflects the original 13 colonies. The eagle holds arrows and an olive branch, representing defense and peace, respectively. The reverse side of the seal features a pyramid and an eye, symbolizing strength and divine guidance. The film emphasizes that the Great Seal is an important emblem of national identity, alongside the flag and the national anthem. Keywords Great Seal, United States, American Eagle, national emblem, history, symbols, freedom, peace, strength, divine guidance, 13 colonies Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 589 https://avgeeks.videonest.co/videos/435423/making-a-decision-ischoosing-1974 https://img.videonest.org/gamma/435423_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435423/making-a-decision-ischoosing-1974 Making a Decision Is...Choosing (1974) The film discusses the process of decision-making, emphasizing that everyone makes choices daily, from simple to life-altering. It outlines a structured approach to making effective decisions: first, identify what you want the outcome to be; second, gather relevant information and consider options; and third, evaluate the risks and chances for success. The film highlights that decision-making is a skill that can be learned and practiced, and ultimately, it asserts that personal values and individual circumstances play a crucial role in making the best choices. Keywords decision-making, choices, outcomes, options, risks, personal values, skill development, effective decisions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 1088 https://avgeeks.videonest.co/videos/435424/price-of-survival-1967 https://img.videonest.org/gamma/435424_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435424/price-of-survival-1967 Price Of Survival (1967) "Price of Survival" documents the aftermath of a devastating tornado and a chemical plant explosion, highlighting the chaos and urgency faced by emergency responders and medical personnel. The film showcases the efforts of rescue teams, hospital staff, and civil defense units as they work tirelessly to treat casualties, manage resources, and coordinate disaster response. It emphasizes the importance of preparedness and the lessons learned from the disaster, ultimately stressing the need for improved emergency services and community cooperation in future crises. Keywords tornado, disaster response, emergency services, casualties, rescue teams, hospital, preparedness, chemical explosion, community, medical personnel Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 1711 https://avgeeks.videonest.co/videos/435425/your-job-getting-ahead-1969 https://img.videonest.org/gamma/435425_thumbnail_resized_v2.webp https://gamma.videonest.org/435425_video_v4_360.mp4 Your Job: Getting Ahead (1969) "Your Job: Getting Ahead" is a 1968 educational film produced by Coronet. This 16-minute documentary provides career advice through interviews with experienced workers, offering practical tips on workplace success. The film follows a young newspaperman as he applies these strategies to advance in his career. Topics covered include identifying dead-end jobs, knowing when and how to change jobs, selecting fields with growth potential, and planning for further education to enhance career prospects. Aimed at young professionals and job seekers, the film serves as a guide to making informed career decisions and achieving long-term success in the workforce. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 907 careerjobemploymentcareer advicejob search1960seducational filmworkplacejob marketcareer planningjob skills https://avgeeks.videonest.co/videos/435426/fha-public-service-films-muppets-first-series-1963 https://img.videonest.org/gamma/435426_thumbnail_resized_v2.webp https://gamma.videonest.org/435426_video_v4_360.mp4 FHA PUBLIC SERVICE FILMS - MUPPETS - FIRST SERIES (1963) Jim Henson's Muppets - including Kermit! This PSA presents a conversation about the challenges of financing a new home. It highlights the fears of a person worried about financial commitments and introduces a free guide from the Federal Housing Administration (FHA) that provides advice on affordable home financing. Keywords home financing, FHA guide, financial fears, affordable payments, Federal Housing Administration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 87 FHAhome financingMuppetsPSA1963real estateFederal Housing Administration https://avgeeks.videonest.co/videos/435427/the-civil-war-post-war-years-revised-1983 https://img.videonest.org/gamma/435427_thumbnail_resized_v2.webp https://gamma.videonest.org/435427_video_v4_360.mp4 The Civil War: Post-War Years (revised, 1983) The film explores the tumultuous period following the Civil War, focusing on the challenges of reconstruction in the South. It highlights President Abraham Lincoln's vision for a unified nation, which was shattered by his assassination and the subsequent presidency of Andrew Johnson. The film details the struggles faced by returning Southern soldiers, the plight of freedmen, and the establishment of the Freedmen's Bureau to assist those in need. It addresses the political conflicts between Congress and President Johnson, the rise of radical Republicans advocating for civil rights, and the eventual implementation of the 14th and 15th amendments. The narrative culminates in the eventual failure of radical reconstruction efforts, leading to the resurgence of conservative power in the South and the disenfranchisement of African Americans. Keywords Civil War, Reconstruction, Abraham Lincoln, Andrew Johnson, Freedmen's Bureau, Radical Republicans, Civil Rights, 13th Amendment, 14th Amendment, 15th Amendment, Southern Economy, Black Codes, Ku Klux Klan, Sharecropping Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 1248 Civil WarReconstructionAbraham LincolnFreedmen's BureauCivil Rights14th AmendmentAndrew JohnsonBlack CodesKu Klux KlanSharecropping https://avgeeks.videonest.co/videos/435428/people-in-the-headlines-albert-schweitzer-etc-1950s https://img.videonest.org/gamma/435428_thumbnail_resized_v2.webp https://gamma.videonest.org/435428_video_v4_360.mp4 People In the Headlines - Albert Schweitzer, etc. (1950s) The film highlights significant moments in history, focusing on Dr. Albert Schweitzer, a medical missionary honored by Cambridge University for his humanitarian work in Africa. It showcases the reopening of the Vienna State Opera after WWII, attended by notable figures including Secretary of State Dulles. The film also features Major General William Dean, a Korean War hero, receiving accolades after his release from captivity. Additionally, it captures Queen Juliana of the Netherlands touring Dutch colonies in South America, engaging with local natives and participating in their cultural festivities. Keywords Albert Schweitzer, Vienna State Opera, WWII, Major General William Dean, Korean War, Queen Juliana, Dutch colonies, cultural festivities Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 182 Albert SchweitzerVienna State OperaWilliam DeanQueen JulianaDutch coloniesSouth AmericaKorean WarMedical MissionaryCambridge University https://avgeeks.videonest.co/videos/435429/northwest-schools-heavy-equipment-operator-1970s https://img.videonest.org/gamma/435429_thumbnail_resized_v2.webp https://gamma.videonest.org/435429_video_v4_360.mp4 [Northwest Schools - Heavy Equipment Operator, 1970s] A TV commercial for the training for heavy equipment operation, highlighting it as a lucrative skilled trade. It emphasizes that Northwest Schools offers flexible training options that do not interfere with current jobs or education, encouraging viewers to request a free brochure for more information. Keywords heavy equipment, skilled trades, training, Northwest Schools, career, education, flexible options Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 28 heavy equipmentskilled tradestrainingNorthwest Schoolscareereducation1970s https://avgeeks.videonest.co/videos/435430/hojas-revival-1950s https://img.videonest.org/gamma/435430_thumbnail_resized_v2.webp https://gamma.videonest.org/435430_video_v4_360.mp4 Hoja's Revival (1950s) The film depicts a peaceful town disrupted by a riot sparked by public discontent with the government. A character named Hamid, amidst the chaos, recalls a story about Nasr-ed-din Hoja, who was falsely convinced of his impending death due to the malicious gossip of envious villagers. The story serves as a metaphor for the dangers of believing in negative narratives, emphasizing that such agitation can undermine the stability of society. Ultimately, Hoja's realization that he is not dying mirrors the need for people to recognize and resist misleading influences about their government. Keywords peace, riot, government, Nasr-ed-din Hoja, gossip, societal stability, negative narratives, public discontent Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 590 peaceriotgovernmentNasr-ed-din Hojagossipsocietal stabilitynegative narrativespublic discontent1950s filmUSISMarionettes https://avgeeks.videonest.co/videos/435431/san-gorgio-whole-egg-noodles https://img.videonest.org/gamma/435431_thumbnail_resized_v2.webp https://gamma.videonest.org/435431_video_v4_360.mp4 [San Gorgio Whole Egg Noodles] The film highlights San Gorgio's whole egg noodles, emphasizing their high-quality ingredients made exclusively from certified Grade A eggs sourced from Spread Eagle Farms in Pennsylvania. It showcases the unique shapes of the noodles, such as fettuccini and bow ties, and promotes the freshness and superior quality of the product, underscoring its distinction in the market. Keywords San Gorgio, egg noodles, Grade A eggs, Spread Eagle Farms, quality, freshness, Pennsylvania, fettuccini, bow ties Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 189 San Giorgioegg noodlesGrade A eggsSpread Eagle Farmspastafettuccinibow ties https://avgeeks.videonest.co/videos/435432/chemistry-chemical-bonding-and-atomic-structure-1983 https://img.videonest.org/gamma/435432_thumbnail_resized_v2.webp https://gamma.videonest.org/435432_video_v4_360.mp4 Chemistry: Chemical Bonding And Atomic Structure (1983) This film explains the fundamental concepts of chemical bonding and atomic structure, focusing on the different types of bonds—metallic, ionic, and covalent. It discusses how atoms are held together by chemical bonds, the properties of metals and salts, and the behavior of molecules. The film illustrates how various bonds determine the characteristics of substances, such as conductivity, malleability, and brittleness. It also covers the significance of valence electrons and the octet rule in forming stable compounds, especially in organic chemistry. Keywords chemical bonding, atomic structure, metallic bonds, ionic bonds, covalent bonds, valence electrons, octet rule, properties of metals, properties of salts, molecular compounds Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T10:19:59.300Z yes A/V Geeks 16mm Films no 1443 chemical bondingatomic structureionic bondscovalent bondsmetallic bondsvalence electronsoctet rule https://avgeeks.videonest.co/videos/435433/av-geeks-lunch-5-9-2025 https://img.videonest.org/gamma/435433_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435433/av-geeks-lunch-5-9-2025 AV Geeks Lunch 5-9-2025 A fellow who bounced on a rail Watched train films with popcorn and ale. He’d cheer and he’d shout, “Now *that’s* a great route!” Then leaned out and waved at a snail. Fred McLeod's Album Of Steam Locomotives In Action: Baltimore And Ohio The Railroad Station The Passenger Train Railroad Engineer Troop Train 2025-05-12T10:19:59.417Z yes A/V Geeks 16mm Films no 3109 https://avgeeks.videonest.co/videos/435434/av-geeks-16mm-lunch-5-6-2025 https://img.videonest.org/gamma/435434_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435434/av-geeks-16mm-lunch-5-6-2025 AV Geeks 16mm Lunch 5-6-2025 Oops, we missed Cinco de Mayo. Let's watch five films about Mexico (plus one). #16mmfilms #avgeeks Mexico by Motor (excerpt) People of Mexico Mexican Moods Mexican Children Mexico: Land and the People Cambio De Musica, Maestro! 2025-05-12T10:19:59.417Z yes A/V Geeks 16mm Films no 4160 https://avgeeks.videonest.co/videos/435435/av-geeks-16mm-lunch-5-2-2025 https://img.videonest.org/gamma/435435_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/435435/av-geeks-16mm-lunch-5-2-2025 AV Geeks 16mm Lunch 5-2-2025 May Two! Electric Boogaloo! #16mmfilms #avgeeks Urban Life in New York City On Every Hand Profile: Joan Ganz Cooney The Great Rights American Summer 2025-05-12T10:19:59.417Z yes A/V Geeks 16mm Films no 4578 https://avgeeks.videonest.co/videos/439306/all-my-tomorrows-1979 https://img.videonest.org/gamma/439306_thumbnail_resized_v2.webp https://gamma.videonest.org/439306_video_v3.mp4 All My Tomorrows (1979) The film follows the story of Peggy, a young girl who feels trapped in her mundane life and seeks excitement through partying and experimenting with drugs. After a night of drinking and taking pills with her friends, Peggy suffers an overdose that leaves her in a coma, leading to devastating consequences for her and her family. As she lies in the hospital, Peggy reflects on her choices, the love of her mother, and the guilt of those around her, realizing the heavy price of her pursuit of fun. Keywords overdose, drugs, partying, family, consequences, reflection, youth, tragedy, addiction, hospital 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 996 overdosedrugsdrug abusesubstance abuseaddictionalcoholismhospitalmedical emergencypatientfamilyconsequences1970sAll My Tomorrowsmental healthrehabilitation https://avgeeks.videonest.co/videos/439307/indiana-jones-action-figures-commercial-1982 https://img.videonest.org/gamma/439307_thumbnail_resized_v2.webp https://gamma.videonest.org/439307_video_v3.mp4 Indiana Jones Action Figures Commercial (1982) A promotional advertisement for action figures from the "Raiders of the Lost Ark" collection, highlighting Indiana Jones, Toht and Cairo Swordsman toys. It showcases their features and interactions, emphasizing the excitement of play with these collectibles. Keywords Indiana Jones, action figures, Raiders of the Lost Ark, Kenner, toys, advertisement 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Indiana JonesRaiders of the Lost Arkaction figuresKenner toys1980s toysCairo SwordsmanTohtvintage commercialtoy advertisementcollectibles https://avgeeks.videonest.co/videos/439308/magic-rolling-board-1976 https://img.videonest.org/gamma/439308_thumbnail_resized_v2.webp https://gamma.videonest.org/439308_video_v3.mp4 Magic Rolling Board (1976) The film showcases the "Magic Rolling Board," a wheeled board that transforms into a magical vehicle for creative play. It highlights the imaginative use of the board by children and adults, including professional skaters and racers who demonstrate their skills and push the limits of speed and creativity. The film features champions like Ed Meline and Guy Grundy, who excel in freestyle skating and downhill racing, respectively, emphasizing the board's versatility and recreational opportunities. Keywords Magic Rolling Board, creativity, play, Ed Meline, Guy Grundy, freestyle skating, downhill racing, speed, imagination, recreation LIMITED DISTRIBUTION. 2025-05-12T00:00:00.000Z yes A/V Geeks 16mm Films no 816 Magic Rolling BoardskateboardingEd MelineGuy Grundyfreestyle skatingdownhill racing1970sskatersskating stylesskate tricksold-school skatingskateboard velocitydownhill racerextreme sportsskate competition https://avgeeks.videonest.co/videos/439309/look-whats-going-around-1973 https://img.videonest.org/gamma/439309_thumbnail_resized_v2.webp https://gamma.videonest.org/439309_video_v3.mp4 Look What's Going Around (1973) The film discusses the stigma surrounding venereal diseases (VD) and emphasizes the importance of treatment and awareness. It features personal accounts of individuals who contracted gonorrhea, highlighting the challenges of recognizing symptoms, the rapid spread of the disease, and the necessity of informing sexual partners. The medical staff's role in providing treatment and education is underscored, alongside preventive measures such as condom use. The narrative aims to reduce embarrassment and encourage individuals to seek help, stressing that VD is treatable and preventable. Keywords venereal disease, gonorrhea, treatment, stigma, awareness, symptoms, prevention, sexual health, condom use, education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-12T00:00:00.000Z yes A/V Geeks 16mm Films no 951 Venereal diseaseGonorrheaTreatmentStigmaAwarenessSymptomsPreventionSexual HealthCondom useEducationSexual contactEarly detectionPublic healthSafe sexContact tracing https://avgeeks.videonest.co/videos/439310/lets-find-something-better-to-do-1983 https://img.videonest.org/gamma/439310_thumbnail_resized_v2.webp https://gamma.videonest.org/439310_video_v3.mp4 Let's Find Something Better To Do (1983) The film "Let's Find Something Better To Do" features Howard Krunkerk, a reporter who explores the concept of vandalism through the perspective of children. It defines vandalism as the destruction or defacement of property, emphasizing its negative impacts on communities and the emotional harm it causes to others. The film encourages kids to find positive activities instead of engaging in vandalism, highlighting the importance of respect for others' belongings and the environment. Keywords vandalism, children, community, respect, property, negative impacts, positive activities, Howard Krunkerk, CK News 2025-05-12T00:00:00.000Z yes A/V Geeks 16mm Films no 570 vandalismchildrencommunityrespectpropertynegative impactspositive activitiesHoward KrunkerkCK NewsCKID Newskids newskidsinterviewjuvenileBeacon Films https://avgeeks.videonest.co/videos/439311/av-geeks-16mm-lunch-5-12-2025 https://img.videonest.org/gamma/439311_thumbnail_resized_v2.webp https://gamma.videonest.org/439311_video_v3.mp4 AV Geeks 16mm Lunch 5-12-2025 You want rain? We got rain here at A/V Geeks.. and 16mm films! #16mmfilms #avgeeks Helping Mother And the Family Babies Wanted (outtakes from March of Time) Mother Cat and her Baby Skunks Drugs, Smoking and Alcohol During Pregancy Teenage Pregnancy Mother Goose Stories 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 4533 16mm filmA/V Geekseducational filmfamilypregnancyMother Goosevintage filmfamily valuesparentingbabymotherhoodchildrenbaby caredrugssmoking https://avgeeks.videonest.co/videos/440754/the-lost-treasure-1950s https://img.videonest.org/gamma/UnL2n1ji8s0_thumbnail_resized_v2.webp https://gamma.videonest.org/UnL2n1ji8s0_video_v3_360.mp4 The Lost Treasure (1950s) The film revolves around a conversation in a local coffee house where an elderly man shares a story about Nasr-ed-din Hoja. The tale illustrates the importance of hard work and cherishing one's heritage through the experiences of two sons who, tempted to sell their family farm for a quick profit, ultimately discover that their true treasure lies in the labor and love they invest in their land. The narrative emphasizes the wisdom of valuing what one has and finding happiness in one's own life rather than chasing radical promises. Keywords Nasr-ed-din Hoja, coffee house, heritage, treasure, hard work, wisdom, family, happiness, radical ideas, storytelling Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 695 Nasr-ed-din Hojaheritagetreasurehard workwisdomfamilyhappinessstorytellingparablemoral lesson https://avgeeks.videonest.co/videos/440771/av-geeks-16mm-lunch-5-13-2025 https://img.videonest.org/gamma/440771_thumbnail_resized_v2.webp https://gamma.videonest.org/440771_video_v5_360.mp4 AV Geeks 16mm Lunch 5-13-2025 We’ve got reels of feels! #avgeeks #16mmfilm #avgeeks #16mmfilms 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 4584 16mm filmvintage filmeducational filmAppleby Horse Fairgypsy cultureUC Davisagricultural schoolmask makingcrimeMr. Bigjailfilm projectornight drivingFamily Filmshorse trading https://avgeeks.videonest.co/videos/440805/amerikas-tweede-ruimtevaarder-dutch-1961 https://img.videonest.org/gamma/OW0om-Mmzjg_thumbnail_resized_v2.webp https://gamma.videonest.org/OW0om-Mmzjg_video_v3_360.mp4 Amerika's Tweede Ruimtevaarder (Dutch, 1961) The film chronicles the launch of the Mercury Redstone rocket from Cape Canaveral on July 21, 1961, which carries astronaut Virgil Ivan Grissom into space. Grissom, a former jet pilot, undergoes rigorous training and prepares for the mission in a specially designed capsule named Liberty Bell 7. The launch is successful, reaching a peak altitude of 190 km and a speed of 8400 km/h. After a brief period of weightlessness, Grissom safely separates from the rocket and pilots the capsule. However, the landing in the Atlantic Ocean is complicated by a window breaking, causing water to enter the capsule. Grissom is eventually rescued by a helicopter, humorously requesting a tissue upon his retrieval. Despite the capsule's loss, valuable data from the mission is preserved. Keywords Mercury Redstone, Virgil Grissom, space launch, Cape Canaveral, astronaut, Liberty Bell 7, weightlessness, rescue, data recovery, 1961 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 403 Gus GrissomMercury Redstonespace launchCape CanaveralastronautLiberty Bell 7weightlessnessspace mission1961space explorationrocket launch https://avgeeks.videonest.co/videos/440809/fast-ones-racers-tv-commercial-1982 https://img.videonest.org/gamma/yYUoeltaZmM_thumbnail_resized_v2.webp https://gamma.videonest.org/yYUoeltaZmM_video_v3_360.mp4 Fast Ones Racers TV Commercial (1982) The commercial features a collection of toy race cars called "Fast Ones Racers," showcasing models from various states in the U.S., including Florida, Georgia, and New York. It highlights the appeal of both racing and collecting these unique toys, which are sold separately by Kenner. Keywords Fast Ones Racers, toy cars, collecting, racing, Kenner, Florida, Georgia, New York 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Fast Ones Racerstoy carsKenner1980svintage toyscollectingracing https://avgeeks.videonest.co/videos/440815/ro-revus-talks-about-worms-1970 https://img.videonest.org/gamma/CZRlxnHZUTA_thumbnail_resized_v2.webp https://gamma.videonest.org/CZRlxnHZUTA_video_v3_360.mp4 Ro-Revus Talks About Worms (1970) In this educational film, RoRevus discusses worms and their potential health risks, particularly how they can infect pets and humans. The dialogue emphasizes the importance of hygiene, such as using a toilet instead of the outdoors and washing hands before eating to prevent worm infections. RoRevus explains how worms can grow inside the body and consume nutrients, making individuals feel sick. The film aims to teach children about good health habits to avoid getting worms. Keywords worms, health education, hygiene, children, infections, RoRevus, nutrition, prevention 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 391 wormshealth educationhygienechildreninfectionsRoRevuspreventionpetshumansnutritionsickgerms https://avgeeks.videonest.co/videos/440827/a-rough-sketch-for-a-proposed-film-dealing-with-the-powers-of-ten-1968 https://img.videonest.org/gamma/RkjraM-Mvog_thumbnail_resized_v2.webp https://gamma.videonest.org/RkjraM-Mvog_video_v3_360.mp4 A rough sketch for a proposed film dealing with the powers of ten.. (1968) Full title "A rough sketch for a proposed film dealing with the powers of ten and the relative size of things in the universe" This film is precedes the Eames film "Powers of Ten". A visual journey that explores the vastness of the universe by zooming out from a picnic scene to the cosmic scale and then zooming back in to the microscopic level of a carbon atom. The film demonstrates the exponential growth of distance and time as it moves through various scales, illustrating the relationship between the Earth, the solar system, and the universe, ultimately highlighting the insignificance of Earth in the grand scheme of things. Keywords Powers of Ten, universe, scale, picnic, cosmic, microscopic, carbon atom, exponential growth, Earth, solar system, Milky Way Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 466 Powers of TenUniverseScaleCosmicMicroscopicExponential growthEarthSolar systemMilky WayCarbon atom https://avgeeks.videonest.co/videos/440833/glamour-gals-ocean-queen-cruise-ship-commercial-1982 https://img.videonest.org/gamma/8vw4-CDY92E_thumbnail_resized_v2.webp https://gamma.videonest.org/8vw4-CDY92E_video_v3.mp4 Glamour Gals Ocean Queen Cruise Ship Commercial (1982) The commercial features the Glamour's Ocean Queen Cruise Ship toy, highlighting its three decks, movable furniture, and working elevator. It showcases the play possibilities with characters Shara and Aaron, emphasizing the need for assembly and that dolls are sold separately. Keywords Glamour's Ocean Queen, Cruise Ship, Kenner, toy, dolls, assembly, movable furniture, elevator 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Glamour GalsOcean QueenKennerCruise Ship ToyDoll Playset1980s ToysRetro CommercialVintage ToysPlayingToy Commercial https://avgeeks.videonest.co/videos/445649/drug-effects-1969 https://img.videonest.org/gamma/T2Abf1DCRZ0_thumbnail_resized_v2.webp https://gamma.videonest.org/T2Abf1DCRZ0_video_v3.mp4 Drug Effects (1969) Cartoon cavemen teach us the effects of drugs, focusing on how they are consumed, their behavioral changes, and the types of dependence they create. Specifically, it highlights marijuana, noting its method of intake, its stimulating and depressing effects, and the variability of individual reactions, including mild hallucinations. The narrative emphasizes the importance of understanding these factors for decision-makers addressing drug-related issues and outlines the need for comprehensive data on various drugs for accurate assessments. Keywords drugs, effects, marijuana, behavior, dependence, hallucinations, decision-makers, drug disaster 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 195 Drug Effects ReviewMarijuanaAddictionAnimated Cartoon1960s PSALockheed AircraftDrug EducationHallucinationsDrug DependenceVintage AnimationBehavioral Effects https://avgeeks.videonest.co/videos/445689/pig-iron-and-steel-silent-1930s https://img.videonest.org/gamma/1ZRYbe1AuTg_thumbnail_resized_v2.webp https://gamma.videonest.org/1ZRYbe1AuTg_video_v3.mp4 Pig Iron And Steel (silent, 1930s) This silent, visually rich 1930s industrial montage chronicles the process of steel production, from raw ore to finished metal products, capturing both the mechanical precision and human labor involved. It begins with raw metal ore and train cars arriving at a steel mill, followed by molten metal being poured, stirred, and cast by skilled workers in intense, glowing factory interiors. Large vats bubble and brim with liquid steel, while cranes and mechanical arms methodically shape, transport, and cool steel bars. The footage also briefly shifts to a medical exam—possibly reflecting workplace safety—before returning to the relentless rhythm of machines flattening, shaping, and cutting steel into usable forms. The sequence closes with cranes loading finished bars into railcars, ready for distribution, underscoring the scale and complexity of early 20th-century American industry. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-14T00:00:00.000Z yes A/V Geeks 16mm Films no 659 Steel productionSteel millSteel manufacturingSteel castingSteel ingotsSteel bloomSteel billetRail manufacturingHot rollingIndustrial processIndustrial machineryMetallurgyMetalworkingArchival footageVintage industry https://avgeeks.videonest.co/videos/445714/star-wars-micro-collection-line-commercial-1982 https://img.videonest.org/gamma/FinUsJ-rKPk_thumbnail_resized_v2.webp https://gamma.videonest.org/FinUsJ-rKPk_video_v3.mp4 Star Wars Micro Collection Line Commercial (1982) A promotional advertisement for the Star Wars Micro Collection Line by Kenner, featuring various playsets such as Death Star World, Hoth World, and Vasperin World, along with diecast figures of rebel soldiers and stormtroopers. The ad highlights a special offer where customers can receive free figures with the purchase of playsets or vehicles, with details available on specially marked packages. The promotion was valid until January 31, 1983. Keywords Star Wars, Micro Collection, Kenner, playsets, Death Star, Hoth, Vasperin, diecast figures, promotion, advertisement 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Star WarsKenner ToysMicro CollectionHoth WorldVintage ToysToy Commercial1980s CommercialAction FiguresCollectiblesStar Wars PlaysetsDie-cast FiguresRebel SoldiersStormtroopersLucasfilmToy Promotion https://avgeeks.videonest.co/videos/445754/from-here-to-there-1970 https://img.videonest.org/gamma/445754_thumbnail_resized_v2.webp https://gamma.videonest.org/445754_video_v3.mp4 From Here To There (1970) **From Here to There** (1964, Saul Bass for United Air Lines) is a poetic and visually stylized short film that captures the emotional and sensory experience of jet travel during the golden age of commercial aviation. Produced by Saul Bass & Associates for United Air Lines, the nine-minute color film follows a single flight from Los Angeles to the East Coast, using striking imagery to convey the anticipation of departure, the solitude of the journey, and the emotional highs and lows of reunions and farewells. More than a technical explanation of air travel, the film highlights the personal moments and human drama that unfold at 30,000 feet and on the ground. 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 520 airplane landingUnited Airlinesairport arrivalfamily reunionStatue of Libertyaerial footagetrain stationcouples kissingmountain viewairport infrastructure https://avgeeks.videonest.co/videos/445755/ethics-in-the-computer-age-1984 https://img.videonest.org/gamma/445755_thumbnail_resized_v2.webp https://gamma.videonest.org/445755_video_v3.mp4 Ethics In The Computer Age (1984) This dramatized educational film explores the ethical dilemmas surrounding computer use during the early rise of personal computing. It follows two teenage programmers who create a video game called *Oil's Well* and license it to a software company, only to discover it's being illegally copied and sold by pirates. Their excitement turns to dismay as they witness the financial and moral impact of software piracy firsthand. The second half of the film shifts focus to a high school student using a computer to complete a report on Oliver Wendell Holmes. With the help of a tech-savvy friend, he accesses protected databases through a hacker network, justifying it as a harmless game. However, his unauthorized access to a hospital databank causes a system malfunction during a medical emergency, endangering a patient's life. Through these narratives, the film highlights themes of digital responsibility, privacy, and the real-world consequences of unethical computer behavior. Interviews with computer professionals underscore the growing threat of software piracy and hacking, emphasizing that actions taken on computers—though seemingly invisible—can have serious personal and societal consequences. Keywords computer gaming, ethics, hacking, software piracy, Oil's Well, licensing, underground culture, game development, copyright infringement LIMITED DISTRIBUTION. 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 1367 ethicssoftware piracycomputer hackingOil's Wellvideo gamecopyrightgame design1980s technologydata theftIntellectual PropertyCopyright LawApple IImedical databaseCPRcardiac arrest https://avgeeks.videonest.co/videos/445756/glamour-gals-party-place-set-tv-commercial-1981 https://img.videonest.org/gamma/445756_thumbnail_resized_v2.webp https://gamma.videonest.org/445756_video_v3.mp4 Glamour Gals Party Place Set TV Commercial (1981) A commercial for the Glamour Gals collection, showcasing a character named Danny in silver shimmer. It highlights the interactive aspects of the toys, including posing, hairstyling, and playing in a party-themed setting with movable furniture. The film promotes the party place and encourages viewers to prepare for a barbecue and enjoy dancing. Keywords Glamour Gals, Danny, silver shimmer, toys, party place, movable furniture, barbecue, dancing 2025-05-13T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Glamour GalsDannysilver shimmerparty placemovable furniture1980svintage toystv commercialKennertoy collection https://avgeeks.videonest.co/videos/445757/av-geeks-16mm-lunch-5-14-2025 https://img.videonest.org/gamma/445757_thumbnail_resized_v2.webp https://gamma.videonest.org/445757_video_v3.mp4 AV Geeks 16mm Lunch 5-14-2025 It's not lunch without a 16mm film projector hum. #avgeeks #16mmfilms Vorn! Zoo Animals In the Wild: Elephants E is for Ecology Three Herding Societies Evolution of the Motion Picture 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 4148 16mmfilmsAV GeeksAfrican elephantsEcologyherding societiesMotion PicturesFilm Historysilent filmfood productionanimal herdingwater cycleGeorge EastmanThomas A. EdisonZoo Animalsfilm technology https://avgeeks.videonest.co/videos/446991/air-traffic-controller-1968 https://img.videonest.org/gamma/ZStSAO0bUF0_thumbnail_resized_v2.webp https://gamma.videonest.org/ZStSAO0bUF0_video_v3.mp4 Air Traffic Controller (1968) The film features Frank Boone, an air traffic controller at a major international airport, who manages the complex task of directing aircraft on the ground and in the air. The narrative highlights Boone's daily challenges, including emergency situations like a police request for a helicopter to search for a lost child. It also showcases the high-stakes environment of air traffic control, where precision and quick decision-making are crucial. Keywords air traffic control, Frank Boone, emergency response, aviation, airport operations, helicopter, lost child, FAA, Air Force, responsibility 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 512 Frank BooneAir Traffic ControlLAX Airport1960s AviationAirport OperationsBoeing JetsEmergency HelicopterRadar SystemsAviation DocumentaryAirplane TakeoffUnited AirlinesPan AmericanTrans World AirlinesFord MustangVintage Aviation https://avgeeks.videonest.co/videos/447294/av-geeks-16mm-lunch-5-15-2025-2025-05-15-1756 https://img.videonest.org/gamma/DI6jaBWgMmA_thumbnail_resized_v2.webp https://gamma.videonest.org/DI6jaBWgMmA_video_v3.mp4 AV Geeks 16mm Lunch 5-15-2025 2025-05-15 17:56 Step back in time – 16mm style. #avgeeks #16mmfilms 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 482 movieold movieArrow Shirt CompanyfilmAV Geeks16mm filmsvintage film https://avgeeks.videonest.co/videos/447336/girls-beware-3rd-1979 https://img.videonest.org/gamma/ez74JsB11hA_thumbnail_resized_v2.webp https://gamma.videonest.org/ez74JsB11hA_video_v3.mp4 Girls Beware (3rd, 1979) The film highlights the challenges young women face as they transition into adulthood, emphasizing the importance of being aware of potential dangers, particularly regarding sexual abuse. It follows the story of Judy, who, despite her cautious nature, is lured into a dangerous situation by a seemingly friendly man offering babysitting work. Another character, Maria, shares her experience of being manipulated by someone she considered a friend, illustrating the risk of misplaced trust. The film stresses the necessity for young women to develop good judgment about people, recognize warning signs, and seek help when needed. Keywords sexual abuse, trust, young women, dangers, manipulation, awareness, judgment, help, friendship, safety Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 706 Girls BewareChild SafetySexual AbuseStranger DangerTeen SafetyPredatorsgroomingchild molestationinappropriate behaviorexploitationteenagerolder manreporting abuseYouth safety tipsFemale safety https://avgeeks.videonest.co/videos/447348/why-we-take-care-of-property-planet-of-the-ticklebops-1975 https://img.videonest.org/gamma/PHbEpTp5uuQ_thumbnail_resized_v2.webp https://gamma.videonest.org/PHbEpTp5uuQ_video_v3.mp4 Why We Take Care of Property: Planet of the Ticklebops (1975) On the whimsical Planet Nice, inhabitants live in cozy glass bubbles and enjoy the sport of tickle bopping. Young friends Vandal and Darene question the importance of cleanliness and care for their environment. After a series of playful bubble-popping adventures, they realize the value of taking care of their planet, leading to the invention of bowling as a fun way to express their frustrations. Ultimately, they restore the joy and vibrancy of their home. Keywords Planet Nice, Vandal, Darene, tickle bopping, bubbles, cleanliness, environment, adventure, bowling 2025-05-15T00:00:00.000Z yes A/V Geeks 16mm Films no 698 Planet NiceTicklebopsVandalismEnvironmental restorationAnimated shortPlanet careChildren's fablefantasy creaturesspray paintingdestructionchildren's animationPollution cleanupCommunity rebuildingVintage animationcartoon https://avgeeks.videonest.co/videos/447363/the-vision-1978 https://img.videonest.org/gamma/ID9FjZ9JTUU_thumbnail_resized_v2.webp https://gamma.videonest.org/ID9FjZ9JTUU_video_v3.mp4 The Vision (1978) Emphasizes the unchanging nature of God amidst the world's changes, expressing gratitude for His constancy. A conversation reveals a vision of God that encourages not to limit Him, suggesting that He is more expansive than one can imagine. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 134 The VisionSam KlemkeAnimationGodSpiritualityReligious SymbolsFaith1970s AnimationDivine VisionTheological DialogueIndependent Film https://avgeeks.videonest.co/videos/447364/rio-de-janeiro-silent-1930s https://img.videonest.org/gamma/bVvlfInoVvY_thumbnail_resized_v2.webp https://gamma.videonest.org/bVvlfInoVvY_video_v3.mp4 Rio De Janeiro (silent, 1930s) A sweeping 1930s portrait of Rio de Janeiro captures the Brazilian metropolis in all its splendor—sunlit shores, majestic peaks, and bustling city life. The film opens along the southern shore of Guanabara Bay, revealing Rio as the largest city in Brazil, a fast-developing seaport and the nation's seat of government. Pedestrians stroll under tree-lined paths with Sugar Loaf Mountain rising dramatically at the harbor’s entrance. Alpine trolleys ascend to mountain summits, offering panoramic views of Copacabana Beach and the jewel-like bay, once the crown of Portugal’s colonial kingdom. Urban vistas unfold with scenes of traffic winding past the Mangue Canal and Paris Park, while stately palm-lined avenues lead to the grand Avenida Rio Branco—newly completed and central to the city’s business district. Iconic streets such as Rua do Ouvidor teem with life, as trams carry well-dressed passengers past the ornate Municipal Theatre and Monroe Palace. English paving stones glisten beneath Don Pedro’s statue, a tribute to Brazil’s first emperor. Bathing spots like Avenida Beira Mar and Copacabana Beach buzz with leisure, set against colonial facades and modern towers. The monumental statue of Christ atop Corcovado stands watch over it all. From the legacy of explorer Andre Gonçalves to the rhythmic pulse of the city streets, Rio emerges as a vibrant blend of history, elegance, and tropical vitality—bathed in sunlight and laced with progress. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 575 Rio de JaneiroBrazilSugarloaf MountainCopacabana BeachVintage TravelogueBay of GuanabaraHistorical FootageAvenida Rio BrancoRua do OuvidorMunicipal TheatreMonroe PalaceCorcovado MountainGuanabara BayMosaic PavementsNu-Art Fireside Films https://avgeeks.videonest.co/videos/447365/uc-davis-school-of-agronomy-1950s https://img.videonest.org/gamma/KsB95ttKmyw_thumbnail_resized_v2.webp https://gamma.videonest.org/KsB95ttKmyw_video_v3.mp4 [UC Davis School of Agronomy, 1950s] The film follows a college student, Steve, as he navigates his education in agriculture at a university. He learns the importance of practical experience through a summer job on a farm, which helps him understand the complexities of farming and the necessity of education in various agricultural fields. Through his coursework and discussions with peers and advisers, he discovers his passion for agronomy and the interconnectedness of different agricultural disciplines. The film emphasizes the value of a university education in preparing students for flexible careers and problem-solving in the agricultural industry. Keywords college education, agriculture, practical experience, agronomy, summer job, farming, problem-solving, university, career preparation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 754 Agricultural EducationFarmingCollege LifeCareer ExplorationHarvestingIrrigationAgronomyFarm ManagementCollege StudiesCollege EducationLearningGraduationUniversity of CaliforniaBachelor of ScienceProblem Solving https://avgeeks.videonest.co/videos/447411/three-herding-societies-1982 https://img.videonest.org/gamma/UmeOqv-2nHI_thumbnail_resized_v2.webp https://gamma.videonest.org/UmeOqv-2nHI_video_v3.mp4 Three Herding Societies (1982) The film explores the herding traditions of three distinct cultures: the Laps in northern Finland, the Ketua Indians in Peru, and the Maasai in Kenya. The Laps rely on reindeer for survival,... 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 764 LappsQuechuasMasaiFinlandPeruKenyareindeer herdinglivestockcattle herdingcultural practicesMaasai warriorscattleherdingLaplandersQuechua https://avgeeks.videonest.co/videos/448892/av-geeks-16mm-lunch-5-16-2025 https://img.videonest.org/gamma/CERWYbO4nXo_thumbnail_resized_v2.webp https://gamma.videonest.org/CERWYbO4nXo_video_v3.mp4 AV Geeks 16mm Lunch 5-16-2025 Do the 16mm films know that it is Friday? Do they care? #avgeeks #16mmfilms 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 4312 16mm filmsA/V GeeksBetty Crockercake recipefood historyaccessibilityBlindnessVisually ImpairedNational Safety Council1960saccidentcake bakingvintage cookingfilm donationsStory of Lead https://avgeeks.videonest.co/videos/448938/turning-points-1978 https://img.videonest.org/gamma/StAOHPR7m6A_thumbnail_resized_v2.webp https://gamma.videonest.org/StAOHPR7m6A_video_v3.mp4 Turning Points (1978) Discusses the experiences of several women returning to education and the workforce after raising children. They reflect on traditional gender roles, personal struggles with self-worth, and the challenges of balancing family and education. Many express a desire for independence, fulfillment, and financial stability through education, particularly in nursing and business. They share their fears and triumphs as they navigate their new paths, emphasizing the importance of pursuing goals and the empowerment that comes with education. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 2059 adult learningcontinuing educationreturning to schoolhigher educationcareer goalsparentingsingle parenteducationnursing schoolvocational educationCollege studentFamily RolesAcademic Achievementfinancial aidNew York City https://avgeeks.videonest.co/videos/448942/horses-of-appleby-fair-1982 https://img.videonest.org/gamma/Cev8BuSbAgs_thumbnail_resized_v2.webp https://gamma.videonest.org/Cev8BuSbAgs_video_v3.mp4 Horses Of Appleby Fair (1982) Showcases the Applebee Horse Fair, an annual event in a quiet village in northwest England, known for its scenic beauty and rich history. The narrator reflects on their life in Applebee, highlighting the significance of horses in the community and the excitement of the fair, which attracts gypsies and visitors alike. The fair features horse trading, harness races, and a vibrant atmosphere, with the narrator expressing a desire to buy a horse for their grandchild. Despite some local resistance to the gypsies, the fair is a cherished tradition that brings joy and excitement to the village. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-16T00:00:00.000Z yes A/V Geeks 16mm Films no 691 ApplebyEnglandAppleby Horse Fairhorse tradingGypsiesharness racingWestmorlandRomani peopleGypsy horsecultural eventhorse marketequestrianEden Riverhorse-drawn wagonAppleby Fair https://avgeeks.videonest.co/videos/448953/eggs-to-market-1964 https://img.videonest.org/gamma/KzRHuqzAg_M_thumbnail_resized_v2.webp https://gamma.videonest.org/KzRHuqzAg_M_video_v3.mp4 Eggs To Market (1964) Details the process of how fresh eggs are collected, processed, and delivered to markets. Farmers use motor-driven carts to care for chickens and collect eggs multiple times a day. The eggs are washed, inspected through candling, sorted by size, and packed into cartons by machines. They are then stored in a cool room before being shipped to supermarkets, ensuring that consumers receive eggs laid within the last 24 hours. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 661 Egg FarmEgg ProcessingAutomated Egg ProcessingCackle Fresh Eggschicken farmingegg packagingsorting machinefarm to supermarketegg productionegg gradingegg deliveryfresh eggsfood distributionOlson FarmsOlson Brothers Farms https://avgeeks.videonest.co/videos/448962/structure-of-a-grasshopper-silent-1930s https://img.videonest.org/gamma/aECCx4ezuF4_thumbnail_resized_v2.webp https://gamma.videonest.org/aECCx4ezuF4_video_v3.mp4 Structure Of A Grasshopper (silent, 1930s) In this silent 1930s nature film, the daily life and dramatic survival of grasshoppers are observed with a blend of documentary realism and surreal imagery. A grasshopper is seen drinking from a pool of water surrounded by rocks and sticks before climbing atop a tall branch, where it feeds and rests. Close-ups emphasize its movements, including a moment when it raises its rear and expels waste. Intercut with this is a kaleidoscopic, dreamlike sequence of a woman sipping from a cup, offering a visual echo of the insect's stillness. The peaceful tone shifts when a praying mantis attempts to eat a struggling frog and a lizard snaps up a grasshopper from a plant. Throughout, various grasshoppers cling to branches, hide beneath twigs, or explore the pond’s edge. The film captures the fragile beauty and constant peril of insect life with an unusual mix of poetic imagery and natural science. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 577 grasshoppergrasshopper anatomyinsect anatomylife functionsanimal sciencelocustssegmented bodyorthopteracompound eyedigestioninsect reproductionmoltinggrasshopper eggsanimal kingdomF. P. Smith https://avgeeks.videonest.co/videos/448978/just-naturally-different-1950s https://img.videonest.org/gamma/VhrTsUYUhko_thumbnail_resized_v2.webp https://gamma.videonest.org/VhrTsUYUhko_video_v3.mp4 Just Naturally Different (1950s) The film follows Bill Thompson, an experienced oil production superintendent who initially views his workers as interchangeable parts rather than individuals. As he grapples with rising lifting costs and high employee turnover, he realizes the importance of recognizing the unique qualities and needs of each worker. Through conversations with his wise boss and observations of other supervisors, Bill learns to appreciate the differences among his crew, leading to improved efficiency and morale. By treating his workers as individuals, he not only enhances productivity but also earns their respect as a leader. Keywords oil production, leadership, individual differences, employee morale, efficiency, management, crew dynamics, workplace relationships Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 507 Bill Thompsonoil productionemployee moraleefficiencymanagementpersonnel problemspersonnel solutionsoil workersoil wellswell servicinggas productionmaintenance planningTexasGulf Oil Corporationcrew dynamics https://avgeeks.videonest.co/videos/448980/a-gift-from-dirk-1950 https://img.videonest.org/gamma/QpDiKt5A04s_thumbnail_resized_v2.webp https://gamma.videonest.org/QpDiKt5A04s_video_v3.mp4 A Gift From Dirk (1950) In Amsterdam, a boy named Durk lives on a canal boat and learns about beauty from his father. They discuss the value of beautiful things, exemplified by a story about a nobleman who traded valuable possessions for a single tulip bulb, the Firebird tulip. Durk dreams of seeing this tulip and, during a visit to the Keukenhof Gardens, searches for it among many other flowers. Despite not finding the Firebird tulip, he learns that beauty is subjective and can be found in many forms. Ultimately, he nurtures a tulip he believes is special, reflecting his journey of understanding beauty. Keywords Amsterdam, canal boat, beauty, Firebird tulip, Keukenhof Gardens, subjective beauty, father-son relationship, tulip bulb, story, adventure Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 1101 AmsterdamHollandKeukenhof Gardenstuliptulipstulip bulbFirebird tulipflower gardengardeningDutchFlower bedsNetherlandsDaffodilsHyacinthsboy https://avgeeks.videonest.co/videos/448996/making-a-mask-1951 https://img.videonest.org/gamma/yQQO5wPyb2c_thumbnail_resized_v2.webp https://gamma.videonest.org/yQQO5wPyb2c_video_v3.mp4 Making A Mask (1951) The film "Making A Mask" demonstrates the process of creating masks using simple materials like newspaper, paste, and clay. It follows a group of children as they mold their faces, apply layers of wet newspaper, and paint their finished masks. The project encourages creativity, allowing each child to design a unique character. The masks are durable and can be used for various occasions, showcasing the fun of crafting. Keywords mask-making, children, creativity, crafting, newspaper, paste, clay, artistic project, imagination Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 338 Mask MakingDIYCraftarts and craftspaper machehomemade maskKids Activitieseducationhandmade maskfilm bureaucreativitycraftingnewspaperpasteclay https://avgeeks.videonest.co/videos/449006/mr-big-1968 https://img.videonest.org/gamma/nPePmSx9jm8_thumbnail_resized_v2.webp https://gamma.videonest.org/nPePmSx9jm8_video_v3.mp4 Mr Big (1968) n a small town, a man known as Mr. Big finds himself in jail after a drunk driving incident that results in a woman's serious injury. As he awaits his attorney, he interacts with fellow inmates and reflects on his pride and the consequences of his actions. The film explores themes of accountability, self-reflection, and the struggle for redemption as Mr. Big confronts his past and the reality of his situation. Keywords jail, drunk driving, pride, accountability, redemption, small town, self-reflection, consequences 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1671 https://avgeeks.videonest.co/videos/449023/us-crime-rates-a-shocking-look-at-every-minute-and-second https://img.videonest.org/gamma/nKn8rjDLDVM_thumbnail_resized_v2.webp https://gamma.videonest.org/nKn8rjDLDVM_video_v3.mp4 US Crime Rates: A Shocking Look at Every Minute & Second Explore the shocking crime rates in the United States. Every 18 seconds a serious crime occurs, with homicides every 45 minutes. We reveal the alarming frequency of burglaries and larceny. Stay informed and aware! #CrimeStats #USCrime #CrimeRate #TrueCrime #CriminalJustice #CrimeAwareness #UnitedStates #Burglary #Larceny #Homicide 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 34 US CrimeCrime RatesUnited StatesHomicideBurglaryLarcenySerious CrimeCriminal JusticeCrime Awareness https://avgeeks.videonest.co/videos/449064/fast-ones-dino-loop-set-1982 https://img.videonest.org/gamma/449064_thumbnail_resized_v2.webp https://gamma.videonest.org/449064_video_v3.mp4 Fast Ones Dino Loop set (1982) The commercial promotes Kenner's Fast Ones Dino Loop set, featuring the Blazing Bandit racer and a unique Fast Ones license plate. It highlights the excitement of racing and looping with the Dino Loop set, emphasizing the challenge of becoming the champion. The set requires assembly and is marketed as a new product from Kenner. 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 30 KennerFast OnesDino Loop SetBlazing BanditToy Commercial1980sVintage ToysToy RacingCar RacingCollectible Toys https://avgeeks.videonest.co/videos/449065/the-weird-number-1971 https://img.videonest.org/gamma/449065_thumbnail_resized_v2.webp https://gamma.videonest.org/449065_video_v3.mp4 The Weird Number (1971) This animated story revolves around a town where numbers are personified, and each number behaves predictably, such as stealing a fixed amount. When a robbery occurs, it is discovered that a creature, representing a fraction (2/3), has been stealing. The sheriff and the baker encounter various rational numbers, such as 4/6 and 5/4, who explain their identities and how they can change forms. The narrative highlights the concept of rational numbers, illustrating how natural numbers can also be expressed as fractions. Eventually, the rational numbers integrate into the town, but rumors arise about new, mysterious numbers that can't be expressed as natural numbers. 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 725 rational numbersfractionmathematics educationnatural numbernumber thiefsheriffbakerExploring Mathematicscake cuttinganimated lessonmath educationrobbingnumber ninenumber 763Xerox Films https://avgeeks.videonest.co/videos/449066/airline-stewardess-1968 https://img.videonest.org/gamma/449066_thumbnail_resized_v2.webp https://gamma.videonest.org/449066_video_v3.mp4 Airline Stewardess (1968) The film follows Elaine Vaughn, a chief stewardess for Pan-American World Airways, as she prepares for a flight to Nassau. It highlights her daily routine, including makeup tips for stewardesses, interactions with passengers, and her journey from Philadelphia to becoming a stewardess after training in Miami. Elaine's story emphasizes her passion for travel and the challenges of working in the airline industry. Keywords Elaine Vaughn, stewardess, Pan-American World Airways, flight preparation, airline industry, travel, training, Miami, passenger interactions 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 713 Elaine VaughnPan AmericanAirline StewardessAirline IndustryTravelFlight AttendantsAir TravelNassau BahamasPassenger InteractionsFlight 403Check InBoarding PlanePan American World AirwaysAirline TravelPassenger Service https://avgeeks.videonest.co/videos/449067/zoo-animals-in-the-wild-elephants-1981 https://img.videonest.org/gamma/449067_thumbnail_resized_v2.webp https://gamma.videonest.org/449067_video_v3.mp4 Zoo Animals In The Wild; Elephants (1981) The film discusses the characteristics and behaviors of elephants, highlighting the differences between African and Asian elephants. It explains that African elephants are larger with bigger ears and live in herds. The video showcases the usefulness of an elephant's trunk for eating, drinking, and protecting their skin from insects. It also mentions their need for water, their tusks, and how they enjoy playing in mud to cool off. Keywords elephants, African elephants, Asian elephants, herds, trunk, dust, water, tusks, muddy water Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 298 elephantsAfrican elephantsAsian elephantselephant herdselephant trunkelephant tusksdust bathinganimal behaviorwildlifeanimal anatomy https://avgeeks.videonest.co/videos/449068/focus-on-the-fifties-1981 https://img.videonest.org/gamma/449068_thumbnail_resized_v2.webp https://gamma.videonest.org/449068_video_v3.mp4 Focus On The Fifties (1981) he film explores the transformative decade of the 1950s in America, highlighting the rise of television and its impact on culture, politics, and society. It discusses the shift from radio to television, the emergence of iconic shows and personalities, and the establishment of nightly news. Significant events include the televised Senate hearings on organized crime, the popularity of sitcoms like "I Love Lucy," and advancements in technology and medicine, such as the polio vaccine. The film also chronicles the Cold War's influence, including McCarthyism and the space race, and the struggle for civil rights, culminating in the Supreme Court's desegregation rulings. Keywords 1950s, television, culture, politics, McCarthyism, civil rights, space race, I Love Lucy, polio vaccine, organized crime, technology 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1434 1950s televisionI Love LucyCold WarMcCarthyismcivil rightsspace racePolio VaccineCivil Rights MovementRacial segregationBrown vs. BoardAmerican BandstandMarilyn MonroeRichard NixonPublic educationinvention https://avgeeks.videonest.co/videos/449069/evolution-of-motion-pictures-1940 https://img.videonest.org/gamma/449069_thumbnail_resized_v2.webp https://gamma.videonest.org/449069_video_v3.mp4 Evolution Of Motion Pictures (1940) The film explores the history and evolution of motion pictures, beginning with ancient shadow plays from over 3,000 years ago. It highlights key developments in visual storytelling, including Leonardo da Vinci's camera obscura, the invention of the magic lantern, and the concept of persistence of vision. Significant milestones include Edward Mybridge's instantaneous photography, Thomas Edison's advancements in film technology, and the transition from silent films to sound. The documentary emphasizes the contributions of various inventors and artists that led to the birth of modern cinema. Keywords motion pictures, history, shadow plays, Leonardo da Vinci, camera obscura, magic lantern, persistence of vision, Edward Mybridge, Thomas Edison, silent films, sound films, animation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1284 motion picturesfilm historyhistory of cinemaThomas Edisoncamera obscuraLeonardo da Vincimagic lanternPersistence of VisionEdward Muybridgesilent filmsound filmsanimationMickey Mousecelluloid filmanimated cartoon https://avgeeks.videonest.co/videos/449070/niagara-1970s https://img.videonest.org/gamma/449070_thumbnail_resized_v2.webp https://gamma.videonest.org/449070_video_v3.mp4 Niagara (1970s) The film showcases the beauty and history of Niagara Falls, Ontario, highlighting its natural wonders and attractions. It explores the region's historical significance, including Fort Erie and the War of 1812, while also showcasing the charming town of Niagara on the Lake. Visitors can enjoy various experiences, from scenic drives along the Niagara Parkway to thrilling boat rides on the Maid of the Mist. The film emphasizes the area's recreational opportunities, including wine production, entertainment at Marineland, and the romantic appeal of Niagara as a honeymoon destination. Ultimately, the falls remain the star attraction, captivating visitors with their grandeur. Keywords Niagara Falls, Ontario, tourism, history, Fort Erie, Niagara on the Lake, Maid of the Mist, recreation, honeymoon capital, wine production, Marineland 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 818 Niagara FallsOntarioCanadaFort ErieNiagara ParkwayShaw Festivaltourismfloral clockSpanish aerocarMaid of the MistMarinelandentertainmentSightseeing TourTravel DestinationHorseshoe Falls https://avgeeks.videonest.co/videos/449071/a-day-with-the-fbi-1951 https://img.videonest.org/gamma/449071_thumbnail_resized_v2.webp https://gamma.videonest.org/449071_video_v3.mp4 A Day With The FBI (1951) The film provides an overview of the operations and responsibilities of the FBI, highlighting its role in law enforcement and internal security. It details the extensive communication network between headquarters and field offices, the scientific methods used in crime investigation, and the rigorous training and qualifications required for special agents. The film emphasizes the cooperation between the FBI and local police, showcasing real cases where forensic evidence led to the resolution of crimes. It underscores the importance of the FBI in maintaining public safety and the challenges posed by criminal and subversive activities. Keywords FBI, law enforcement, crime investigation, forensic science, special agents, public safety, communication network, training, criminal justice, cooperation 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1138 FBIFederal Bureau of Investigationlaw enforcementcrime investigationforensic sciencespecial agentscrime laboratoryinternal securityFBI AcademyJ. Edgar Hoovercriminal investigationcrime detectionFBI laboratorycriminal apprehensionpolice chase https://avgeeks.videonest.co/videos/449072/e-is-for-ecology-1979 https://img.videonest.org/gamma/449072_thumbnail_resized_v2.webp https://gamma.videonest.org/449072_video_v3.mp4 E Is For Ecology (1979) "E Is For Ecology" is an educational film that introduces the concepts of ecology, focusing on the interdependence of the sun, air, water, plants, and animals. It explains the water cycle, air cycle, and the recycling of elements in nature, emphasizing how plants and animals rely on each other for survival. The film encourages viewers to recycle and highlights the importance of maintaining ecological balance. Keywords ecology, energy, water cycle, air cycle, recycling, plants, animals, environment, interdependence Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-17T00:00:00.000Z yes A/V Geeks 16mm Films no 669 Ecologywater cyclerecyclingenvironmental educationplant lifeanimalssunlightair and waternatural resourcesAir cyclePlantElementsRecyclereuseE is for Ecology https://avgeeks.videonest.co/videos/449073/wipe-out-hate-a-pledge-for-a-healthy-united-america https://img.videonest.org/gamma/449073_thumbnail_resized_v2.webp https://gamma.videonest.org/449073_video_v3.mp4 Wipe Out Hate: A Pledge for a Healthy, United America! 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 25 Wipe Out HateCatherine HepburnEdward G. RobinsonPledge AllegianceAmerican ValuesDemocracyFair PlayAnti-HateFighting Hate https://avgeeks.videonest.co/videos/449074/animated-e-sings-a-catchy-recycle-song-chalkboard-edition https://img.videonest.org/gamma/449074_thumbnail_resized_v2.webp https://gamma.videonest.org/449074_video_v3.mp4 Animated 'e' Sings a Catchy Recycle Song! (Chalkboard Edition) 2025-05-18T00:00:00.000Z yes A/V Geeks 16mm Films no 29 animated letterrecycle songrecyclingenvironmental awarenesskids learningchalkboard animation https://avgeeks.videonest.co/videos/450712/manolin-the-bullfighter-1962 https://img.videonest.org/gamma/_sbU4cJh5po_thumbnail_resized_v2.webp https://gamma.videonest.org/_sbU4cJh5po_video_v3.mp4 Manolin the Bullfighter (1962) In this humorous vintage propaganda cartoon, a character named Manolito is persuaded to become a famous toreador in the big city, despite his doubts about his abilities. He faces challenges, including fighting real bulls, while navigating the absurdities of the bullfighting world. The film features comedic exchanges and a blend of courage and farce as Manolito grapples with his identity and the pressures of fame. Keywords Manolito, toreador, bullfighting, comedy, fame, absurdity, challenges Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 468 Manolin ToreroBullfightingRoosterClassic CartoonDibujos Animados S.A.Animated ComedyManolitoBurritoCartoon bullfightingSlapstick comedyAnimated shortRooster matadorDonkey in disguiseArena anticsCostume prank https://avgeeks.videonest.co/videos/450727/av-geeks-16mm-lunch-5-20-2025-2025-05-20-1700 https://img.videonest.org/gamma/OkdLuO3QhGo_thumbnail_resized_v2.webp https://gamma.videonest.org/OkdLuO3QhGo_video_v3.mp4 AV Geeks 16mm Lunch 5-20-2025 2025-05-20 17:00 Watching old 16mm films to pass the time! Can't think of anything better than that! #avgeeks #16mmfilms 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 694 16mm filmfilm animationexperimental animationdrawn animationcamera-less animationanimated filmblack and whiteadd colorsimple charactersdocumentary filmmakerGem CohenJohn AllmanInside Outmedia educationOwen Gottlieb https://avgeeks.videonest.co/videos/451940/time-part-two-1940s https://img.videonest.org/gamma/2g9jCDyhDM4_thumbnail_resized_v2.webp https://gamma.videonest.org/2g9jCDyhDM4_video_v3.mp4 Time, Part Two (1940s) The film discusses the concept of time zones and how they are essential for navigation. It explains that the Earth is divided into 24 time zones, each based on 15° of longitude, to maintain a standardized time system across different regions. The film illustrates how local times can differ significantly due to the Earth's rotation, leading to different dates occurring simultaneously in various locations. It also covers the importance of the International Date Line and how crossing it affects the date without changing the time. Finally, it touches on the relationship between civil time, apparent time, and the equation of time, which are crucial for celestial navigation. Keywords time zones, navigation, Greenwich civil time, International Date Line, dates, celestial navigation, apparent time, equation of time, meridian, longitude Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 1203 https://avgeeks.videonest.co/videos/452426/scenes-of-mountain-countries-silent-1930s https://img.videonest.org/gamma/8TPUXKgZwmQ_thumbnail_resized_v2.webp https://gamma.videonest.org/8TPUXKgZwmQ_video_v3.mp4 Scenes Of Mountain Countries (silent, 1930s) This 1930s film offers a sweeping, scenic journey through mountainous regions around the world, blending natural grandeur, cultural traditions, and the resilience of people living in high-altitude landscapes. It opens with dramatic shots of waterfalls cascading down cliffs and rivers winding through snow-capped peaks. A world map highlights major mountain ranges before shifting to stunning aerial views of glaciers and rocky terrain. Birds nest on crags, and horseback riders traverse rugged trails. A solemn ceremony at a National Park Service memorial along the John Muir Trail honors naturalist heritage. The film explores both the built and natural environments, showcasing homes carved into canyon walls, miners at work deep within the mountains, and molten metal being poured into molds. The focus then turns to daily life: villagers in traditional dress fetch water, weave thread on looms, and gather hay by churches and alpine homes. A train snakes along cliffs and across bridges, cutting through snowy landscapes and river valleys, connecting remote settlements. Glaciers melt into rivers, and mountaineers scale rock faces, ropes tied around their waists. Scenes of villagers harvesting, transporting, and storing hay underscore the effort to survive in mountainous terrain. Elsewhere, people haul belongings up steep slopes while animals traverse snowy and rocky paths. The film closes with dramatic imagery of climbers navigating a glacier and crossing a rope bridge, before ending with a title card: “The End.” Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 556 Mount WhitneyJohn Muir TrailNational Park ServiceIndigenous CulturesMining OperationsSteam Locomotive1930s Silent FilmArchival filmMountain explorationEarly 20th centuryMountaineeringPack animalsRope bridgeRural historyHistorical expeditions https://avgeeks.videonest.co/videos/452436/national-barbecue-month-1970s https://img.videonest.org/gamma/a1BD8V-EeYY_thumbnail_resized_v2.webp https://gamma.videonest.org/a1BD8V-EeYY_video_v3.mp4 National Barbecue Month (1970s) Chef Michael Tondo celebrates National Barbecue Month by inviting viewers to enjoy barbecues during July, focusing on Old West cooking traditions. He demonstrates how to prepare a country-style top round steak, emphasizing the importance of sealing in flavors with kitchen bouquet, grilling techniques, and serving suggestions. Tondo also shares tips for creating a festive western atmosphere for barbecues, including serving barbecue beans and using decorative touches to enhance the experience. Keywords barbecue, Old West, Chef Michael Tondo, top round steak, kitchen bouquet, grilling techniques, western atmosphere, National Barbecue Month Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 255 National Barbecue Monthtop round steakKitchen Bouquetbarbecuingbrowning saucecountry style steakbarbecuebarbequebarbequingcorn on the cobgrillingbarbecue beanscookingwesternchuckwagon https://avgeeks.videonest.co/videos/452441/kenners-betty-crocker-easy-bake-mini-wave-oven-1982 https://img.videonest.org/gamma/8BRhlxB_wRQ_thumbnail_resized_v2.webp https://gamma.videonest.org/8BRhlxB_wRQ_video_v3.mp4 Kenner's Betty Crocker Easy Bake Mini Wave Oven (1982) A commercial for the Kenner's Betty Crocker Easy Bake Mini Wave Oven, highlighting its features such as preheating time, cake mixing options, and quick cooking capabilities. It emphasizes the fun and ease of baking with this toy oven. Keywords Betty Crocker, Easy Bake, Mini Wave Oven, Kenner, baking, toy, cooking, fun 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Betty CrockerEasy Bake OvenKennerCPG ProductsToy OvenBakingCake MixMini Microwave OvenToy CommercialCooking https://avgeeks.videonest.co/videos/452442/the-raccoon-silent-1930s https://img.videonest.org/gamma/XCpX-idgsws_thumbnail_resized_v2.webp https://gamma.videonest.org/XCpX-idgsws_video_v3_360.mp4 The Raccoon (silent, 1930s) This silent 1930s-era raccoon footage presents a charming and naturalistic study of raccoon behavior in a woodland setting. The film begins with a raccoon interacting with a tree stump, climbing and exploring its surroundings. It proceeds to show the raccoon digging at the base of a tree, wandering through the woods, and navigating a tree—both ascending and descending, eventually entering a hollow trunk. The animal is then seen along a stream, investigating a small waterfall and examining the water’s edge for food. As the raccoon continues its exploration, it encounters mollusks and crabs, foraging and feeding in the shallows. Detailed sequences show the raccoon digging and eating near the creek before climbing trees once again, highlighting its agility. The footage emphasizes both the raccoon's curiosity and adaptability, ending with scenes of it perched in tree branches and repeatedly ascending and descending trunks. The overall impression is a gentle portrait of wildlife at home in its habitat, captured with a sense of observational patience typical of early nature films. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 360 The RaccoonraccoonforagingwoodlandmammalclimbingtreefishingstreamcrayfishCrustaceanAnimaltreeswildlifevintage video https://avgeeks.videonest.co/videos/453618/av-geeks-16mm-lunch-with-john-allman https://img.videonest.org/gamma/o_w49H11Ty0_thumbnail_resized_v2.webp https://gamma.videonest.org/o_w49H11Ty0_video_v3_360.mp4 A/V Geeks 16mm Lunch with John Allman Join us live with filmmaker John Allman and educational media expert Owen Gottlieb as we talk about John's amazing films for the Inside/Out series. #avgeeks #16mmfilms 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 4904 https://avgeeks.videonest.co/videos/453630/film-about-wwii-industry-1943 https://img.videonest.org/gamma/dGGJUB0ohNA_thumbnail_resized_v2.webp https://gamma.videonest.org/dGGJUB0ohNA_video_v3_360.mp4 [Film about WWII Industry 1943] The film emphasizes the critical importance of time in wartime production, illustrating how every second counts in the effort to supply military needs. It reflects on the responsibilities of various workers in the production chain and how small delays can lead to significant consequences in the war effort. The narrative uses personal stories to highlight the interconnectedness of roles and the impact of lost time on victory or defeat in battle. Keywords time, production, responsibility, war, military supplies, efficiency, consequences, teamwork, urgency Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 626 World War IIwartime productionThe Dartnell Corporationmanufacturingtime managementworker productivityairplane productionmachine gunsriflesjeepsanti-tank gunsbattleshipsproduction delaysworkplace efficiencyemployee https://avgeeks.videonest.co/videos/453673/personal-health-for-girls-2nd-ed-1972 https://img.videonest.org/gamma/_1Uq5H1acZ0_thumbnail_resized_v2.webp https://gamma.videonest.org/_1Uq5H1acZ0_video_v3_360.mp4 Personal Health For Girls (2nd ed, 1972) Focuses on personal health and hygiene for young girls, emphasizing the importance of cleanliness, proper menstrual care, skincare, dental hygiene, and a balanced diet. It discusses managing acne, exercising, and maintaining a positive self-image while encouraging girls to make informed health decisions and avoid harmful substances like tobacco and alcohol. Keywords personal health, hygiene, menstruation, skincare, acne, dental hygiene, balanced diet, exercise, self-image, tobacco, alcohol Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 711 personal hygieneteenage girlsmenstruationskin careacne treatmenthealthy dietexercisingproper sleeptobacco awarenessalcohol awarenesshair careshoweroral carebody odorbalanced diet https://avgeeks.videonest.co/videos/453679/av-geeks-16mm-lunch-5-22-2025 https://img.videonest.org/gamma/doQjjSpsb60_thumbnail_resized_v2.webp https://gamma.videonest.org/doQjjSpsb60_video_v3.mp4 AV Geeks 16mm Lunch 5-22-2025 16mm films, you say? Why yes, we have some. Would you like to see them? #avgeeks #16mmfilms 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 3921 https://avgeeks.videonest.co/videos/454121/av-geeks-16mm-lunch-5-23-2025 https://img.videonest.org/gamma/y0mFc1rInRo_thumbnail_resized_v2.webp https://gamma.videonest.org/y0mFc1rInRo_video_v3.mp4 AV Geeks 16mm Lunch 5-23-2025 It's the beginning of a holiday weekend! Will anybody take time to watch some 16mm films before they take off? #avgeeks #16mmfilms 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 5013 Jean PiagetJohn FlavellDavid Elkindadolescenceteenagersmental developmenthigh schoolformal operationsabstract thinkingteenage self-consciousnessformal educationA/V Geeks16mm filmsStory of LeadStory of Copper https://avgeeks.videonest.co/videos/455064/measuring-hearing-1960s https://img.videonest.org/gamma/455064_thumbnail_resized_v2.webp https://gamma.videonest.org/455064_video_v3.mp4 Measuring Hearing (1960s) Discusses methods for assessing the auditory capacity of children with learning impairments, highlighting that these procedures differ based on the child's age, the type of stimulus used, and the expected responses. It also outlines various evaluation techniques employed in this context. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-27T00:00:00.000Z yes A/V Geeks 16mm Films no 655 Hearing ImpairmentHearing testSound Field testingPure ToneSpeech AudiometryPlay AudiometryHearing LossDeafnessAudiometric AnalysisAuditory SkillsGeorge Washington UniversityBureau of Education for the HandicappedAcoustic SignalElectrodeshearing impaired https://avgeeks.videonest.co/videos/455065/guess-who-1965 https://img.videonest.org/gamma/455065_thumbnail_resized_v2.webp https://gamma.videonest.org/455065_video_v3.mp4 Guess Who? (1965) Walter Lantz cartoon follows Junior Barry, who wins a monkey named Bony Bunkey in a contest. Hiding the monkey from his father leads to a series of comedic misunderstandings and chaotic situations in the household. The antics escalate as family members interact with the mischievous monkey, creating a humorous environment filled with confusion and laughter. Keywords monkey, contest, family, comedy, misunderstandings, chaos, Junior Barry, antics Year 1965 2025-05-27T00:00:00.000Z yes A/V Geeks 16mm Films no 367 monkeyWalter LantzcartoonanimationcomedyfamilymisunderstandingschaosJunior BarryanticsBunkyThe Beary'sbeartwist contest https://avgeeks.videonest.co/videos/455066/this-is-america-no-7-democracys-diary-reel-1 https://img.videonest.org/gamma/455066_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455066/this-is-america-no-7-democracys-diary-reel-1 This Is America (No. 7): Democracy's Diary (Reel 1) We are trying to track down Reel 2. The film explores the intricate processes involved in newspaper production in the United States, emphasizing the importance of journalism in informing the public. It details the journey of news from global sources to local readers, highlighting the role of various professionals such as reporters, editors, and researchers. The film also underscores the significance of the press in a democratic society, showcasing how the New York Times operates and the responsibilities it holds in delivering accurate information to the public. Keywords journalism, newspaper, New York Times, news production, democracy, reporters, editors, information, communication, public awareness Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-26T00:00:00.000Z yes A/V Geeks 16mm Films no 556 Democracy's DiaryNew York TimesAmerican journalismnewspaper reportingpress freedomnews productionreporterseditorsinformationcommunicationpublic awarenessNewspaper printingTypesettingLinotype machinespolitical opinion https://avgeeks.videonest.co/videos/455067/adolescence-a-case-study-1978 https://img.videonest.org/gamma/455067_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455067/adolescence-a-case-study-1978 Adolescence: A Case Study (1978) The film "Adolescence: A Case Study" explores the mental and emotional development of a 17-year-old girl named Angie as she navigates the complexities of adolescence. It highlights her transition from childhood to adulthood, showcasing her newfound ability to think abstractly, question societal norms, and engage in hypothetical reasoning. The film discusses the challenges teenagers face, including self-consciousness, identity formation, and the struggle to balance personal desires with societal expectations. Through Angie's experiences, the film illustrates the bittersweet nature of growing up, as she learns to understand her place in the world and the intricacies of relationships. Keywords adolescence, mental development, abstract thinking, identity, self-consciousness, relationships, societal expectations, emotional growth, hypothetical reasoning Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-26T00:00:00.000Z yes A/V Geeks 16mm Films no 1180 adolescencecase studyAngieteenagerJohn FlavellJean Piagetformal operationshypothetical thinkingAdolescent developmentself-consciousteenagersidentityinterpersonal relationshipmaturationpersonal growth https://avgeeks.videonest.co/videos/455068/hojas-vigil-1950s https://img.videonest.org/gamma/455068_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455068/hojas-vigil-1950s Hoja's Vigil (1950s) The film explores themes of freedom of the press and the complexities of truth through a conversation among friends in a coffee house. Hamid, a young radical, argues for a free press but is challenged by his peers about the nature of truth and bias in journalism. The story of Nasr-ed-din Hoja is used as an allegory, illustrating how unfair rules are easier to create than to uphold. The narrative critiques the idea that freedom of the press should only reflect certain viewpoints, suggesting that such a mindset hinders societal progress. Keywords freedom of press, truth, bias, journalism, Nasr-ed-din Hoja, allegory, societal critique, young radical, coffee house, unfair rules Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-26T00:00:00.000Z yes A/V Geeks 16mm Films no 573 Nasr-eddin HojaUSIStaleswinter nightmarionette showNassar Eddin Hojapuppet showMiddle Easternallegory https://avgeeks.videonest.co/videos/455069/glamour-gals-dolls-1981 https://img.videonest.org/gamma/455069_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455069/glamour-gals-dolls-1981 Glamour Gals dolls (1981) a promotional advertisement for the "Glamour Gals" collection by Kenner, showcasing various dolls and playsets, including Jesse in a purple outfit and a dining set for two. It highlights a party playhouse with movable furniture and a collector's case designed for displaying the dolls. Keywords Glamour Gals, Kenner, dolls, playsets, Jesse, advertisement, collector's case, toy collection 2025-05-26T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Glamour GalsKennerdollstoysJesse dollFirebird1981collector's caseparty playhouse https://avgeeks.videonest.co/videos/455070/when-the-littlest-camel-knelt-1960s https://img.videonest.org/gamma/455070_thumbnail_resized_v2.webp https://gamma.videonest.org/455070_video_v3.mp4 When The Littlest Camel Knelt (1960s?) "When The Littlest Camel Knelt" tells the story of a small, curious camel who dreams of carrying gifts to a king. Unlike the larger camels, Cappy and Mo, who boast about their royal experiences, the littlest camel longs for the same adventure. He gets the chance to accompany the wise men on a journey to Bethlehem to see a great king. However, upon arrival, he discovers that the king is not in a grand palace but in a humble stable, where he witnesses the birth of baby Jesus. The littlest camel learns the true meaning of reverence and joy, kneeling in adoration along with the other animals. Keywords camel, Bethlehem, wise men, baby Jesus, king, humility, reverence, adventure, joy Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-26T00:00:00.000Z yes A/V Geeks 16mm Films no 672 CamelBethlehemThree Wise Menbaby JesusLittlest CamelChristmas StoryNativity sceneWise MenkneelingworshipGoldFrankincenseMyrrhBibleReligious Story https://avgeeks.videonest.co/videos/455071/tigers-of-the-seas-1930s https://img.videonest.org/gamma/455071_thumbnail_resized_v2.webp https://gamma.videonest.org/455071_video_v3.mp4 Tigers Of The Seas (1930s) A silent, observational film documenting a full shark capture and butchering process at sea and onshore. It begins with dramatic scenes of men struggling to catch a large shark from the bow of a fishing boat, capturing its fight against the line and its eventual hoisting aboard using ropes and pulleys. The film then transitions to detailed footage of the shark being examined, weighed, and methodically butchered onshore. Its body is sliced, organs removed, and parts laid out to dry in the sun. The final scene shows men proudly displaying the skinned hide, illustrating the commercial use of the catch. The footage offers a raw, unfiltered glimpse into the shark fishing practices of the 1930s. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 584 shark fishingshark skinningshark livershark finshistorical videovintage footageshark processingcommercial fishingDusky SharkTiger sharktrawl netrazor edged teethSherman PrattGrace O. Clarke https://avgeeks.videonest.co/videos/455072/east-side-west-side-1973 https://img.videonest.org/gamma/455072_thumbnail_resized_v2.webp https://gamma.videonest.org/455072_video_v3.mp4 East Side West Side (1973) This film explores the history and vibrancy of New York City, detailing its transformation from a barren island to a bustling metropolis. It highlights significant landmarks like the Statue of Liberty, Empire State Building, and Central Park, as well as the city's diverse culture and people. The narrative captures the essence of New York through its neighborhoods, iconic sites, and the unique experiences it offers to both residents and visitors. Keywords New York City, history, landmarks, culture, diversity, Manhattan, tourism, neighborhoods, Statue of Liberty, Empire State Building, Central Park Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 1680 New York CityManhattanStatue of LibertyEmpire State BuildingCentral Parkcity historytourismneighborhoodsdiversityTimes SquareBrooklyn BridgeConey Island1970s fashionmuseumsWall Street https://avgeeks.videonest.co/videos/455073/wingate-i-love-you-1973 https://img.videonest.org/gamma/455073_thumbnail_resized_v2.webp https://gamma.videonest.org/455073_video_v3.mp4 Wingate, I Love You (1973) **Wingate, I Love You** (1973) is a 9-minute short film produced by Counterpoint Films. It tells the story of a young man who runs away from home due to family conflict. Through his journey, the film highlights the emotional consequences of unspoken feelings and underscores the importance of openly expressing love and affection within families. The message encourages communication and emotional honesty to heal and strengthen relationships. 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 557 Bus stationTicketDenverMisunderstandingFamily TroublesNephewfamily problemsrelationship adviceConcordiaFamily Films Production https://avgeeks.videonest.co/videos/455074/zuckuss-and-at-at-commander-action-figures-1982 https://img.videonest.org/gamma/455074_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455074/zuckuss-and-at-at-commander-action-figures-1982 Zuckuss and AT-AT Commander Action Figures (1982) TV advertisement for Kenner's Star Wars action figures, highlighting characters from "The Empire Strikes Back." It showcases the excitement of the Star Wars saga and the various figures available for purchase, emphasizing the adventure and conflict between characters like Luke Skywalker and the Imperial forces. Keywords Star Wars, Kenner, action figures, Empire Strikes Back, advertisement, nostalgia 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Star WarsKenneraction figuresEmpire Strikes BackTV advertisementnostalgia1982ZuckussAT-AT CommanderLuke Skywalker https://avgeeks.videonest.co/videos/455075/a-talent-for-tony-1971 https://img.videonest.org/gamma/455075_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455075/a-talent-for-tony-1971 A Talent For Tony (1971) A Talent for Tony(1971) is a 13-minute educational film from the "Parables Series", produced by the Franciscan Communications Center. The story follows five-year-old Tony, who struggles with self-doubt when his artist father asks him to draw. Initially paralyzed by fear of failure, Tony gradually learns that the most important talent is believing in himself. The film emphasizes self-confidence and personal growth through a gentle, parable-like narrative. 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 754 A Talent for Tonydrawingartfathersonself-confidencepaintingfine artcrayonsart festivalKirby Furlong1971educational filmparable https://avgeeks.videonest.co/videos/455076/hemp-for-victory-reel-2-1942 https://img.videonest.org/gamma/455076_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455076/hemp-for-victory-reel-2-1942 Hemp for Victory (Reel 2, 1942) The film details the process of harvesting hemp in Wisconsin, highlighting the use of modern machinery and traditional methods. It discusses the importance of proper timing and conditions for harvesting, the transition from hand-binding to mechanized processes, and the various applications of hemp, especially for military use during World War II. The film emphasizes the resurgence of hemp as a crucial resource for cordage and other products. Keywords hemp, harvesting, Wisconsin, machinery, World War II, cordage, agriculture, mechanization, military use Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-25T00:00:00.000Z yes A/V Geeks 16mm Films no 442 Hemp harvestHemp rettingFiber hempCordageParachute webbingKentucky HempAmerican HempCannabis SativaPlymouth Cordage CompanyBoston Navy YardHemp rope makingNaval usesManila hempRope walkship mooring https://avgeeks.videonest.co/videos/455077/hemp-for-victory-reel-1-1942 https://img.videonest.org/gamma/455077_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455077/hemp-for-victory-reel-1-1942 Hemp for Victory (Reel 1, 1942) This film discusses the historical significance and agricultural practices associated with hemp in America, particularly during World War II. It highlights hemp's long-standing use for cordage and textiles, its decline due to cheaper alternatives, and a resurgence in cultivation driven by wartime needs. The film serves as a guide for farmers on how to grow and harvest hemp, emphasizing the importance of soil quality, planting techniques, and harvesting methods. Keywords hemp, agriculture, World War II, farming, cordage, textiles, Kentucky, cultivation, harvesting, soil quality Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 410 HempHemp For VictoryHemp cultivationWorld War IIMaritimeKentuckyhemp for fiberhemp harvest1942Kentucky hemprettingagriculturetextilesfarmingcordage https://avgeeks.videonest.co/videos/455078/viking-1976 https://img.videonest.org/gamma/455078_thumbnail_resized_v2.webp https://gamma.videonest.org/455078_video_v3.mp4 Viking (1976) The Viking mission to Mars is a groundbreaking project involving sophisticated spacecraft designed to explore the planet's surface and atmosphere. Launched in 1975, Viking comprises an orbiter and lander that will conduct various scientific investigations, particularly focusing on the search for life. The mission's complexity includes precise orbital mechanics, automated landing procedures, and advanced imaging technology. Viking aims to answer critical questions about Mars' geology, atmosphere, and potential for life, while also providing stunning images of the Martian landscape. The success of this mission could reshape our understanding of life in the universe. Keywords Viking mission, Mars, spacecraft, orbiter, lander, life search, geology, atmosphere, NASA, Jet Propulsion Laboratory Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1702 Viking missionMarsSpace explorationViking lander projectNASAJet Propulsion LaboratoryMars landingLife on MarsViking 1Viking 2imaging instrumentsMars surfaceOlympus Monssoil samplesBiological organisms https://avgeeks.videonest.co/videos/455079/singing-puppets-christmas-program-1960s https://img.videonest.org/gamma/455079_thumbnail_resized_v2.webp https://gamma.videonest.org/455079_video_v3.mp4 [Singing Puppets Christmas Program, 1960s?] The film starts with a quintet of puppets singing a Gospel song. Then depicts the story of Mary and Joseph seeking shelter in Bethlehem during a census ordered by Caesar. Despite the busy inn being fully booked, they find refuge in a stable where Mary is about to give birth. The narrative emphasizes themes of kindness, gratitude, and the significance of humble beginnings, as the couple prepares for the arrival of their child. Keywords Mary, Joseph, Bethlehem, innkeeper, stable, census, Caesar, shelter, birth, kindness Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 433 puppet showpuppet quartetreligious themesGospel NewsinnkeeperinnBethlehemJoseph of NazarethKing CaesarMarystable https://avgeeks.videonest.co/videos/455080/kenners-star-wars-the-empire-strikes-back-action-figures-1981 https://img.videonest.org/gamma/455080_thumbnail_resized_v2.webp https://gamma.videonest.org/455080_video_v3.mp4 Kenner's Star Wars: The Empire Strikes Back action figures (1981) TV commercial for action figures from Kenner's Star Wars: The Empire Strikes Back collection. It highlights characters like Luke Skywalker, R2-D2, Ben Kenobi, and Yoda, emphasizing their unique features and the importance of each figure being sold separately. Keywords Star Wars, action figures, Kenner, Empire Strikes Back, Luke Skywalker, R2-D2, Yoda, Ben Kenobi 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Star WarsKennerEmpire Strikes BackLuke SkywalkerR2-D2YodaBen Kenobiaction figuresTV commercial1981vintage toys https://avgeeks.videonest.co/videos/455081/case-of-the-elevator-duck-1974 https://img.videonest.org/gamma/455081_thumbnail_resized_v2.webp https://gamma.videonest.org/455081_video_v3.mp4 Case Of The Elevator Duck (1974) In "Case of the Elevator Duck," a young boy named Gilbert finds a duck in his apartment building and decides to investigate its owner. He faces challenges from his mother, who is worried about the housing rules against pets. Gilbert's determination leads him on a humorous adventure through the building as he navigates the complexities of childhood, friendship, and responsibility, all while trying to save the duck from being taken to the animal shelter. Keywords detective, duck, apartment, children, adventure, pet, investigation, housing rules, friendship, responsibility 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1019 Elevator DuckLearning Corporation of AmericaGilbertanimal shelterduck petpublic housingvintageretroYoung boywhite duckelevatorapartment buildingchildrenfriendshipadventure https://avgeeks.videonest.co/videos/455082/assembly-line-footage-silent-1970s https://img.videonest.org/gamma/455082_thumbnail_resized_v2.webp https://gamma.videonest.org/455082_video_v3.mp4 Assembly Line Footage (silent, 1970s) Silent footage shows the sophisticated automated assembly line. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-24T00:00:00.000Z yes A/V Geeks 16mm Films no 1847 assembly linemanufacturingautomationindustrial processesautomated assemblyfactoryindustrial machinemetal partsconveyor beltprecision engineeringautomated machineryindustrial equipmentmetal componentssmall partselectrical parts https://avgeeks.videonest.co/videos/455083/californias-dawn-1960s https://img.videonest.org/gamma/455083_thumbnail_resized_v2.webp https://gamma.videonest.org/455083_video_v3.mp4 [California's Dawn, 1960s] The film chronicles the early history of California, highlighting the impact of Spanish colonization on Native Americans, the establishment of missions, and the subsequent changes brought about by Mexican rule and American expansion. It details the interactions between Spanish settlers, Native Americans, and Russian traders, as well as the eventual American occupation during the Mexican-American War. Key figures like John Sutter and Commodore Sloat are mentioned, culminating in the signing of the California Constitution and the state's path to becoming part of the United States. Keywords California, Spanish colonization, Native Americans, missions, Mexican rule, American expansion, John Sutter, Commodore Sloat, California Constitution, Mexican-American War Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 838 California historySpanish missionsNative AmericansMexican RepublicJohn SutterCommodore SloatMariano VallejoCalifornia ConstitutionAmerican expansionUS-Mexico Warland grantsFort RossFur tradeIndigenous laborGeneral Vallejo https://avgeeks.videonest.co/videos/455084/prime-minister-nobusuke-kishi-of-japan-1957 https://img.videonest.org/gamma/455084_thumbnail_resized_v2.webp https://gamma.videonest.org/455084_video_v3.mp4 Prime Minister Nobusuke Kishi of Japan (1957) The speech emphasizes the importance of fostering mutual understanding and cooperation between the United States and Asia, particularly Japan. It highlights the historical friendship between the U.S. and Japan, the cultural exchanges that have occurred, and the need for continued improvement in relations. The speaker encourages Americans to engage with Asian cultures through travel and personal experiences to bridge the existing gaps in knowledge and understanding. Keywords mutual understanding, cooperation, United States, Asia, Japan, cultural exchange, relations, travel, education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 344 Nobusuke KishiPrime MinisterJapanUnited StatesAsiaAsian-American FriendshipUS National CommissionSan FranciscoJapanese Peace TreatyPrime Minister of Japanvisiting JapanAsian cultureinternational relations https://avgeeks.videonest.co/videos/455085/star-wars-microcollection-bespin-world-playset-1981 https://img.videonest.org/gamma/455085_thumbnail_resized_v2.webp https://gamma.videonest.org/455085_video_v3.mp4 Star Wars Microcollection Bespin World playset (1981) A promotional advertisement for the Star Wars Microcollection line, showcasing the Bespin World playset. It highlights the various components, including 16 diecast figures and action poses, and demonstrates how to connect different playsets. The ad emphasizes the interactive features, such as the Bestpin freeze chamber, and promotes the figures as sold separately, produced by Kenner. Keywords Star Wars, Microcollection, Bespin World, playset, diecast figures, Kenner, action poses, freeze chamber 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 31 Star WarsMicrocollectionBespin Worldplaysetdiecast figuresKenneraction posesfreeze chamber1981Lucasfilmvintage toyscollectible toys https://avgeeks.videonest.co/videos/455086/boy-who-liked-deer-1975 https://img.videonest.org/gamma/455086_thumbnail_resized_v2.webp https://gamma.videonest.org/455086_video_v3.mp4 Boy Who Liked Deer (1975) The film revolves around a young boy, Jason, who is passionate about caring for deer. He faces challenges at school, including vandalism incidents and academic pressures. As he navigates friendships and responsibilities, he is encouraged to help with a summer youth program. The story highlights themes of empathy, the importance of education, and the consequences of misbehavior among peers. Keywords deer, youth program, vandalism, empathy, education, friendship, responsibility Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 1101 deerfeeding deerdeer parkvandalismschoolclassroomteenagersummer schoolyouth programempathyfriendshipresponsibilityeducationThe Boy Who Liked DeerE.E. Cummings https://avgeeks.videonest.co/videos/455087/smiley-1979 https://img.videonest.org/gamma/455087_thumbnail_resized_v2.webp https://gamma.videonest.org/455087_video_v3.mp4 Smiley (1979) "Smiley" is a heartwarming story about a boy named Jesse who discovers a friendly dog without a collar and names her Smiley. As Jesse and his family take care of Smiley, they hope to find her owner, but she becomes a beloved part of their lives. After a week of bonding, Smiley runs away, leaving Jesse heartbroken. However, she is eventually found and returned to her original owner, bringing a bittersweet conclusion to Jesse's experience with the dog he grew to love. Keywords dog, boy, friendship, lost pet, family, heartwarming, return, owner, bond, bittersweet 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 1160 Smileydoglost dogfound dogpetfamilyfriendshipreunionpet lossdog running awaymaking signspet adoptionkidsJessloss https://avgeeks.videonest.co/videos/455088/new-york-subways-silent-1960s https://img.videonest.org/gamma/455088_thumbnail_resized_v2.webp https://gamma.videonest.org/455088_video_v3.mp4 [New York Subways, silent, 1960s] This 1960s footage of the New York City subway captures a rich and reflective portrait of urban life in mid-century America. The film showcases a series of quiet, atmospheric scenes both inside subway cars and around the stations, emphasizing the routines and rhythms of daily commuting. Passengers—men in suits, women in dresses, children, and elderly alike—sit reading newspapers, stand holding onto poles, or gaze out of windows in dimly lit and retro-styled interiors. The visuals evoke a sense of nostalgia and contemplation, highlighting both the isolation and community of public transit. Above ground and in stations, transitions up and down staircases reinforce the movement and flow of city life. Together, these moments form a timeless, cinematic meditation on commuting, identity, and the shared space of New York’s underground. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-23T00:00:00.000Z yes A/V Geeks 16mm Films no 333 New York Citysubwaymass transitcommutingpublic transportationurban lifeSubway stationpublic transitCommuting https://avgeeks.videonest.co/videos/455089/empire-strikes-back-rebel-transport-and-action-figures-commercial-1981 https://img.videonest.org/gamma/455089_thumbnail_resized_v2.webp https://gamma.videonest.org/455089_video_v3.mp4 Empire Strikes Back Rebel Transport and Action Figures Commercial (1981) A commercial for action figures from the Star Wars: The Empire Strikes Back collection. It showcases a scenario involving a prisoner escape, a Rebel Transport capable of holding multiple action figures, and various accessories like backpacks and gas masks. The dialogue hints at a classic chase and clever tactics between characters, emphasizing the fun of assembling and playing with these toys. Keywords Star Wars, action figures, Empire Strikes Back, Rebel Transport, prisoner escape, toys, adventure, assembly required 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Star Warsaction figuresKennerEmpire Strikes BackRebel Transport1980svintage toys https://avgeeks.videonest.co/videos/455090/handy-dandy-do-it-yourself-filmmaking-film-1974 https://img.videonest.org/gamma/455090_thumbnail_resized_v2.webp https://gamma.videonest.org/455090_video_v3.mp4 Handy Dandy Do-It-Yourself Filmmaking Film (1974) The film follows a school project where students learn to use Super Eight cameras and other filming equipment to create a movie about jousting, Maryland's official state sport. They discuss the technical aspects of filming, including camera settings, using a light meter, and capturing sound with a tape recorder. The students emphasize the importance of planning, shooting from different angles, and the joy of filmmaking. Ultimately, they highlight that shooting is just the beginning, as editing will transform their footage into a finished film. Keywords Super Eight, filmmaking, jousting, school project, camera techniques, editing, sound recording, Maryland, student film 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 646 Super 8 camerasfilmmakingjoustingcamera techniquesvintage camerasfilm tutoriallight metertape recorderzoom lensexposure meterHoneywell Elmokodachrome 2photography equipmentfilm creditscamera https://avgeeks.videonest.co/videos/455091/shape-hunting-circlessemicircles-ellipses https://img.videonest.org/gamma/455091_thumbnail_resized_v2.webp https://gamma.videonest.org/455091_video_v3.mp4 Shape Hunting: Circles,Semicircles, Ellipses Explores the characteristics of geometric shapes, focusing on circles, semicircles, and ellipses. It explains that a circle is a closed curve with a consistent distance from its center, while a semicircle is half of a circle. The video also highlights the differences between circles and ellipses, noting that ellipses do not have a single center point equidistant from all points. Keywords circles, semicircles, ellipses, geometry, shapes, radius, diameter, circumference, hunting Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 460 Shape HuntingCirclesSemicirclesEllipsesgeometryshapesCoronet Instructional Mediaeducational videoellipseshapes huntingradiusdiametercircumferenceorbital mechanics https://avgeeks.videonest.co/videos/455092/ink-paint-scratch-1979 https://img.videonest.org/gamma/455092_thumbnail_resized_v2.webp https://gamma.videonest.org/455092_video_v3.mp4 Ink, Paint, Scratch (1979) This short educational film from Little Red Filmhouse introduces viewers to the vibrant world of camera-less animation. In just 11 minutes, it showcases three creative examples of animation made entirely by drawing, painting, and scratching directly onto film stock. Designed as an instructional resource, the film emphasizes how simple classroom materials can be used to produce expressive and visually striking animated works. With its energetic tone and hands-on demonstrations, it's both a fun watch and an effective teaching tool—perfect for budding animators or educators exploring experimental film techniques. 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 610 Ink Paint Scratchcamera-less filmmakinganimation techniquesexperimental filmdrawing animationfilm animation processvintage animationfilm techniquesRobert SwartheRobert Swarthfilm stripsvisual musicold filmfilm grainfilm damage https://avgeeks.videonest.co/videos/455093/little-lost-burro-1982 https://img.videonest.org/gamma/455093_thumbnail_resized_v2.webp https://gamma.videonest.org/455093_video_v3.mp4 Little Lost Burro (1982) In a hot desert, a young burro named Blanco is separated from his mother when she is captured by prospectors. Alone and lost, Blanco struggles to find food and companionship, following a rabbit that eventually abandons him. After facing dangers and loneliness, Blanco finally reunites with his mother, who is now working with a prospector, ensuring they will stay together. Keywords burro, desert, mother, separation, prospectors, friendship, loneliness, reunion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 554 wild burroprospectorlittle lost burroparentingrattlesnakecactusBlancobobcatdesert wildlifeanimal friendshipsreunitingghost townburrodesertmother https://avgeeks.videonest.co/videos/455094/night-driving-footage-silent-1970s https://img.videonest.org/gamma/455094_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455094/night-driving-footage-silent-1970s Night Driving footage [silent, 1970s] Raw outtake footage from a film about driving at night. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 346 roadnightcardrivingcity lightsvintage filmcar drivingnight drivecity skylinehighwaytravel https://avgeeks.videonest.co/videos/455095/retail-sales-film-luggage-1960s https://img.videonest.org/gamma/455095_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455095/retail-sales-film-luggage-1960s [Retail Sales Film - Luggage, 1960s] The film showcases a sales training scenario focusing on selling luggage. A salesman demonstrates how to effectively engage customers by highlighting the advantages of quality luggage for business and travel needs. The importance of making logical suggestions to encourage additional purchases is emphasized, illustrating how a well-timed recommendation can enhance customer satisfaction and boost sales. Keywords sales training, luggage, customer engagement, quality, business travel, suggestions, additional purchases Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-21T00:00:00.000Z yes A/V Geeks 16mm Films no 275 sales trainingluggagecustomer engagementbusiness travelsales techniquesupselling1960s https://avgeeks.videonest.co/videos/455096/at-at-all-terrain-armored-transport-toy-commercial-1982 https://img.videonest.org/gamma/455096_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455096/at-at-all-terrain-armored-transport-toy-commercial-1982 AT-AT (All Terrain Armored Transport) toy commercial (1982) Features the AT-AT (All Terrain Armored Transport) toy from Kenner, showcasing its interactive features such as walking, crushing obstacles, and scanning for rebels. It highlights the toy's cockpit, laser cannons with lights and sounds, and a troop compartment, all inspired by "The Empire Strikes Back." Keywords ATA, All Terrain Armored Transport, Kenner, Star Wars, Empire Strikes Back, action figures, interactive toy, laser cannons, cockpit, troop compartment 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 30 AT-ATKennerStar WarsEmpire Strikes Backtoy commercialvintage toysaction figures1982All Terrain Armored Transport https://avgeeks.videonest.co/videos/455097/maturing-female-1970 https://img.videonest.org/gamma/455097_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/455097/maturing-female-1970 Maturing Female (1970) The film portrays the struggles of a teenage girl named Kathy as she navigates the challenges of growing up, particularly the conflicts with her parents regarding her independence and social life. Kathy's relationship with a boy named Doug raises concerns for her father, who worries about her safety and reputation. The dialogue highlights the generational gap in perceptions of dating and behavior, as Kathy seeks more freedom while her parents impose stricter rules. Keywords teenage girl, parental conflict, dating, independence, generational gap, growing up, reputation, family dynamics 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 765 Teenage lifeFamily LivingTeen issuesFamily issuesfather daughterrelationship troublesDoug TurnerOver protectiveparentingpeer pressurepersonal valuespopularitysocial issuesdatingindependence https://avgeeks.videonest.co/videos/455098/sources-of-art-1967 https://img.videonest.org/gamma/455098_thumbnail_resized_v2.webp https://gamma.videonest.org/455098_video_v3.mp4 Sources Of Art (1967) Art is a fundamental form of human expression, reflecting the artist's perception of the world. It can convey emotions, beauty, and various themes such as hunger, fear, and mystery. Artists draw inspiration from their environment, using basic elements like line, color, shape, and texture to create their work. Each element plays a crucial role in conveying mood and meaning, with no two artists interpreting the world in the same way. The combination of these elements allows artists to communicate their feelings and experiences through their art. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 575 Sources of ArtBailey Films IncArt historyArt appreciationArt educationVincent Van GoghPablo PicassoSt. Louis City Art MuseumVisual ArtsPaintingSculptureShapeTexture https://avgeeks.videonest.co/videos/455099/wood-joints-1960s https://img.videonest.org/gamma/455099_thumbnail_resized_v2.webp https://gamma.videonest.org/455099_video_v3.mp4 [Wood Joints , 1960s] Discusses various woodworking joints, focusing on techniques for creating strong and accurate connections. It emphasizes the importance of precise cuts and square edges for joints like end joints, butt joints, rabbit joints, dado joints, groove joints, dowel joints, and lap joints. Key steps include cleaning surfaces, applying glue, using appropriate fasteners (screws or nails), and ensuring the pieces fit flush and square. The tutorial also highlights the use of tools like marking gauges, chisels, and tri squares to achieve accurate measurements and cuts. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 792 wood jointend butt jointrabbit jointdado jointgroove jointlap jointswoodworkingwoodworking techniquesmarking gaugetry squareback sawwood gluewood dowelssquare wood https://avgeeks.videonest.co/videos/455100/transformer-fire-extinguisher-1939-silent https://img.videonest.org/gamma/455100_thumbnail_resized_v2.webp https://gamma.videonest.org/455100_video_v3.mp4 Transformer- Fire Extinguisher (1939, silent) In this 1939 silent, industrial safety or firefighting demonstration film, a series of controlled fire tests are conducted at an industrial plant under the watchful eyes of technicians and observers. Men in work attire observe flames burning within a containment area as a man sequentially holds up placards marked with numbers—possibly indicating time, temperature, or experiment stages. A caption explains that oil is deliberately spilled over the sides of a tank, escalating the blaze. Subsequent captions document the test’s progress, noting the use of CO2 to suppress the fire. Thick smoke fills the frame as men cautiously approach the area, and a crowd of onlookers gathers. A “SECOND TEST” begins, repeating the setup with a larger burning object, again observed carefully by workers and technicians. White smoke and bright flames mark the intensity of the fire, and the scene becomes increasingly chaotic as men gesture and move through the smoke. Captions refer to the broader implications of such fires, including the threat of brush fires, and the film concludes with a crowd examining the burned remains and a final “SUMMARY” caption, likely reviewing the test’s outcomes or recommended procedures. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 593 Cardoxoil firefire safetyfire extinguishmentcarbon dioxideChicago IllinoisCO2 extinguisherfire suppressioncontrolled burnengineering test https://avgeeks.videonest.co/videos/455101/enterprise-usa-1940s https://img.videonest.org/gamma/455101_thumbnail_resized_v2.webp https://gamma.videonest.org/455101_video_v3.mp4 Enterprise USA (1940s) The story of Buchanan, a small town that once thrived on cotton farming but faced economic decline as the soil became depleted. The community recognized the need for change and embarked on a fundraising effort to attract industry to create jobs. After overcoming challenges, they successfully built a factory, which revitalized the town by providing employment and fostering a sense of teamwork and pride among residents. The factory's success led to increased prosperity, new infrastructure, and a return of young people to the town, demonstrating the importance of enterprise and hard work in achieving economic growth. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 1598 Buchanan GeorgiaHaralson CountyCotton farmingLocal IndustryFactoryTown ProsperityCluett PeabodyArrow CompanyJob opportunitiesAmerican flagFactory WorkTextile Industrylocal economyTeamworkAmerican prosperity https://avgeeks.videonest.co/videos/455102/av-geeks-16mm-lunch-5-26-2025 https://img.videonest.org/gamma/455102_thumbnail_resized_v2.webp https://gamma.videonest.org/455102_video_v3.mp4 AV Geeks 16mm Lunch 5-26-2025 Honor our fallen service members by ensuring their sacrifice was not in vain. #avgeeks #16mmfilms Return of WWII Dead, 1948 Mars and Beyond Memo to Mars Trail of the Rocket 2025-05-27T00:00:00.000Z yes A/V Geeks 16mm Films no 5100 World War IIMarsNASARocket engineOldsmobileSpace ExplorationMilitarySaipanAutomobilesCarHighwayScience fictionAssembly lineMass productionAV Geeks https://avgeeks.videonest.co/videos/455103/av-geeks-16mm-lunch-5-19-2025 https://img.videonest.org/gamma/455103_thumbnail_resized_v2.webp https://gamma.videonest.org/455103_video_v3.mp4 AV Geeks 16mm Lunch 5-19-2025 Bringing classroom nostalgia to your lunch hour! #avgeeks #16mmfilms Southwest US and Petroglyphs Smiley Turning Points 2025-05-20T00:00:00.000Z yes A/V Geeks 16mm Films no 4403 16mm filmSouthwest USApetroglyphsSmiley dogfamily1979 filmUS Southwestdogfilm projectorancient ruinscanyon landscapeturning pointseducationcareerA/V Geeks https://avgeeks.videonest.co/videos/455104/edisons-first-movie-from-zoetrope-to-dancing-figure https://img.videonest.org/gamma/455104_thumbnail_resized_v2.webp https://gamma.videonest.org/455104_video_v3.mp4 Edison's First Movie: From Zoetrope to Dancing Figure! 2025-05-22T00:00:00.000Z yes A/V Geeks 16mm Films no 26 EdisonFilm HistoryZoetropeFred OttEarly CinemaMotion PictureVintage Footage https://avgeeks.videonest.co/videos/455105/number-1s-wild-transformation-wife-hates-it-rational-numbers-explained https://img.videonest.org/gamma/455105_thumbnail_resized_v2.webp https://gamma.videonest.org/455105_video_v3.mp4 Number 1's Wild Transformation: Wife Hates It! (Rational Numbers EXPLAINED) 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 32 Rational NumbersEducational AnimationMath ConceptsNumber StoriesNumber TransformationVisual Math https://avgeeks.videonest.co/videos/455106/satellite-creature-impregnation-and-alligator-attack-lonely-road-horror https://img.videonest.org/gamma/455106_thumbnail_resized_v2.webp https://gamma.videonest.org/455106_video_v3.mp4 Satellite Creature Impregnation & Alligator Attack! Lonely Road Horror 2025-05-19T00:00:00.000Z yes A/V Geeks 16mm Films no 28 Satellite CreatureAlligator AttackLonely RoadHorror MoviesCreature FeatureGiant Gila MonsterSuspenseful ScenesBody Horror https://avgeeks.videonest.co/videos/457474/av-geeks-16mm-lunch-5-27-2025 https://img.videonest.org/gamma/m3AQHw73cvc_thumbnail_resized_v2.webp https://gamma.videonest.org/m3AQHw73cvc_video_v3.mp4 AV Geeks 16mm Lunch 5-27-2025 Long holiday weekend hangover? We might have the cure! Watch our 16mm films and find out! #avgeeks #16mmfilms 2025-05-27T00:00:00.000Z yes A/V Geeks 16mm Films no 4141 16mm filmvintage filmcoffeesquare dancingaviationfilm projectorschool eventcoffee brewingairplaneelectronic musicthereminpuppet showbusiness travelvintage animationmusical instruments https://avgeeks.videonest.co/videos/457521/teenage-egocentrism-why-they-think-the-world-revolves-around-them https://img.videonest.org/gamma/E9mbEx8mlD0_thumbnail_resized_v2.webp https://gamma.videonest.org/E9mbEx8mlD0_video_v3.mp4 Teenage Egocentrism: Why They Think The World Revolves Around Them 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no Teenage EgocentrismAdolescent PsychologyTeenage BehaviorUnderstanding TeenagersTeenage DevelopmentParenting TeensTeenage MindsetEgocentrismSocial PsychologyTeen Life https://avgeeks.videonest.co/videos/457533/hojas-strange-ways-1950s https://img.videonest.org/gamma/a3Sk8xfM048_thumbnail_resized_v2.webp https://gamma.videonest.org/a3Sk8xfM048_video_v3.mp4 Hoja's Strange Ways (1950s) The film narrates the story of Nasr-ed-din Hoja, a wise but unconventional man chosen to be a judge in his village. Faced with the challenge of proving his wisdom to the Emperor Tamarlain, he cleverly devises a plan involving his donkey to demonstrate his intelligence. Through humor and wit, the tale emphasizes the importance of understanding and respecting different perspectives and ways of life, illustrating that what may seem strange can often hold valuable wisdom. Keywords Nasr-ed-din Hoja, wisdom, Emperor Tamarlain, donkey, cultural understanding, humor, storytelling, village judge Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 656 Nasr-ed-din HojaTales Of Nasr-ed-dinpuppet showanimated puppet showTamerlanedonkeywise manvillagerUSISNasreddin HojapuppetAnimatedShort filmAnimated Filmfoolish act https://avgeeks.videonest.co/videos/457547/empire-strikes-back-scout-walker-1981 https://img.videonest.org/gamma/l4BUCLjJN6U_thumbnail_resized_v2.webp https://gamma.videonest.org/l4BUCLjJN6U_video_v3.mp4 Empire Strikes Back Scout Walker (1981) Advertisement for Kenner's Star Wars: The Empire Strikes Back toy line. It features action figures and vehicles, showcasing their features and encouraging viewers to purchase them. The narrative includes a battle scenario with characters preparing for combat and maintaining their equipment. Keywords Star Wars, Kenner, toys, advertisement, action figures, The Empire Strikes Back, battle, vehicle maintenance 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 30 Star WarsKennertoysadvertisementaction figuresThe Empire Strikes BackScout Walkervehicle maintenance energizer1980svintage toys https://avgeeks.videonest.co/videos/457565/lost-river-1951 https://img.videonest.org/gamma/_T5J23vHuL8_thumbnail_resized_v2.webp https://gamma.videonest.org/_T5J23vHuL8_video_v3.mp4 Lost River (1951) The film discusses the importance of water conservation in the western United States, emphasizing how the region's agriculture and industry depend on effective irrigation systems. It highlights the historical efforts made by pioneers and federal projects to reclaim land from the desert through irrigation. The film addresses challenges such as water loss due to seepage and inefficient management, while promoting strategies for better water use and conservation. It concludes that effective management and conservation of water resources can significantly enhance agricultural productivity and economic prosperity in the West. Keywords water conservation, irrigation, western United States, agriculture, water management, reclamation, seepage, efficiency, economic prosperity Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1327 water conservationirrigation systemswater resourceswater managementWestern USAreclamationagricultural productionUS Bureau of Reclamationcanal managementsoil conservationefficient farmingfederal reclamationdrainage waterreservoir managementflood control https://avgeeks.videonest.co/videos/457588/av-geeks-16mm-lunch-5-28-2025 https://img.videonest.org/gamma/wKYmUQG1o9s_thumbnail_resized_v2.webp https://gamma.videonest.org/wKYmUQG1o9s_video_v3.mp4 AV Geeks 16mm Lunch 5-28-2025 Grey outside, but flickering warm light on the inside! #avgeeks #16mmfilms 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 3964 16mm filmAV GeeksUnited Statesdrug abusesafety practiceseducational filmoffice safetyWorld War IIfamily lifeaddictionpeer pressureretrovintage adsindustrial filmfilm reel https://avgeeks.videonest.co/videos/457605/kenners-fast-ones-mustangs-1981 https://img.videonest.org/gamma/d9903qKZNqg_thumbnail_resized_v2.webp https://gamma.videonest.org/d9903qKZNqg_video_v3.mp4 Kenner's Fast Ones - Mustangs (1981) The film presents a mini racing scene featuring Kenner's Fast Ones toy cars, specifically Mustangs. The competition heats up as Little Lou and Fred race to determine the winner, showcasing the excitement of drag racing with the Fast Burnout Alley set that includes two Mustangs. Keywords Toys, Racing, Mustangs, Kenner, Fast Ones, Competition, Burnout Alley, Mini Racing 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 32 ToysRacingMustangsKennerFast OnesCompetitionBurnout AlleyMini RacingToy CarsDrag Racing1980sVintage ToysToy Set https://avgeeks.videonest.co/videos/457638/information-explosion-the-1966 https://img.videonest.org/gamma/0X036Q5JjIA_thumbnail_resized_v2.webp https://gamma.videonest.org/0X036Q5JjIA_video_v3.mp4 INFORMATION EXPLOSION, THE (1966) The film discusses the impact of technology on information accessibility and communication in society. It highlights the importance of free exchange of ideas for democracy, the role of rapid information dissemination in various fields like government and medicine, and the necessity of teaching individuals, especially children, to critically evaluate the overwhelming amount of information they encounter. The narrative emphasizes the need for educators to adapt to the changing media landscape and foster independent thinking among students. Keywords information explosion, technology, communication, democracy, education, media literacy, critical thinking, rapid dissemination, medical education, societal impact Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1638 information explosiontechnologycommunicationdemocracyeducationmedia literacycritical thinkingrapid disseminationmedical educationOhio State UniversityEdgar DaleMarshall McLuhantelevisionbooksfilm https://avgeeks.videonest.co/videos/457652/einstein-silent-footage-1940s https://img.videonest.org/gamma/L9FFP8WO8vc_thumbnail_resized_v2.webp https://gamma.videonest.org/L9FFP8WO8vc_video_v3.mp4 [Einstein, silent footage, 1940s] Einstein, silent footage, 1940s Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 679 Albert EinsteinFranklin D. Roosevelt19391940sletter writingF. D. Rooseveltnuclear fissionNational Bureau of Standardsmeetingmen in suitsconferencevintageblack and whiteLong Islandsmoking a pipe https://avgeeks.videonest.co/videos/457654/a-look-at-soviet-agriculture-1959 https://img.videonest.org/gamma/b4vJoMa-oho_thumbnail_resized_v2.webp https://gamma.videonest.org/b4vJoMa-oho_video_v3.mp4 A LOOK AT SOVIET AGRICULTURE (1959) This film documents a visit by a U.S. Department of Agriculture delegation to various agricultural regions in the Soviet Union, showcasing the country's diverse farming practices and challenges. The delegation explored the North Caucasus, Ukraine, Crimea, Uzbekistan, Kazakhstan, and Siberia, observing mechanization in wheat production, the predominance of women in agriculture, and limitations in storage facilities. They noted advancements in oilseed crops and livestock research, especially in dairying. The film highlights the Soviet Union's efforts to improve agricultural output and mechanization, while acknowledging that it still lags behind the United States in overall production. Keywords Soviet Union, agriculture, U.S. Department of Agriculture, mechanization, wheat production, women workers, livestock, oilseed crops, storage facilities, farming regions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1093 Soviet AgricultureUSSR AgricultureSoviet UnionWheat HarvestingLivestock ProductionFarm MechanizationOilseed CropsCollective FarmingUSDAUkrainian cropsUzbek RepublicMilk ProductionMeat ProductionScientific ResearchAgricultural Production https://avgeeks.videonest.co/videos/457671/king-rollo-and-the-bread-1979 https://img.videonest.org/gamma/kUlovyEkgFg_thumbnail_resized_v2.webp https://gamma.videonest.org/kUlovyEkgFg_video_v3.mp4 King Rollo And The Bread (1979) In this whimsical tale, King Rollo and a magician encounter a farmer who is content with his simple loaf of bread. King Rollo, eager to demonstrate the magician's skills, suggests various extravagant dishes, each magically transformed by the magician. However, the farmer repeatedly requests his bread back, expressing his fondness for it. Ultimately, the magician restores the bread, and the farmer invites them to enjoy it, praising both the magician's talent and his wife's baking. Keywords King Rollo, magician, farmer, bread, magic, food transformation, chocolate cake, spaghetti, ice cream, simplicity 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 329 King Rollobreadmagicfarmerfood transformationDavid McKeekingcartoonwizardLeo BeltoitRay BrooksDuncan LamontClive JusterKing Rollo Films Ltd.Perspective Films https://avgeeks.videonest.co/videos/457674/getting-ready-emotionally-1951 https://img.videonest.org/gamma/ss-3BOpGiS8_thumbnail_resized_v2.webp https://gamma.videonest.org/ss-3BOpGiS8_video_v3_360.mp4 Getting Ready Emotionally (1951) The film discusses the emotional adjustments high school students must make when transitioning to military service. It highlights the challenges of taking orders, facing homesickness, and developing self-discipline. The narrator encourages viewers to prepare emotionally for military life by taking stock of their behaviors, accepting responsibilities, and learning to deal with criticism. It emphasizes that many have successfully navigated these changes and that preparation can ease the transition. Keywords military service, emotional adjustment, self-discipline, taking orders, homesickness, responsibility, preparation, high school, life changes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 624 emotional preparednessmilitary serviceemotional adjustmentself-disciplinetaking ordershomesicknessmilitary lifemilitary trainingpersonal growthlife skillshigh schoolyoung menCoronet Filmmilitary disciplinepreparation https://avgeeks.videonest.co/videos/457701/kenners-star-wars-the-empire-strikes-back-toy-collection-1982 https://img.videonest.org/gamma/v5ytvhcwdRE_thumbnail_resized_v2.webp https://gamma.videonest.org/v5ytvhcwdRE_video_v3_360.mp4 Kenner's Star Wars: The Empire Strikes Back toy collection (1982) The film features a promotional advertisement for Kenner's Star Wars: The Empire Strikes Back toy collection, showcasing various action figures, vehicles, and characters from the franchise. It highlights iconic items like the rebel transport, AT-AT, and Slave One, appealing to parents and children alike by emphasizing the adventure and excitement of the Star Wars universe. Keywords Star Wars, Empire Strikes Back, Kenner, toys, action figures, advertisement, galaxy, adventure, vehicles 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 60 Star WarsEmpire Strikes BackKennerToysAction FiguresVintageAdvertisementRebel TransportAT-ATSlave Onetoy commercial1982 https://avgeeks.videonest.co/videos/457727/av-geeks-16mm-lunch-5-29-2025 https://img.videonest.org/gamma/EMguXcanxgA_thumbnail_resized_v2.webp https://gamma.videonest.org/EMguXcanxgA_video_v3_360.mp4 AV Geeks 16mm Lunch 5-29-2025 Oof.. technology is conspiring against us today. But we will persevere by showing you 16mm films! #avgeeks #16mmfilms 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 4670 16mm filmvintage videoanimationeducationdocumentarychildrenarchive spaceschool childrenexperimental videopuppet showNasreddin Hodjaaviation industrycancer researchThe Wizard of OzA/V Geeks https://avgeeks.videonest.co/videos/457740/birds-in-winter-2nd-ed-1975 https://img.videonest.org/gamma/trqdVdgAlCc_thumbnail_resized_v2.webp https://gamma.videonest.org/trqdVdgAlCc_video_v3_360.mp4 Birds In WInter (2nd Ed, 1975) The film focuses on winter bird watching, highlighting the importance of backyard feeding stations for attracting various bird species during cold months. It emphasizes how providing food, water, and shelter helps birds survive winter. The narrator shares insights on identifying different birds, such as cardinals, gross beaks, tit mice, chickadees, sparrows, and woodpeckers, detailing their characteristics and behaviors. The film showcases the joy and fulfillment of bird watching and the positive impact of feeding birds in winter. Keywords bird watching, winter, feeding stations, survival, identification, cardinals, gross beaks, tit mice, chickadees, sparrows, woodpeckers Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 641 bird watchingwinter birdsbird feedercardinalevening grosbeakTufted TitmouseBird IdentificationChickadeeHouse SparrowFox SparrowBlue JayDowny WoodpeckerWhite-breasted Nuthatchwinter survivalbird habits https://avgeeks.videonest.co/videos/457764/water-spiders-silent-1970s https://img.videonest.org/gamma/9t9aM1vBY0g_thumbnail_resized_v2.webp https://gamma.videonest.org/9t9aM1vBY0g_video_v3_360.mp4 Water Spiders (silent, 1970s) An educational film documenting a young boy’s exploration of aquatic and semi-aquatic spiders in their natural and controlled environments. Beginning with the boy collecting specimens from a stream using a net, the film shifts to close-up footage of spiders in an aquarium, showcasing their behavior in detail. Scenes include spiders spinning webs on plants, capturing and dragging prey, building and defending egg sacs, and interacting with other creatures like worms and cockroaches. The film provides a careful, observational look at spider behavior and lifecycle, emphasizing their adaptability and predatory skills within a miniature aquatic ecosystem. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 584 Water spiderspider behavioraquatic habitatpond lifespideraquatic insectsegg sacanimal adaptationbubble nestCoronet Filmsunderwater habitatinsect https://avgeeks.videonest.co/videos/457788/michelangelo-1964 https://img.videonest.org/gamma/ue8nlvvsFqk_thumbnail_resized_v2.webp https://gamma.videonest.org/ue8nlvvsFqk_video_v3_360.mp4 Michelangelo (1964) This film presents a detailed account of the life and artistic journey of Michelangelo, focusing on his development as a master in painting, sculpture, and architecture. It highlights his early influences in Florence, his apprenticeship, his significant works including the statue of David and the Sistine Chapel, and his struggles with the commissions he received from various Popes. The narrative emphasizes Michelangelo's relentless pursuit of perfection, his artistic philosophies, and the challenges he faced throughout his career, culminating in his lasting legacy in the world of art. Keywords Michelangelo, art, sculpture, painting, architecture, Florence, David, Sistine Chapel, Pope, legacy LIMITED DISTRIBUTION. 2025-05-30T00:00:00.000Z yes A/V Geeks 16mm Films no 1819 MichelangeloRenaissance artRenaissance sculptureItalian RenaissanceFlorenceSistine ChapelSculpturePaintingArchitectureDavidPope JuliusItalian ArtRomeMarble SculptureAntique Statues https://avgeeks.videonest.co/videos/457811/king-rollo-and-the-balloons-1979 https://img.videonest.org/gamma/1kZFBzp-UU4_thumbnail_resized_v2.webp https://gamma.videonest.org/1kZFBzp-UU4_video_v3_360.mp4 King Rollo And The Balloons (1979) King Rollo discovers three balloons in his drawer and asks Cook and a magician for help in blowing them up, but they are busy. After struggling, he successfully inflates a green balloon, which flies around the room and out the window. He continues to blow up a blue balloon and a long yellow one. Meanwhile, the magician is attempting to make a pie vanish. A loud bang draws their attention, and King Rolo claims he was practicing magic, stating he can make a balloon disappear. Keywords King Rollo, balloons, magician, Cook, magic, children's film, animation 2025-05-30T00:00:00.000Z yes A/V Geeks 16mm Films no 328 King RolloanimationballooncookmagicianDavid McKeechildren's filmcartooninflateblowingRay BrooksDuncan LamontClive JusterLeo Beltoit https://avgeeks.videonest.co/videos/457887/ballets-golden-age-1830-1845-1957 https://img.videonest.org/gamma/36aPd8hg3sc_thumbnail_resized_v2.webp https://gamma.videonest.org/36aPd8hg3sc_video_v3_360.mp4 Ballet's Golden Age 1830-1845 (1957) We scanned this so you could see the optical soundtrack. The film captures the enchanting world of ballet in the early 19th century, highlighting the beauty and artistry of renowned dancers such as Madame Celeste, Madame Cherito, and Mary Talioni. It discusses the dedication, discipline, and emotional depth required to excel in ballet, showcasing the mesmerizing performances that captivated audiences. The narrative reflects on the evolution of ballet as an art form, emphasizing the physical grace and technical prowess of the dancers, while also hinting at the personal sacrifices they made for their craft. Keywords ballet, dancers, beauty, artistry, performance, discipline, history, emotion, elegance, 19th century 2025-05-30T00:00:00.000Z yes A/V Geeks 16mm Films no 581 Ballet's Golden Ageballet historydance performanceFanny ElsslerMademoiselle CelesteBallet costumesMarie TaglioniballerinaFilippo TaglioniballetLa SylphideSpanish dancedance historycultural heritage19th century https://avgeeks.videonest.co/videos/457911/fannys-wedding-day-1933 https://img.videonest.org/gamma/q0TQKhSgnTI_thumbnail_resized_v2.webp https://gamma.videonest.org/q0TQKhSgnTI_video_v3.mp4 Fanny's Wedding Day (1933) In this fifth installment of the Fanny Zilch operatic melodrama from Terrytoons, characters J. Leffingwell Strongheart and Fanny reach the altar to marry, while the antagonist Oil Can Harry plots to disrupt the wedding and claim Fanny for himself. 2025-05-31T00:00:00.000Z yes A/V Geeks 16mm Films no 310 Fannywedding dayclassic cartoonanimated shortcomedycartoonblack and whiteclassical musicanimationOne Gun Garrycarrying https://avgeeks.videonest.co/videos/457919/personal-hygiene-for-boys-2nd-ed-1971 https://img.videonest.org/gamma/MzfR5HUFnss_thumbnail_resized_v2.webp https://gamma.videonest.org/MzfR5HUFnss_video_v3.mp4 Personal Hygiene For Boys (2nd Ed, 1971) A 1960s educational hygiene film that compares the human body to a machine, emphasizing the importance of taking care of it both inside and out. The film encourages adolescents to prioritize personal health through regular exercise, a balanced diet, sufficient sleep, and daily cleanliness. It covers practical hygiene tips like bathing, using deodorant, caring for skin and hair, shaving, and brushing teeth, while also warning against the misuse of drugs, alcohol, and tobacco. With humor and relatability—often referencing a character named Rick who cares more for his car than himself—the film urges viewers to maintain a clean appearance and healthy habits to feel and look their best. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-31T00:00:00.000Z yes A/V Geeks 16mm Films no 653 personal hygieneexercisebalanced dietsleepgroomingbody odorathlete's foothygiene practicesacne preventionshampooing hairbody careshaving tipsdrug misusealcohol misuseoral care https://avgeeks.videonest.co/videos/457954/primitive-man-in-a-modern-world-1969 https://img.videonest.org/gamma/JAoa1STvk64_thumbnail_resized_v2.webp https://gamma.videonest.org/JAoa1STvk64_video_v3.mp4 Primitive Man In A Modern World (1969) A film by the Moody Institute of Science that critiques the idea of "primitive" societies by arguing that many such groups—like the Lockandons, Chimulas, and Quechuas—are actually the decayed descendants of once-great civilizations such as the Maya, Inca, and Aztec. Through a mix of ethnographic footage and historical narration, the film contrasts these cultures' past achievements in architecture, astronomy, and medicine with their present-day struggles marked by superstition, addiction, and poverty. It warns that moral and spiritual decay, not just external conditions, lead civilizations to collapse—implying that modern Western society, despite its technological progress, may face the same fate if it continues to ignore these lessons from history. 2025-05-31T00:00:00.000Z yes A/V Geeks 16mm Films no 1373 Mayan CivilizationInca cultureAztecsancient civilizationsmoral decaycultural collapseMoody Institute of ScienceLocandonesMayan cultureInca EmpireAztec CivilizationChichen ItzaMachu PicchuIncan architecturePeruvian culture https://avgeeks.videonest.co/videos/457976/king-rollo-and-the-birthday-1979 https://img.videonest.org/gamma/LYIsnIJqJFs_thumbnail_resized_v2.webp https://gamma.videonest.org/LYIsnIJqJFs_video_v3.mp4 King Rollo And The Birthday (1979) In this charming story, King Rollo decides to send Queen Gwen a birthday card and buys the best one he can find at the shop. However, Cook suggests that a handmade card would be more meaningful. Though King Rolo insists he can't draw, Cook encourages him to try. With help from the magician and several failed attempts, King Rollo finally creates a card featuring Queen Gwen on a horse. Though he feels it isn’t as good as the store-bought one, he sends it anyway. At the party, Queen Gwen is delighted with the card, calling it "very special" and appreciating its uniqueness—proving that effort and personal touch matter more than perfection. 2025-05-31T00:00:00.000Z yes A/V Geeks 16mm Films no 332 King RolloQueen Gwenbirthday cardbirthday presentDavid McKeeLeo BeltoftRay BrooksDuncan LamontClive JusterKing Rollo Films LTDPerspective Films https://avgeeks.videonest.co/videos/457998/office-safety-the-thrill-seekers-1983 https://img.videonest.org/gamma/ry3xQOw62dk_thumbnail_resized_v2.webp https://gamma.videonest.org/ry3xQOw62dk_video_v3.mp4 Office Safety: The Thrill Seekers (1983) A humorous 1980s workplace safety film that satirically highlights common office hazards by portraying careless employees as "thrillseekers" who recklessly ignore basic safety rules. Framed with ironic narration and exaggerated examples, the film showcases a variety of avoidable accidents—from tripping over open drawers and climbing on chairs to misuse of electrical equipment and improper lifting techniques. By emphasizing how these thrillseekers treat everyday office tasks as opportunities for danger, the film ultimately delivers a serious message: safety in the workplace is everyone's responsibility, and ignoring it—no matter how mundane the job may seem—can lead to real harm. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-01T00:00:00.000Z yes A/V Geeks 16mm Films no 616 office safetywork safetysafety tipsoccupational safetythrill seekersworkplace safetysafety hazardsoffice accidentsworkplace risksdangerous behavioroffice lifebriefcaseoffice hallwayCentron Production1980s https://avgeeks.videonest.co/videos/458112/wasted-1983 https://img.videonest.org/gamma/458112_thumbnail_resized_v2.webp https://gamma.videonest.org/458112_video_v3.mp4 Wasted (1983) "Wasted" is a poignant account of an individual's struggle with addiction, detailing the descent into substance abuse and the impact it has on family relationships. The narrator reflects on their early experiences with drugs, the chaos and danger that ensued, and the painful transformation of a loved one into a drug addict. Through harrowing memories, the film explores the destructive nature of addiction, peer pressure, and the long road to recovery, ultimately emphasizing the importance of self-respect and genuine connections over temporary highs. Keywords addiction, recovery, family, substance abuse, peer pressure, personal struggle, self-respect, relationships, drug use, transformation 2025-06-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1280 Drug addictionSubstance AbusePeer pressureDrug abuseTeenagersFamily problemsDrugsAnti-drug messageDrug EducationHigh schoolTeenagerSoccerMTI Teleprograms Inc.Animated shortDrug Problems https://avgeeks.videonest.co/videos/458113/earthworm-anatomy-and-dissection-1961 https://img.videonest.org/gamma/458113_thumbnail_resized_v2.webp https://gamma.videonest.org/458113_video_v3.mp4 Earthworm: Anatomy And Dissection (1961) The film provides a detailed instructional guide on the anatomy and dissection of an earthworm, highlighting key structures and systems. It covers the dissection process, including tools needed and steps to expose various systems such as the digestive, circulatory, excretory, nervous, and reproductive systems. The earthworm's anatomy is described, including its segments, organs, and functions, emphasizing its hermaphroditic nature and reproductive processes. Keywords earthworm, dissection, anatomy, digestive system, circulatory system, excretory system, nervous system, reproductive system, hermaphroditic, educational Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-30T00:00:00.000Z yes A/V Geeks 16mm Films no 630 EarthwormAnatomyDissectionDigestive SystemCirculatory SystemExcretory SystemNervous SystemReproductive SystemAnnelidaAnimal DissectionSeminal VesicleAnteriorPosteriorNephridiumSetae https://avgeeks.videonest.co/videos/458114/camp-gallagher-silent-1970s https://img.videonest.org/gamma/458114_thumbnail_resized_v2.webp https://gamma.videonest.org/458114_video_v3.mp4 [Camp Gallagher, silent, 1970s] raw silent footage of a summer camp in New Mexico, Camp Gallagher. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-29T00:00:00.000Z yes A/V Geeks 16mm Films no 1160 summer campcampingfishingraftinggroup activitycampfirehikingforestnew mexicolife vestcamp counselorscutting woodsleeping bagsaward ceremonyTrout Hatchery https://avgeeks.videonest.co/videos/458115/wild-turkey-silent-1947 https://img.videonest.org/gamma/458115_thumbnail_resized_v2.webp https://gamma.videonest.org/458115_video_v3.mp4 Wild Turkey (silent, 1947) Captures a traditional turkey hunt from start to finish, set against the backdrop of a prestigious hunting lodge. The film opens with serene shots of wild turkeys in the brush and trees before transitioning to scenes of formally dressed guests dining and socializing at the Woodmont Rod and Gun Club. Two men then set out into the woods, using turkey calls to track their quarry. The hunt unfolds with moments of suspense and success as the men skillfully shoot and retrieve several turkeys. The film concludes with the hunters returning to the lodge, birds in hand, highlighting both the camaraderie and ritual of early 20th-century sport hunting. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 455 Wild Turkeyturkey huntingSportsRod and Gun Clubhuntingfowlhunting birdsshotgunwoodsgame birdRKO Pathe https://avgeeks.videonest.co/videos/458116/southwest-landscapes-raw-footage-silent-1970s https://img.videonest.org/gamma/458116_thumbnail_resized_v2.webp https://gamma.videonest.org/458116_video_v3.mp4 [Southwest Landscapes raw footage, silent, 1970s] raw footage of Southwestern United States and Native American ruins and petroglyphs. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-05-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1173 canyoncliff dwellingsrock artnative americanlandscaperock formationaerial viewvalleyhorsepictographscave artancient ruinssandstone cliffhorsespetroglyphs https://avgeeks.videonest.co/videos/458117/av-geeks-6-2-2025 https://img.videonest.org/gamma/458117_thumbnail_resized_v2.webp https://gamma.videonest.org/458117_video_v3.mp4 AV Geeks 6-2-2025 Join us for a proto-AV Geeks video! #16mmfilms #avgeeks It's Potty Time 2025-06-03T00:00:00.000Z yes A/V Geeks 16mm Films no 1988 AV Geeks16mm filmSkip ElsheimerPotty trainingeducational videochildren's songhygienechildrenpartybirthday partyA/V GeeksIts Potty Timecollecting 16mm filmFound Footage Festivalbirthday cake https://avgeeks.videonest.co/videos/458118/av-geeks-16mm-lunch-5-30-2025 https://img.videonest.org/gamma/458118_thumbnail_resized_v2.webp https://gamma.videonest.org/458118_video_v3.mp4 AV Geeks 16mm Lunch 5-30-2025 Join us for a discussion about filmmakers who made it big with podcaster Bill Ackerman. #avgeeks #16mmfilms Lost Puppy The Bike The Magic Bond 2025-05-31T00:00:00.000Z yes A/V Geeks 16mm Films no 4894 A/V Geeks16mm filmLost PuppyThe BikeMagic Bondvintage filmfilm historyeducational filmfilm cultureCaleb DeschanelGeorge LucasWorld War IIAmerican youthVeterans of Foreign Warspodcast https://avgeeks.videonest.co/videos/458120/teenage-mental-development-identity-relationships-and-society https://img.videonest.org/gamma/458120_thumbnail_resized_v2.webp https://gamma.videonest.org/458120_video_v3.mp4 Teenage Mental Development: Identity, Relationships & Society 2025-05-28T00:00:00.000Z yes A/V Geeks 16mm Films no 45 teenage developmentmental healthidentity formationrelationshipssocietygrowing upadolescenceself discoveryemotional intelligenceteenage life https://avgeeks.videonest.co/videos/461498/you-are-there-susan-b-anthony-1971 https://img.videonest.org/gamma/ojqDmyfByB4_thumbnail_resized_v2.webp https://gamma.videonest.org/ojqDmyfByB4_video_v3.mp4 You Are There: Susan B Anthony (1971) The film depicts the trial of Susan B. Anthony, who was arrested for voting in the 1872 election, highlighting the struggle for women's suffrage in America. Anthony argues that the Constitution grants citizenship and voting rights to all individuals, not just men, and challenges the unjust laws that deny women the right to vote. Despite her passionate defense, she is ultimately found guilty and fined, but her actions inspire future generations in the fight for women's rights, culminating in the ratification of the 19th Amendment in 1920. Keywords Susan B. Anthony, women's suffrage, trial, voting rights, 14th Amendment, 15th Amendment, injustice, equal rights, historical drama LIMITED DISTRIBUTION. 2025-06-04T00:00:00.000Z yes A/V Geeks 16mm Films no 1367 Susan B. Anthonywomen's suffragevoting rightstrial14th Amendment15th Amendmentcourt casehistorical dramaHenry R. Seldencourtroomlegal trialelectionarrestUnited Stateswomen's rights https://avgeeks.videonest.co/videos/461793/av-geeks-16mm-lunch-6-4-2025 https://img.videonest.org/gamma/Z3SYRpkaRhY_thumbnail_resized_v2.webp https://gamma.videonest.org/Z3SYRpkaRhY_video_v3_360.mp4 AV Geeks 16mm Lunch 6-4-2025 Skip's caught a bug but that won't stop him from showing you some 16mm films! #avgeeks #16mmfilms 2025-06-04T00:00:00.000Z yes A/V Geeks 16mm Films no 6001 https://avgeeks.videonest.co/videos/461825/dissection-and-anatomy-of-the-frog-1964 https://img.videonest.org/gamma/K_f8rdDJnqc_thumbnail_resized_v2.webp https://gamma.videonest.org/K_f8rdDJnqc_video_v3.mp4 Dissection and Anatomy of the Frog (1964) This educational video provides a detailed dissection of a frog, highlighting its anatomy and internal organs. It explains the process of euthanizing the frog through pithing, followed by a step-by-step examination of the gut cavity, circulatory system, and reproductive organs. The video emphasizes the structure and function of various organs, including the heart, liver, stomach, pancreas, kidneys, and the reproductive system in both male and female frogs. Keywords Dissection, frog, anatomy, pithing, internal organs, gut cavity, circulatory system, reproductive organs, educational video 2025-06-04T00:00:00.000Z yes A/V Geeks 16mm Films no 883 frog dissectionamphibian anatomyanimal sciencescientific experimentorgan systemsFrogAnatomyDissectionPancreasSpleenKidneysOvariesOviductcirculatory systemnerve structure https://avgeeks.videonest.co/videos/461841/picasso-a-painters-diary-part-2-from-cubism-to-guernica-1981 https://img.videonest.org/gamma/FLG1X_SF_SY_thumbnail_resized_v2.webp https://gamma.videonest.org/FLG1X_SF_SY_video_v3_360.mp4 Picasso: A Painter's Diary (Part 2): From Cubism To Guernica (1981) This film explores the evolution of Pablo Picasso's artistic journey, highlighting his influences from Iberian and African art, his development of Cubism alongside Georges Braque, and the emotional turmoil in his personal life that shaped his work. It delves into Picasso's relationships, particularly with women, and how they inspired new styles in his art. The film also discusses the impact of historical events, such as the Spanish Civil War, on his creations, notably the iconic "Guernica," which serves as a powerful commentary on the horrors of war. Keywords Picasso, Cubism, art evolution, Iberian art, African influence, personal life, relationships, Guernica, Spanish Civil War, emotional turmoil. LIMITED DISTRIBUTION 2025-06-05T00:00:00.000Z yes A/V Geeks 16mm Films no 2109 Pablo PicassoCubismGuernicaSpanish Civil WarIberian artAfrican artart evolutionGeorges Braqueart historyModern ArtLes Demoiselles d'AvignonOlga KhokhlovaDora MaarMarie Thereseart influences https://avgeeks.videonest.co/videos/461845/wil-lmy-job-burn-1977 https://img.videonest.org/gamma/CIQMf7XUzXI_thumbnail_resized_v2.webp https://gamma.videonest.org/CIQMf7XUzXI_video_v3_360.mp4 Wil lMy Job Burn? (1977) The film "Will My Job Burn" explores the devastating impact of industrial fires on workers and their families. It highlights personal accounts of unemployment and emotional turmoil faced by employees after their factories burn down, emphasizing the broader economic consequences of such fires. The narrative stresses the importance of fire safety measures and the collective responsibility of workers, management, and unions to prevent these tragedies. It concludes that with proper training and vigilance, the risk of losing jobs to fire can be significantly reduced. Keywords industrial fires, unemployment, economic impact, fire safety, personal accounts, collective responsibility, emotional turmoil, manufacturing, prevention, worker safety 2025-06-05T00:00:00.000Z yes A/V Geeks 16mm Films no 1119 Industrial FiresFire SafetyFire PreventionJob LossEconomic ImpactUnemploymentFactory FireWorker SafetyCollective ResponsibilityFire Safety TrainingSprinkler SystemsFire ExtinguishersSafety InspectionsWorkplaceIndustrial Plant https://avgeeks.videonest.co/videos/461875/helping-the-child-face-the-donts-1958 https://img.videonest.org/gamma/AzOxgqOUU7E_thumbnail_resized_v2.webp https://gamma.videonest.org/AzOxgqOUU7E_video_v3_360.mp4 Helping The Child Face The Don'ts (1958) The film explores the concept of "don'ts" that children face as they grow up, emphasizing the importance of these restrictions for their safety and social development. It discusses how early experiences with these limitations shape a child's personality and ability to coexist with others. The narrative illustrates various scenarios where children learn to navigate their impulses, respect property, and understand social interactions under the guidance of adults. Ultimately, the film highlights that these "don'ts" are essential for fostering a child's understanding of acceptable behavior and personal boundaries. Keywords child development, don'ts, social conduct, safety, property rights, impulse control, parenting, personality formation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-05T00:00:00.000Z yes A/V Geeks 16mm Films no 619 child developmentparentingsocial skillschildhoodraising childrensocial behaviorearly educationchildren playingparenting skillspersonality developmentrespecting othersproperty rightsblack and whiteyoung girldoll https://avgeeks.videonest.co/videos/461912/av-geeks-16mm-lunch-6-5-2025 https://img.videonest.org/gamma/DZ_fWuOF7sk_thumbnail_resized_v2.webp https://gamma.videonest.org/DZ_fWuOF7sk_video_v3_360.mp4 AV Geeks 16mm Lunch 6-5-2025 We're back live after sleeping all day yesterday. 16mm films! #avgeeks #16mmfilms 2025-06-05T00:00:00.000Z yes A/V Geeks 16mm Films no 3875 https://avgeeks.videonest.co/videos/462106/synthese-1970s https://img.videonest.org/gamma/462106_thumbnail_resized_v2.webp https://gamma.videonest.org/462106_video_v4.mp4 Synthese (1970s?) Discusses the interconnectedness of science and nature, emphasizing the adaptability of plants in harsh environments, particularly in salt regions. Jean Marary Pelt, a scientist and deputy... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1646 Jean-Marie PeltSynthese Magazineplant biologyecologyenvironmental protectionlichenair pollutiongeothermal energyFrancehand surgeryRaoul Tubianaelectric fishelectric fieldsPhysiological PhenomenaSensory Mechanisms https://avgeeks.videonest.co/videos/462107/the-march-of-truth-and-forbid-them-not-1948 https://img.videonest.org/gamma/462107_thumbnail_resized_v2.webp https://gamma.videonest.org/462107_video_v4.mp4 The March Of Truth - And Forbid Them Not (1948) A scene involving children in Capernaum during Jesus' time, highlighting their need for love and guidance. The children engage in a playful argument about leading a caravan, reflecting their... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 638 The March of TruthJesuschildrengospelBiblereligionJesus ChristKingdom of HeavenprayingBible Teaching FilmMaryChristianityPaul G. KiehlBible teachingOld Testament https://avgeeks.videonest.co/videos/462108/the-bedouins-of-arabia-1969 https://img.videonest.org/gamma/462108_thumbnail_resized_v2.webp https://gamma.videonest.org/462108_video_v4.mp4 The Bedouins Of Arabia (1969) Describes the life and culture of the Bedouin people in the coastal cities and deserts of Saudi Arabia. It highlights the blend of traditional and modern lifestyles, the importance of water... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1219 BedouinSaudi ArabiaArab CultureDesertNomadic LifeBedouin CultureTraditional ClothingCamelMiddle EastCoastal CitiesTraditional FoodFalconry HuntingArabian PeninsulaDesert OasisCamel Milk https://avgeeks.videonest.co/videos/462109/racing-in-australia-1960s https://img.videonest.org/gamma/462109_thumbnail_resized_v2.webp https://gamma.videonest.org/462109_video_v4.mp4 Racing In Australia (1960s) Turf racing in Australia is a beloved sport, often referred to as the "sport of kings." The Melbourne Cup, held on the first Tuesday of November, is the highlight of the racing calendar, attracting... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 586 Horse racingMelbourne CupAustraliahorse raceAustralian Culturehorse racingMelbourne Cup DayFlemington RacecourseRandwick Racecourseoutback racingAustralian cultureBrunette Downshorse sportsjockeyscattle run https://avgeeks.videonest.co/videos/462110/i-was-a-teenage-travelogue-1975 https://img.videonest.org/gamma/462110_thumbnail_resized_v2.webp https://gamma.videonest.org/462110_video_v4_360.mp4 I Was A Teenage Travelogue (1975) Missing the beginning. An experimental and nostalgic journey taken by the C Larry Roberts and their friends, including Ken, Mike, and Larry, as they reminisce about their time in Kansas. They... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 655 Kansasroad tripfamily travelvintage travelGarden of EdenLucas KansasSP DinsmoorSanta Fe Trailfriendstravelcemeteryconvertiblefilm creditsairline stewardessCastle Rock https://avgeeks.videonest.co/videos/462111/abc-the-world-turned-upside-down-commercial https://img.videonest.org/gamma/462111_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462111/abc-the-world-turned-upside-down-commercial ABC - The World Turned Upside Down commercial George Washington was a complex and contradictory figure who loved one woman but married another. Born into wealth, he spent his early years as a dandy, gambler, and adventurer. Ultimately, he became the father of a nation and played a crucial role in determining the world's fate at the Battle of Yorktown. Keywords: George Washington, complex figure, contradiction, love, marriage, wealth, dandy, gambler, adventurer, father of a nation, Battle of Yorktown. 2025-06-09T00:00:00.000Z yes A/V Geeks 16mm Films no 34 George WashingtonAmerican HistoryBattle of YorktownAmerican RevolutionABCThe World Turned Upside Downcommercials https://avgeeks.videonest.co/videos/462112/leader-ladies-silent-1970s https://img.videonest.org/gamma/462112_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462112/leader-ladies-silent-1970s [Leader Ladies, silent, 1970s] A couple of leader ladies - single frames of women used by film labs to ensure that the color processing is correct. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-09T00:00:00.000Z yes A/V Geeks 16mm Films no 4 1970sfilm leader16mm filmcolor processingarchival footagefilm labvintage film https://avgeeks.videonest.co/videos/462113/ye-olde-songs-1932 https://img.videonest.org/gamma/462113_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462113/ye-olde-songs-1932 Ye Olde Songs (1932) A series of musical performances, including snippets of songs and playful interactions. The speaker engages the audience by asking if they want to hear old songs, leading to performances of "Swanee River," "All Through the Night," and a humorous story about a man and his love for gold. The atmosphere is light-hearted, with references to community gatherings like the rotary club and nostalgic themes related to home and love. Keywords: music, old songs, Swanee River, All Through the Night, rotary club, gold, humor, nostalgia, community, love, home. 2025-06-08T00:00:00.000Z yes A/V Geeks 16mm Films no 308 musical performanceold songsSwanee RiverFelix the Catvintage animationanimationcartoon characterpiano playingmusicalnostalgiaminstrel showblackfacecommunityhumor1930s https://avgeeks.videonest.co/videos/462114/american-dental-association-teddy-bear-psa-1970s https://img.videonest.org/gamma/462114_thumbnail_resized_v2.webp https://gamma.videonest.org/462114_video_v3.mp4 American Dental Association Teddy Bear PSA (1970s) A playmate has a new strong tooth, which is a result of proper care and nutrition advised by her physician and dentist. This tooth began forming about 7 months before her birth, highlighting the importance of prenatal care for dental health. Keywords: playmate, new tooth, strong tooth, care, nutrition, physician, dentist, prenatal care, dental health, American Dental Association. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-08T00:00:00.000Z yes A/V Geeks 16mm Films no 33 American Dental Associationdental healthprenatal carenutritionanimated PSAteddy bearstrong toothphysiciandentist1970s https://avgeeks.videonest.co/videos/462115/insects-1979 https://img.videonest.org/gamma/462115_thumbnail_resized_v2.webp https://gamma.videonest.org/462115_video_v4.mp4 Insects (1979) This educational film introduces young viewers to the fascinating world of insects, emphasizing their abundance, diversity, and importance. It begins with the observation that nature is full... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 706 InsectButterflyHoney BeeCaterpillarMetamorphosisLife CycleLarvaPupaChrysalisEntomologyInvertebrateBee HiveHoney ProductionBee PollenFlower Nectar https://avgeeks.videonest.co/videos/462116/radio-girl-1932 https://img.videonest.org/gamma/462116_thumbnail_resized_v2.webp https://gamma.videonest.org/462116_video_v3.mp4 Radio Girl (1932) A radio station catches fire, trapping a mouse-girl who hosts an exercise program on the upper floor. A boy mouse listener saves her by pulling her to safety through his radio at home. Keywords: radio station, fire, mouse-girl, exercise program, trapped, boy mouse, listener, safety, Frank Moser, Paul Terry, Hazel Dudley 2025-06-08T00:00:00.000Z yes A/V Geeks 16mm Films no 316 radiomousecartoonvintage animationfirefightingmouse charactercartoon animaldancingradio stationBarker Bill's Cartoon Show https://avgeeks.videonest.co/videos/462117/professional-carpet-selling-introductory-film-1977 https://img.videonest.org/gamma/462117_thumbnail_resized_v2.webp https://gamma.videonest.org/462117_video_v4.mp4 Professional Carpet Selling: Introductory Film (1977) A conversation among salespeople and customers in a carpet store, focusing on the importance of effective selling techniques. Ed Stevens, a successful carpet salesman, discusses the need for... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1041 carpet salesselling skillscustomer servicesales techniques1970s fashionvintage commercialcarpet storeEd Stevenstraining programsales strategysalespeoplecarpet sellingcarpet purchaserole playingprobing https://avgeeks.videonest.co/videos/462118/mars-minus-myth-1976 https://img.videonest.org/gamma/462118_thumbnail_resized_v2.webp https://gamma.videonest.org/462118_video_v4.mp4 Mars Minus Myth (1976) Discusses the exploration of Mars, detailing the history of observations and missions, particularly focusing on the Mariner and Viking missions. It highlights the initial misconceptions about... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1306 MarsNASAViking 1Viking 2Mariner 9Mariner 4space explorationplanetary scienceMartian atmosphereViking MissionMartian soilcarbon dioxidewater on Marstelescopeplanetary missions https://avgeeks.videonest.co/videos/462119/the-children-and-the-bear-1959 https://img.videonest.org/gamma/462119_thumbnail_resized_v2.webp https://gamma.videonest.org/462119_video_v4.mp4 The Children and the Bear (1959) The animated film serves as an anti-Communist allegory featuring a bear symbolizing Russia, which escapes and threatens a group of children, representing Southeast Asian countries. The children... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 858 https://avgeeks.videonest.co/videos/462120/us-forestry-service-volunteers-1970s https://img.videonest.org/gamma/462120_thumbnail_resized_v2.webp https://gamma.videonest.org/462120_video_v3.mp4 US Forestry Service Volunteers (1970s) In the 1970s, a group of 50 volunteers from across the United States participated in a conservation project near Pike's Peak, Colorado, where they blazed eight new miles of hiking trails on the Colorado Trail. These families learned navigation skills using compasses and maps while camping and working together for two weeks. The initiative was part of the National Hiking and Ski Touring Association, emphasizing community service and environmental stewardship. Keywords volunteers, Colorado Trail, Pike's Peak, hiking, conservation, National Hiking and Ski Touring Association, compass, families, environment, outdoor adventure Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-07T00:00:00.000Z yes A/V Geeks 16mm Films no 63 volunteersColorado TrailPike's PeakhikingconservationNational Hiking and Ski Touring Associationcompassfamiliesenvironmentoutdoor adventuretrail blazingUS Forestry Service https://avgeeks.videonest.co/videos/462121/non-swimming-rescues-1974 https://img.videonest.org/gamma/462121_thumbnail_resized_v2.webp https://gamma.videonest.org/462121_video_v3.mp4 Non-Swimming Rescues (1974) The film emphasizes the importance of non-swimming rescue techniques for drowning victims. It highlights various methods such as extension assists, throwing assists, and waiting assists that can be employed by individuals who are not strong swimmers. The video stresses the significance of using available equipment, maintaining safety, and having common sense during rescues. It also warns against attempting swimming assists without proper skills, as this could lead to double drowning. Keywords drowning, rescue techniques, non-swimmer, extension assist, throwing assist, waiting assist, safety, survival swimming, common sense 2025-06-06T00:00:00.000Z yes A/V Geeks 16mm Films no 445 drowning preventionlifesavingwater safetyrescue techniquesAmerican National Red Crossswimming skillslife savingflotation devicesassisted rescuenon-swimmerextension assistthrowing assistwaiting assistsafetysurvival swimming https://avgeeks.videonest.co/videos/462122/mythology-of-greece-and-rome-1969 https://img.videonest.org/gamma/462122_thumbnail_resized_v2.webp https://gamma.videonest.org/462122_video_v4.mp4 Mythology Of Greece And Rome (1969) The film explores the mythology of ancient Greece and Rome, highlighting how these cultures created gods to explain natural phenomena and human emotions. Key figures include Jupiter, the king... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 918 ancient GreeceRoman mythsGreek MythologyRoman MythologyJupiterNeptunePlutoPersephoneDemeterGods of OlympusGreek MythsApolloMount Olympusnatural phenomenaclassical sculpture https://avgeeks.videonest.co/videos/462123/individualizing-reading-instruction-in-the-classroom-1957 https://img.videonest.org/gamma/462123_thumbnail_resized_v2.webp https://gamma.videonest.org/462123_video_v4.mp4 Individualizing Reading Instruction In The Classroom (1957) The film showcases a first-grade classroom where the teacher emphasizes individualized reading instruction alongside group activities. Children engage in various creative tasks while the teacher... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1247 reading instructionclassroom activityeducationlearningelementary schoolschool childrenclassroom activitiesreading skillteacher guidancestudent learningreadingart projectclassroomchild literacyearly learning https://avgeeks.videonest.co/videos/462124/zip-codes-phone-book-1970s https://img.videonest.org/gamma/462124_thumbnail_resized_v2.webp https://gamma.videonest.org/462124_video_v3.mp4 Zip Codes Phone Book (1970s) This film highlights the importance of zip codes for local mail delivery, emphasizing that local letters require zip codes just as much as those sent from out of town. It suggests that viewers can find local zip codes in their phone books. Keywords zip codes, local mail, phone book, delivery, communication Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-06T00:00:00.000Z yes A/V Geeks 16mm Films no 15 zip codeslocal mailphone bookmail deliverypostal service1970sunited states postal service https://avgeeks.videonest.co/videos/462125/cotton-processing-silent-1960s-kodachrome https://img.videonest.org/gamma/462125_thumbnail_resized_v2.webp https://gamma.videonest.org/462125_video_v4.mp4 [Cotton Processing, silent, 1960s, Kodachrome ] This silent 1960s industrial film footage provides a detailed look at the journey of cotton from raw material to finished textile product. Beginning with close-up shots of cotton processing... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 1319 CottonCotton ProcessingTextile ProductionTextile MillTextile ManufacturingCotton BalesSpinning ThreadWeaving ClothFactory WorkIndustrial ProcessesFiber QualityHarvestingFarmingCotton GinMachine Processing https://avgeeks.videonest.co/videos/462126/the-land-of-cotton-silent-1930s https://img.videonest.org/gamma/462126_thumbnail_resized_v2.webp https://gamma.videonest.org/462126_video_v4_360.mp4 The Land of Cotton (silent, 1930s) This vintage educational film uses black and white imagery and intertitles to introduce young audiences to agriculture, natural resources, and rural life. It begins with a focus on the cotton... 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 875 cotton flowercotton bollland of cottonrice fieldsilkwormsmulberry leavesfruit marketapple harvestingapple orchardcattle grazingsheep herdingcowspasteurizingmountainsvalleys https://avgeeks.videonest.co/videos/462127/aerospace-highlights-1961-silent https://img.videonest.org/gamma/462127_thumbnail_resized_v2.webp https://gamma.videonest.org/462127_video_v4_360.mp4 Aerospace Highlights 1961 (silent) Highlights the aerospace accomplishments achieved at Cape Canaveral in 1961. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-10T14:41:01.364Z yes A/V Geeks 16mm Films no 728 Cape CanaveralMissile TestMissile LaunchRocket LaunchSpace RaceRocket TestingSpace ExplorationAir ForceRCAArchival FootageOuter SpaceEarth ViewRocket Preparation https://avgeeks.videonest.co/videos/462128/hansel-and-gretel-1933 https://img.videonest.org/gamma/462128_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462128/hansel-and-gretel-1933 Hansel and Gretel (1933) "Hansel and Gretel" is a whimsical animated retelling of the classic fairy tale. It features humorous elements, such as a character named Bill living in a shoe and children being fed frogs. The story includes themes of fear, safety, and the enchanting yet eerie nature of the witch's gingerbread house, culminating in a playful invitation to indulge in cake. Keywords Hansel and Gretel, animation, fairy tale, humor, witch, gingerbread house, children, adventure 2025-06-02T00:00:00.000Z yes A/V Geeks 16mm Films no 327 HanselGretelwitchcartoonfairytalevintage animationgingerbread housechildrenBarker Billcartoon puppiesblack and whitenursery rhymeadventure https://avgeeks.videonest.co/videos/462129/king-rollo-and-the-dishes-1979 https://img.videonest.org/gamma/462129_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462129/king-rollo-and-the-dishes-1979 King Rollo And The Dishes (1979) In this charming tale, King Rollo and a magician tackle the task of washing dishes after a delicious dinner. Initially, they plan to use magic to expedite the cleaning, but the magician insists on doing it without magic. After a mishap with a dropped plate, the magician uses his magic to clean and mend all the dishes just in time for Cook's return, who praises their teamwork. Keywords King Rollo, magician, dishes, magic, teamwork, Cook, dinner, mishap, cleaning 2025-06-02T00:00:00.000Z yes A/V Geeks 16mm Films no 331 King RolloThe DishesCookMagiciandishwashingDavid McKeeAnimationKing Rollo FilmsPerspective FilmsLeo BeltoitRay BrooksDuncan LamontClive Juster https://avgeeks.videonest.co/videos/462130/av-geeks-16mm-lunch-6-9-2025 https://img.videonest.org/gamma/462130_thumbnail_resized_v2.webp https://gamma.videonest.org/462130_video_v3_360.mp4 AV Geeks 16mm Lunch 6-9-2025 Eating spaghetti and meatballs for lunch and watching 16mm to feed my brain. Join us! #avgeeks #16mmfilms Riding In Australia Follow Mr Willoughby Synthese 2025-06-10T00:00:00.000Z yes A/V Geeks 16mm Films no 3863 16mm filmhorse racingMelbourne CupAustralian cultureJean-Marie Peltecologyenvironmental protectionMr Willoughbychildhood adventureelectric fishfilm projectorA/V Geekscollecting filmsold film1960s https://avgeeks.videonest.co/videos/462131/av-geeks-16mm-lunch-6-6-2025 https://img.videonest.org/gamma/462131_thumbnail_resized_v2.webp https://gamma.videonest.org/462131_video_v3_360.mp4 AV Geeks 16mm Lunch 6-6-2025 Did you ask for more 16mm films? We just happen to have some! #avgeeks #16mmfilms Zoo Animals in the Wild: Apes March of Truth - And Forbid Them Not I Was a Teenage Travelog Johnny Lingo 2025-06-07T00:00:00.000Z yes A/V Geeks 16mm Films no 3665 16mm filmvintage filmzoo animalsBible teachingtraveloguefilm projectoreducational filmanimalsChristian filmtravelorangutanJesuscultural traditionisland cultureeight cows https://avgeeks.videonest.co/videos/462132/av-geeks-16mm-lunch-6-3-2025 https://img.videonest.org/gamma/462132_thumbnail_resized_v2.webp https://gamma.videonest.org/462132_video_v5_360.mp4 AV Geeks 16mm Lunch 6-3-2025 We promise no films featuring "potties" today. #avgeeks #16mmfilms Various Coronet Clips Innkeeper's Bill Your FBI Second Revolution in Banking Analog Computer Graphics clips 2025-06-10T14:41:01.395Z yes A/V Geeks 16mm Films no 4220 16mm filmvintage filmeducational filmFBIbankingcomputer graphicsstock footageSkip ElsheimerA/V Geekspuppet animationJ Edgar Hooverinsectsbanking revolutioncomputer systemscheck processing https://avgeeks.videonest.co/videos/462753/on-the-road-to-damascus-part-1-1937 https://img.videonest.org/gamma/QYjzVSKk8ig_thumbnail_resized_v2.webp https://gamma.videonest.org/QYjzVSKk8ig_video_v3.mp4 On The Road To Damascus (Part 1, 1937) Describes the events surrounding the stoning of Stephen, a follower of Jesus, and the subsequent persecution of the early Christian church led by Saul. Stephen, filled with the Holy Spirit, sees a vision of Jesus and is stoned to death by a crowd. Saul, who consents to Stephen's death, actively persecutes Christians, seeking to imprison them. Later, Saul encounters Jesus on the road to Damascus, leading to his conversion. Ananias is instructed by God to help Saul regain his sight and be filled with the Holy Spirit. **Keywords:** Stephen, Saul, stoning, persecution, Holy Spirit, vision, Jesus, Damascus, Ananias, conversion, early church. 2025-06-10T00:00:00.000Z yes A/V Geeks 16mm Films no 813 Stoning of StephenSaul of TarsusPaulDamascusConversion NarrativeVision of JesusAnaniasActs of the ApostlesChristian persecutionReligious filmHoly SpiritReligious visionHealingBlack and white https://avgeeks.videonest.co/videos/462793/av-geeks-16mm-lunch-6-10-2025 https://img.videonest.org/gamma/WeLr7baHXmg_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462793/av-geeks-16mm-lunch-6-10-2025 AV Geeks 16mm Lunch 6-10-2025 It's the Tuesday when we watch old 16mm films.. well, actually we watch 16mm films all the time. #avgeeks #16mmfilms 2025-06-10T00:00:00.000Z yes A/V Geeks 16mm Films no 3466 https://avgeeks.videonest.co/videos/462830/the-upper-room-1952 https://img.videonest.org/gamma/1kJA6_NOO3c_thumbnail_resized_v2.webp https://gamma.videonest.org/1kJA6_NOO3c_video_v3_360.mp4 The Upper Room (1952) In this passage, Jesus instructs Peter and John to prepare for the Passover feast, unaware that it will be their last meal together. Jesus expresses his sadness about not sharing the meal again until the kingdom of God is fulfilled. He teaches his disciples about humility and service, emphasizing that true greatness comes from serving others. During the meal, he predicts his betrayal and identifies the betrayer. Jesus gives a new commandment to love one another and reassures his disciples about his departure, explaining that he is the way to the Father. He promises to send a comforter and offers peace to his followers. Keywords: Jesus, disciples, Passover, last supper, humility, service, betrayal, love, commandment, way, truth, life, comforter, peace. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-10T00:00:00.000Z yes A/V Geeks 16mm Films no 893 Jesus ChristLast SupperdisciplesbetrayalJudas IscariotFeast of the PassoverPeterJohnnew commandmentbody of ChristJesus' BloodHoly CommunionForgiveness of SinsNew Testamentspiritual https://avgeeks.videonest.co/videos/462847/johnny-lingo-building-self-worth-in-others-1969 https://img.videonest.org/gamma/9p4y3Vlg3cg_thumbnail_resized_v2.webp https://gamma.videonest.org/9p4y3Vlg3cg_video_v3_360.mp4 Johnny Lingo: Building Self Worth In Others (1969) The film revolves around Johnny Lingo, a native who is set to marry Mahana, the daughter of a man named Moki. The villagers gossip about Mahana's lack of beauty and her father's desperation to marry her off. Despite the low expectations, Johnny surprises everyone by offering eight cows for Mahana, a significant amount that elevates her status. The story highlights themes of self-worth, societal perceptions of beauty, and the importance of how a woman perceives herself in relation to her marriage. Keywords: Johnny Lingo, Mahana, Moki, cows, marriage, self-worth, beauty, village gossip, trading, societal perceptions, bride price, character dynamics. 2025-06-11T00:00:00.000Z yes A/V Geeks 16mm Films no 1393 Johnny LingoMahanabride priceself-worthisland villageeight cowsarranged marriageisland lifevintage filmHawaiian cultureMr Harrisgift givingnative islandersHawaiitropical island https://avgeeks.videonest.co/videos/462849/the-story-of-magnetism-1960 https://img.videonest.org/gamma/u1FoZrAZwJQ_thumbnail_resized_v2.webp https://gamma.videonest.org/u1FoZrAZwJQ_video_v3_360.mp4 The Story Of Magnetism (1960) Discusses the concept of magnetism, its historical discovery, and its applications. It begins with the introduction of magnetite, a rock that attracts iron, and the development of the compass by mariners. Dr. William Gilbert's studies in the 16th century revealed that magnets have poles that attract and repel, and he demonstrated that the Earth acts like a giant magnet. The text explains how magnets create magnetic fields, the properties of permanent magnets, and the relationship between electricity and magnetism, including the creation of electromagnets and generators. It concludes by mentioning ongoing research into the nature of magnetism at the atomic level. Keywords: magnetism, magnetite, compass, Dr. William Gilbert, magnetic fields, permanent magnets, electromagnets, electricity, generators, atomic theory, iron filings, magnetic poles, historical discovery, applications. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-11T00:00:00.000Z yes A/V Geeks 16mm Films no 835 magnetismDr. William Gilbertelectromagnetismmagnetic fieldcompasselectromagnetelectric currentpermanent magnetsHans OerstedMichael Faradayscientific demonstrationlodestonescienceloadstoneUnited World Films https://avgeeks.videonest.co/videos/462881/individual-differences-1950 https://img.videonest.org/gamma/hVhJGvu8d4M_thumbnail_resized_v2.webp https://gamma.videonest.org/hVhJGvu8d4M_video_v3_360.mp4 Individual Differences (1950) Discusses the beginning of a new school year for students and teachers, highlighting the importance of understanding individual differences among pupils. It follows a teacher, Miss Hart, as she navigates her first day with a new class, focusing on a shy student named Roy Edwards. The narrative illustrates the challenges of teaching when individual needs are not recognized, particularly through Roy's struggles compared to his more confident brother, George. Miss Hart learns to appreciate Roy's unique abilities and interests, ultimately adjusting her teaching methods to foster his success and engagement in school. The text emphasizes the significance of personalized education and the role of teachers in recognizing and nurturing each student's potential. Keywords: school year, students, teachers, individual differences, Miss Hart, Roy Edwards, shy, teaching methods, personalized education, engagement, success, George, confidence, abilities, interests. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-11T00:00:00.000Z yes A/V Geeks 16mm Films no 1397 individual differencesteaching methodsstudent personalitiesclassroomteachersschool childrenteacher preparationclassroom diversitylearningback to schoolnew englandMassachusettsBostoncolonial attireschool play https://avgeeks.videonest.co/videos/462965/zoo-animals-in-the-wild-apes-1981 https://img.videonest.org/gamma/AAXILRKBC1o_thumbnail_resized_v2.webp https://gamma.videonest.org/AAXILRKBC1o_video_v3.mp4 Zoo Animals In The Wild: Apes (1981) Discusses various types of apes, including chimpanzees, gibbons, gorillas, and orangutans. It highlights that all apes lack tails and are highly intelligent, with abilities to use their hands and feet similarly. Orangutans are described as strong yet shy and peaceful. The bond between a mother ape and her baby is emphasized, noting that they stay together for several years, during which the mother teaches the baby essential skills, including how to eat. Additionally, orangutans build nests in trees each night for safety while they sleep. Keywords: apes, chimpanzees, gibbons, gorillas, orangutans, intelligence, hands, feet, strong, shy, peaceful, mother, baby, nests, trees, sleep. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-11T00:00:00.000Z yes A/V Geeks 16mm Films no 332 orangutanapeswildliferainforestanimal behaviortool useanimal intelligencejungle animalschimpanzeesgibbonsgorillasmotherbabyneststrees https://avgeeks.videonest.co/videos/462987/life-between-the-tides-1970s https://img.videonest.org/gamma/4COzCyuO37A_thumbnail_resized_v2.webp https://gamma.videonest.org/4COzCyuO37A_video_v3.mp4 Life Between The Tides (1970s) Describes the intricate behaviors of a female beetle as she constructs a cradle for her young using specific instincts and built-in patterns. It details her process of selecting leaves, cutting them, and rolling them into a protective cradle, emphasizing the precision and coordination required for such a task. The beetle's actions are driven by instinct, with her brain coordinating her movements without the ability to learn beyond her initial programming. The text also highlights the importance of the cradle in providing protection, moisture, and food for the larvae, showcasing the beetle's adaptive genius and the efficiency of her reproductive strategy. Keywords: beetle, instincts, cradle, construction, leaves, cutting, rolling, protection, larvae, adaptive genius, behavior patterns, programming, precision, coordination. 2025-06-12T00:00:00.000Z yes A/V Geeks 16mm Films no 761 beetleAmegao beetleleaf cradleinsectbeetle instinctsleaf rolling beetleleaf foldinganimal behaviorlarvapupaegg layingnatural historyoak leaveschestnut leavesmetamorphosis https://avgeeks.videonest.co/videos/462993/av-geeks-16mm-lunch-6-11-2025 https://img.videonest.org/gamma/XIDLQkU4LyU_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/462993/av-geeks-16mm-lunch-6-11-2025 AV Geeks 16mm Lunch 6-11-2025 It's muggy out! Blechh! Stay inside with us and watch some old 16mm films! #avgeeks #16mmfilms 2025-06-12T00:00:00.000Z yes A/V Geeks 16mm Films no 4644 https://avgeeks.videonest.co/videos/463130/av-geeks-16mm-lunch-6-12-2025 https://img.videonest.org/gamma/rLrepKuZvxk_thumbnail_resized_v2.webp https://gamma.videonest.org/rLrepKuZvxk_video_v3.mp4 AV Geeks 16mm Lunch 6-12-2025 Where's Skip streaming from today? will we be watching ole 16mm films? Will Youtube bring the hammer down? #avgeeks #16mmfilms 2025-06-13T00:00:00.000Z yes A/V Geeks 16mm Films no 4245 16mm filmA/V GeeksChristian filmBedouins of ArabiaArabian Culturereligious dramafilm projectorsilent filmSkip Elsheimerfilm scanningSaudi Arabiadesert travelcultural traditionstime managementAlan Lakein https://avgeeks.videonest.co/videos/463132/pompeii-and-vesuvius-1951 https://img.videonest.org/gamma/cv6AIqg-lzw_thumbnail_resized_v2.webp https://gamma.videonest.org/cv6AIqg-lzw_video_v3.mp4 Pompeii And Vesuvius (1951) In August 79 AD, Mount Vesuvius erupted, releasing a cloud of vapor that led to the destruction of the nearby city of Pompeii. Initially observed with curiosity, the eruption escalated, resulting in lava flows, poisonous gases, and the engulfing of farms and vineyards. Pompeii, a prosperous city with a vibrant community, was known for its art, architecture, and public life. The city featured temples, theaters, and bustling streets, but was ultimately buried and forgotten until recent years. In contrast, Naples, located nearby, survived the eruption and continues to thrive, preserving its customs and traditions. Vesuvius remains an active and ominous presence, serving as a reminder of the catastrophic events of the past. **Keywords:** Mount Vesuvius, Pompeii, eruption, destruction, lava, poisonous gases, art, architecture, Naples, survival, history, reminder. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-13T00:00:00.000Z yes A/V Geeks 16mm Films no 635 PompeiiMount Vesuviusvolcanic eruptionancient historyRoman EmpireArchaeologyBay of NaplesruinsNaplesHerculaneumvolcanoactive volcanosymbolwarningsmoke https://avgeeks.videonest.co/videos/463162/they-were-cars-1972 https://img.videonest.org/gamma/wWjWkKm9GQE_thumbnail_resized_v2.webp https://gamma.videonest.org/wWjWkKm9GQE_video_v3.mp4 They Were Cars (1972) Presents a musical tour of an auto wrecking yard which teaches action verb concepts while supplying material for independent observations about obsolescence and reliability. **Keywords:** Old McDougall, yard, cars, autos, fast, old, new, golden, blue, parts, mufflers, spark plugs, magnet ball, junk, auto heaven, non-functional. 2025-06-13T00:00:00.000Z yes A/V Geeks 16mm Films no 554 car junkyardclassic carsdismantlingcar partsfolk musicvintage carsautomobileswrecking yardjunk yardauto salvagefastbacksedansused carsantique carsOld McDougal https://avgeeks.videonest.co/videos/463213/american-medical-association-faith-psa-1970s https://img.videonest.org/gamma/M3HfxfA8Euk_thumbnail_resized_v2.webp https://gamma.videonest.org/M3HfxfA8Euk_video_v3.mp4 American Medical Association Faith PSA (1970s) Emphasizes the significant role of faith in a patient's overall health care, comparing its power to that of modern medicine and vaccines. It highlights that faith can take various forms, such as faith in life, inner strength, or a higher power. The American Medical Association encourages individuals to strengthen their faith as part of their health journey. Keywords: faith, health care, physician, vaccines, American Medical Association, strength, public service message. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-13T00:00:00.000Z yes A/V Geeks 16mm Films no 84 faithhealth carephysicianvaccinesAmerican Medical Associationstrengthpublic service messagereligionbeliefhealthmedicine1970sAMA https://avgeeks.videonest.co/videos/463228/av-geeks-16mm-lunch-6-13-2025 https://img.videonest.org/gamma/RRPGacWF7P0_thumbnail_resized_v2.webp https://gamma.videonest.org/RRPGacWF7P0_video_v3.mp4 AV Geeks 16mm Lunch 6-13-2025 How much bad luck can we have watching old 16mm films? #avgeeks #16mmfilms Raccoon's Picnic Two Little Raccoon Buffy the Bored Raccoon Ricky Raccoon Shows The Way [Random Tails] 2025-06-13T00:00:00.000Z yes A/V Geeks 16mm Films no 4564 16mm filmraccoonseducational filmvintage filmstock footageanimated filmwildlifenaturefound footagefilm damageCoronet stock footageexperimental filmThomas Jeffersonfilm projectorhistorical education https://avgeeks.videonest.co/videos/463230/careers-agri-business-1970 https://img.videonest.org/gamma/kh2oVcps8zc_thumbnail_resized_v2.webp https://gamma.videonest.org/kh2oVcps8zc_video_v3.mp4 Careers: Agri-Business (1970) The text discusses the dynamic and fulfilling nature of jobs in the agricultural and food processing industries. Fieldmen often work outside of traditional office settings, providing services to farmers by introducing new techniques and coordinating harvests. While agriculture may not be the highest-paying sector, it offers a comfortable and satisfying work environment. The roles involve significant responsibility, especially during peak seasons like harvest, and there are opportunities for advancement, even for those without formal degrees. The text emphasizes the importance of teamwork, creativity, and a positive attitude in sales and marketing roles within the food industry, highlighting the potential for growth and innovation in this field. **Keywords:** fieldman, agriculture, service organization, farmers, harvest season, food processing, job satisfaction, responsibility, teamwork, marketing manager, creativity, sales, opportunities, food industry, innovation. 2025-06-14T00:00:00.000Z yes A/V Geeks 16mm Films no 683 Agri-BusinessAgricultureFood ProcessingCanning IndustryCrop HarvestingFarming EquipmentQuality ControlFood IndustryMarketing ManagerJob OpportunitiesTomato FarmingFood ScientistGrocery StoreSupermarketRetail https://avgeeks.videonest.co/videos/463237/us-navy-new-navy-psa-1970s https://img.videonest.org/gamma/BXwTiJCoYXY_thumbnail_resized_v2.webp https://gamma.videonest.org/BXwTiJCoYXY_video_v3.mp4 U.S. Navy - New Navy PSA (1970s) Encourages individuals to consider a more fulfilling life by joining the new Navy, highlighting the opportunity to take up to six months to report after enlistment. It invites readers to learn more from a Navy recruiter or by calling a provided phone number. Keywords: Navy, enlistment, opportunity, recruiter, special, fulfilling life, report time, call. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-14T00:00:00.000Z yes A/V Geeks 16mm Films no 31 U.S. NavyNavyNavy recruitmentmilitarymilitary recruitmentenlistmentrecruiteraircraftNavy PSAfulfilling life https://avgeeks.videonest.co/videos/463265/electricity-wires-in-the-home-1964 https://img.videonest.org/gamma/lhdGO6WwM6Y_thumbnail_resized_v2.webp https://gamma.videonest.org/lhdGO6WwM6Y_video_v3.mp4 Electricity - Wires In The Home (1964) Title and ending are clipped. Explains how electricity is generated, distributed, and used in homes. It describes the journey of electricity from generator stations, which can be powered by steam or falling water, through wires to homes. The text also covers the components of electrical systems, including switches, circuit breakers, and the role of conductors and non-conductors. It highlights the importance of safety measures to prevent electrical fires and discusses troubleshooting common electrical issues, such as short circuits. Keywords: electricity, generator station, wires, circuit, conductors, non-conductors, switches, circuit breakers, safety, troubleshooting, short circuit, appliances, filament, tungsten, heat, fire prevention. 2025-06-14T00:00:00.000Z yes A/V Geeks 16mm Films no 478 electricityelectrical safetyhome constructionelectric wirespower generationshort circuitelectric currentelectrical appliancescircuit breakerutility poleelectricianlight bulbelectrical circuitgenerator https://avgeeks.videonest.co/videos/463293/the-crab-silent-1920s https://img.videonest.org/gamma/1GWjfkAZfs4_thumbnail_resized_v2.webp https://gamma.videonest.org/1GWjfkAZfs4_video_v3.mp4 The Crab (silent, 1920s) This 1920s silent film presents an up-close and detailed look at crab behavior in their aquatic habitat. The footage features crabs walking sideways, feeding, fighting, and interacting with their environment. Viewers observe close-ups of crab faces, mouths, and claws, as well as scenes of crabs catching and eating smaller crabs. Territorial behavior is highlighted through multiple crab fights, both on land and underwater. The film also captures moments of crabs hiding under rocks and moving across sandy or rocky terrain, offering a fascinating and sometimes brutal glimpse into the daily life of crustaceans. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-14T00:00:00.000Z yes A/V Geeks 16mm Films no 419 CrabsMarine BiologyDocumentaryUnderwater LifeCrab BehaviorCrustaceansunderwatermarine lifecrabboxing matchJean PainleveGEFAGaumont Franco-Film Aubert https://avgeeks.videonest.co/videos/463315/cell-differentiation-the-search-for-the-organizer-1984 https://img.videonest.org/gamma/efujw72MIm4_thumbnail_resized_v2.webp https://gamma.videonest.org/efujw72MIm4_video_v3.mp4 Cell Differentiation: The Search For The Organizer (1984) In early spring, salamanders engage in courtship and mating, leading to the female laying fertilized eggs in a leaf cradle underwater. The development of salamander embryos parallels that of human embryos, providing insights into biological processes common to all animals. As the embryos grow, they undergo cell division, forming a blastula and differentiating into specialized cells that will develop into various tissues and organs. Experiments by embryologists, including Hans Spemann and Walter Folk, reveal how cells differentiate and how certain regions of an embryo can influence the development of other regions. Spemann's work demonstrated that the dorsal lip of the blastopore acts as an organizer, inducing differentiation in surrounding cells. His groundbreaking research earned him a Nobel Prize in 1935. **Keywords:** salamanders, courtship, mating, fertilized eggs, embryos, cell division, blastula, differentiation, tissues, organs, embryologists, Hans Spemann, Walter Folk, organizer, Nobel Prize. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-15T00:00:00.000Z yes A/V Geeks 16mm Films no 928 Cell DifferentiationEmbryologyHans SpemannSalamanderEmbryo DevelopmentCell MigrationBlastoporeDorsal LipOrganizerCoronet FilmsEducational FilmEctodermMesodermEndodermWalther Vogt https://avgeeks.videonest.co/videos/463383/buffy-the-bored-raccoon https://img.videonest.org/gamma/drQkpuf69Do_thumbnail_resized_v2.webp https://gamma.videonest.org/drQkpuf69Do_video_v3.mp4 Buffy the Bored Raccoon In a lovely forest, a little raccoon named Buffy feels bored and unhappy with her monotonous surroundings. Tired of the same sights and sounds, she ventures out to find excitement, first visiting a farm where she feels unwelcome, and then a busy city that overwhelms her with noise and danger. After being caught by an animal shelter worker, Buffy realizes that the city is not a suitable place for her. Eventually, she and other forest animals are returned to their home, where she appreciates the forest's beauty and excitement anew. Keywords: Buffy, raccoon, forest, boredom, adventure, farm, city, excitement, animal shelter, return, appreciation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-16T00:00:00.000Z yes A/V Geeks 16mm Films no 614 Buffy the Bored RaccoonCoronet Instructional MediaChildren's storyraccoonboredomexploringBuffybored raccoonanimal sheltercityforestanimal rescueanimal controlvintageretro https://avgeeks.videonest.co/videos/463384/the-civil-war-background-issues-1820-1860-revised-1983 https://img.videonest.org/gamma/pS1CE_MSLdc_thumbnail_resized_v2.webp https://gamma.videonest.org/pS1CE_MSLdc_video_v3.mp4 The Civil War: Background Issues (1820-1860) revised 1983 Discusses the period in U.S. history known as the "Era of Good Feelings," marked by national pride and unity under President James Monroe. However, tensions arise over the issue of slavery, particularly with Missouri's application to join the Union as a slave state, leading to the Missouri Compromise. The text highlights the economic differences between the North and South, the rise of abolitionist movements, and the impact of events like Nat Turner's rebellion and the Dred Scott decision. It culminates in the election of Abraham Lincoln, which prompts Southern states to secede, setting the stage for the Civil War. Keywords: Era of Good Feelings, James Monroe, Missouri Compromise, slavery, North, South, abolitionist movement, Nat Turner, Dred Scott, Abraham Lincoln, secession, Civil War. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-16T00:00:00.000Z yes A/V Geeks 16mm Films no 1258 Civil WarSlaveryMissouri CompromiseAbraham LincolnSecessionAbolitionismDred Scott DecisionCompromise of 1850Kansas Nebraska ActFugitive Slave LawJohn BrownHarpers FerryRobert E LeeSouth CarolinaAmerican Expansion https://avgeeks.videonest.co/videos/467044/av-geeks-16mm-lunch-6-20-2025 https://img.videonest.org/gamma/ogy-t5F0f8Y_thumbnail_resized_v2.webp https://gamma.videonest.org/ogy-t5F0f8Y_video_v3.mp4 AV Geeks 16mm Lunch 6-20-2025 Too hot outside. Join us for some cool soothing 16mm films! #avgeeks #16mmfilms 2025-06-21T00:00:00.000Z yes A/V Geeks 16mm Films no 4417 A/V Geeks16mm filmdriving safetytraffic accidentfailing marriagemarriage issuesnewspaperinvestigative reportparentingfriendshipconflictsafe drivingcommunication issuesfamily dynamicssensationalism https://avgeeks.videonest.co/videos/471743/first-american-last-american-1971 https://img.videonest.org/gamma/SOITx6R27Ag_thumbnail_resized_v2.webp https://gamma.videonest.org/SOITx6R27Ag_video_v3.mp4 First American, Last American (1971) Discusses the challenges faced by Native Americans, particularly the Navajo tribe, in contemporary society. It highlights alarming statistics regarding income, health, and education disparities compared to the national average. The narrative emphasizes the cultural differences among various tribes and the struggle of Native Americans to maintain their identity in a predominantly white society. It critiques the U.S. government's failure to uphold treaties and the impact of boarding schools on Indian children. The text also reflects on the aspirations of young Navajos, who seek to balance their cultural heritage with opportunities in the outside world, advocating for a dual identity that allows them to thrive both as Native Americans and as members of broader society. Keywords: Native Americans, Navajo tribe, income disparity, health statistics, cultural identity, U.S. government, treaties, boarding schools, assimilation, education, societal challenges, cultural preservation, identity crisis. 2025-06-21T00:00:00.000Z yes A/V Geeks 16mm Films no 894 Native AmericansNavajo Tribecultural identitytreatiesboarding schoolseducationcultural heritageNative AmericanNavajo Nationaverage incomedeath ratecultural assimilationIndian reservationRobert Kennedyland theft https://avgeeks.videonest.co/videos/475942/heat-of-solution-1959 https://img.videonest.org/gamma/475942_thumbnail_resized_v2.webp https://gamma.videonest.org/475942_video_v4.mp4 Heat Of Solution (1959) Describes an experiment to determine the heat of solution of zinc sulfate when dissolved in water. The heat of solution is defined as the heat change associated with dissolving a solute in... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 1075 Heat of Solutionzinc sulfatecalorimeterchemical reactionsolution processdistilled waterbeakerSpecific HeatThermometerUniversity of Akroncrude calorimeterwatervolumeweightexperimental value https://avgeeks.videonest.co/videos/475943/oxides-of-nitrogen-1959 https://img.videonest.org/gamma/475943_thumbnail_resized_v2.webp https://gamma.videonest.org/475943_video_v4.mp4 Oxides Of Nitrogen (1959) The film discusses three oxides of nitrogen: nitrous oxide (N2O), nitric oxide (NO), and nitrogen dioxide (NO2). It begins with the preparation of nitrous oxide by heating ammonium nitrate,... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 982 Oxides of NitrogenNitrous OxideNitric OxideNitrogen DioxideChemical ReactionChemistry ExperimentAmmonium NitrateNitrogenSolubilitycopper turningsdilute nitric acidsulfurburning splintred phosphorusoxidation reduction https://avgeeks.videonest.co/videos/475944/random-tails https://img.videonest.org/gamma/475944_thumbnail_resized_v2.webp https://gamma.videonest.org/475944_video_v4.mp4 [Random Tails] We digitized this reel of 16mm film clips that had been spliced together, occasionally in reverse or upside down. It appears that there were some deliberate scratches and punched holes. 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 880 educational filmvintage educational filmocean lifeBinary Numbersautumn monthsraking leavesUnited States NavyYellowstoneGolden Gate Bridgemarine biologytidescoastal animalsseaweedsand beachesrocky coast https://avgeeks.videonest.co/videos/475945/mosses-liverworts-and-ferns-1969 https://img.videonest.org/gamma/475945_thumbnail_resized_v2.webp https://gamma.videonest.org/475945_video_v4.mp4 Mosses: Liverworts And Ferns (1969) Most green plants, including trees, shrubs, and grasses, are spermatophytes that produce seeds. In forests, spermatophytes dominate, even in shady, moist areas. However, non-seed plants like... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 751 MossesLiverwortsFernsCoronet Filmplant lifeevolution of plantsseed plantsvascular systemmoss reproductionasexual reproductionsexual reproductiongametophytesporophytefernmoss https://avgeeks.videonest.co/videos/475946/biomes-coniferous-forest-1989 https://img.videonest.org/gamma/475946_thumbnail_resized_v2.webp https://gamma.videonest.org/475946_video_v4.mp4 Biomes: Coniferous Forest (1989) A biome is a community of living organisms adapted to a specific climate. The coniferous forest, characterized by evergreen trees like spruces, pines, and firs, is one of the major forest biomes.... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 815 Coniferous ForestForest BiomeBiomesEvergreensMooseDeerSpruceSnowshoe hareMigrating caribouGrizzly bear cubsPintail ducksBeaver swimmingRed SquirrelWinter SeasonBiome https://avgeeks.videonest.co/videos/475947/us-expansion-growth-of-a-nation-1989 https://img.videonest.org/gamma/475947_thumbnail_resized_v2.webp https://gamma.videonest.org/475947_video_v4.mp4 U.S. Expansion: Growth Of A Nation (1989) In 1845, John L. O'Sullivan coined the term "manifest destiny," signifying the belief that the United States was destined to expand across North America. By this time, the nation had grown... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 1263 US ExpansionManifest DestinyJohn L. O'SullivanLouisiana PurchaseTexasUnited States ExpansionAmerican historyfrontierslaverywestward expansionMexican-American WarAlaska PurchaseStatehoodTerritorial ExpansionOregon Territory https://avgeeks.videonest.co/videos/475948/principles-of-ionization-ionic-equilibrium-1959 https://img.videonest.org/gamma/475948_thumbnail_resized_v2.webp https://gamma.videonest.org/475948_video_v4.mp4 Principles Of Ionization: Ionic Equilibrium (1959) This educational chemistry film explores the impact of different solutes on the boiling point of water and their electrical conductivity. Through experiments, it demonstrates that non-electrolytes... 2025-06-21T16:56:43.419Z yes A/V Geeks 16mm Films no 957 principles of ionizationionic equilibriumboiling pointelectrical conductivitysoluteschemistry laboratorychemistry solutionsodium chlorideurea solutionAcetic acidHydrochloric acidElectrolysischemical reactionnonvolatile soluteion migration https://avgeeks.videonest.co/videos/475949/av-geeks-16mm-lunch-6-19-2025 https://img.videonest.org/gamma/475949_thumbnail_resized_v2.webp https://gamma.videonest.org/475949_video_v4.mp4 AV Geeks 16mm Lunch 6-19-2025 Happy Juneteenth! Let's celebrate the progressive things our country has done by watching old 16mm films! #avgeeks #16mmfilms 2025-06-21T16:56:43.458Z yes A/V Geeks 16mm Films no 3147 16mm filmvintage filmconiferous forestwildlifefusion energyfossil fuelsatomic powersnowshoe haregrizzly bearbeaverred squirrelotterA/V Geeksfilm projectorenergy source https://avgeeks.videonest.co/videos/475950/av-geeks-16mm-lunch-6-18-2025 https://img.videonest.org/gamma/475950_thumbnail_resized_v2.webp https://gamma.videonest.org/475950_video_v4.mp4 AV Geeks 16mm Lunch 6-18-2025 Really, even more 16mm films to watch! What's going on that we have so many unwatched 16mm films?! #avgeeks #16mmfilms The School Bus and You A Modern Identity Crown of Righteousness A Lesson... 2025-06-21T16:56:43.458Z yes A/V Geeks 16mm Films no 3839 16mm filmschool busschool bus safetyA/V Geeksmodern architecturereligiousbiblical dramaSaint Paulpuppet showCrown of Righteousnesssafety patrolstreet safetyarchitecturevintage filmeducation https://avgeeks.videonest.co/videos/475951/av-geeks-16mm-lunch-6-17-2025 https://img.videonest.org/gamma/475951_thumbnail_resized_v2.webp https://gamma.videonest.org/475951_video_v5_360.mp4 AV Geeks 16mm Lunch 6-17-2025 What's in our 16mm grab bag today? Join us and find out! #avgeeks #16mmfilms Hoja and the Camel's Head Beyond All Barriers Case of the Elevator Duck The Earth Belongs to the People 2025-06-21T16:56:43.458Z yes A/V Geeks 16mm Films no 4042 https://avgeeks.videonest.co/videos/475952/av-geeks-16mm-lunch-6-16-2025 https://img.videonest.org/gamma/475952_thumbnail_resized_v2.webp https://gamma.videonest.org/475952_video_v3.mp4 AV Geeks 16mm Lunch 6-16-2025 Is there a song bouncing around inside your head? What about a song bird? We got some 16mm films that talk about that. #avgeeks #16mmfilms 2025-06-17T00:00:00.000Z yes A/V Geeks 16mm Films no 4749 16mm filmsongbirdStar-Spangled BannerAmerican flagIndonesiacultural traditionsbird feedingnational anthemeducational filmA/V Geeksvintage filmrice pattiesrural lifemalaria controltraditional wedding https://avgeeks.videonest.co/videos/478441/a-father-like-that-1983 https://img.videonest.org/gamma/GE6KUb5DhL4_thumbnail_resized_v2.webp https://gamma.videonest.org/GE6KUb5DhL4_video_v3.mp4 A Father Like That (1983) "A Father Like That" (1982) is an offbeat, color short film about a young boy who faces the emotional challenge of writing a school essay about his father—despite not having one in his life. The film explores themes of imagination, longing, and identity as the boy invents a father figure to complete his assignment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-06-22T00:00:00.000Z yes A/V Geeks 16mm Films no 1047 fatherhoodorphanedSingle parentinghomeworkelementary schoolchildhood1980sgood fatherfriendshipComing of AgePhoenix Filmshomework assignmentFamily ValuesPlaygroundMr. Stone https://avgeeks.videonest.co/videos/478509/forest-fisherman-story-of-an-otter https://img.videonest.org/gamma/tnwdtxVPhWY_thumbnail_resized_v2.webp https://gamma.videonest.org/tnwdtxVPhWY_video_v3.mp4 Forest Fisherman: Story Of An Otter The observations of a forest ranger who monitors the growth of plants, trees, and wildlife, particularly focusing on the elusive otter. The ranger notes the challenges of spotting otters due to their shyness and keen senses, often only finding evidence of their presence through tracks and fish remains. Keywords: forest ranger, plants, trees, deer, fish, otter, shy, water-loving, tracks, wildlife. 2025-06-23T00:00:00.000Z yes A/V Geeks 16mm Films no 953 Forest rangerForest FishermanStory of an Otterotterwild otterfishtrackslakesstreamswildlifewater-lovinganimal conservationnatural lifeswimminghunting https://avgeeks.videonest.co/videos/551559/av-geeks-16mm-lunch-7-2-2025 https://img.videonest.org/gamma/551559_thumbnail_resized_v2.webp https://gamma.videonest.org/551559_video_v4.mp4 AV Geeks 16mm Lunch 7-2-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 3558 AV Geeks16mm filmsgardeningWinter of the Witchwitchwater conservationeducationplantparanormalmagicpancakesAnna StrasbergParents' Magazine Filmswater supplyLos Angeles River https://avgeeks.videonest.co/videos/551560/av-geeks-16mm-lunch-7-1-2025 https://img.videonest.org/gamma/551560_thumbnail_resized_v2.webp https://gamma.videonest.org/551560_video_v4.mp4 AV Geeks 16mm Lunch 7-1-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 3966 16mm FilmRPIStudent RadioHeart DiseaseV-BeltHinduismFilmHealthMechanical EngineeringMachine MaintenanceHindu WorshipA/V Geeksanalog filmstudent eventsclub sports https://avgeeks.videonest.co/videos/551561/how-to-dig-a-hole-to-the-other-side-of-the-world-1980 https://img.videonest.org/gamma/551561_thumbnail_resized_v2.webp https://gamma.videonest.org/551561_video_v4.mp4 How To Dig A Hole To The Other Side Of The World (1980) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 691 digging holesEarth's CoreGeologyAnimationChildren's AnimationEarthOceanMagmaMantlebasaltgeysersdigging equipmentLearning Corporation of AmericaSimply ScientificPolestar Production https://avgeeks.videonest.co/videos/551562/av-geeks-16mm-lunch-6-30-2025 https://img.videonest.org/gamma/551562_thumbnail_resized_v2.webp https://gamma.videonest.org/551562_video_v4.mp4 AV Geeks 16mm Lunch 6-30-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 3575 AV Geeks16mm FilmSimple MachinesAgricultural PracticesHigh-risk pregnancyMarch of DimesSoutheastern StatesVintage filmElderly carePet therapyPremature birthTextile millsTobacco FarmingUnited StatesScanning film https://avgeeks.videonest.co/videos/551563/social-responsibility-its-my-hobby-1974 https://img.videonest.org/gamma/551563_thumbnail_resized_v2.webp https://gamma.videonest.org/551563_video_v4.mp4 Social Responsibility: It's My Hobby (1974) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 568 drug usepublic service announcementteenagerdrug dealerpillssocial responsibilitypeer pressureBeau Bridgesdrug dealingfriendshipTom Lazarus https://avgeeks.videonest.co/videos/551564/revolutions-1961 https://img.videonest.org/gamma/551564_thumbnail_resized_v2.webp https://gamma.videonest.org/551564_video_v4.mp4 Revolutions (1961) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 887 revolutionaxisrotationengineeringRensselaer Polytechnic Institutelineplane surfacevertical axisinclined triangledihedral angleline rotationtrue lengthhorizontal linevertical lineoblique angles https://avgeeks.videonest.co/videos/551565/human-body-respiratory-system-2nd-ed-1980 https://img.videonest.org/gamma/551565_thumbnail_resized_v2.webp https://gamma.videonest.org/551565_video_v4.mp4 Human Body: Respiratory System (2nd Ed, 1980) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 763 Respiratory SystemHuman BodyLungBreathingGas ExchangeOxygenCarbon Dioxidealveolibronchiolesred blood cellsCirculatory SystemTracheaNosevocal cordsAir https://avgeeks.videonest.co/videos/551566/the-vertebrates-fish-rev-1985 https://img.videonest.org/gamma/551566_thumbnail_resized_v2.webp https://gamma.videonest.org/551566_video_v4.mp4 The Vertebrates: Fish (Rev, 1985) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 867 fishmarine lifeaquatic animalsvertebratesfish anatomyCoronet Filmsswim bladderlateral linewater temperaturecold-bloodedtroutmarine biologyfish speciesreproductionplankton https://avgeeks.videonest.co/videos/551567/hazards-around-bins-and-hoppers-1978 https://img.videonest.org/gamma/551567_thumbnail_resized_v2.webp https://gamma.videonest.org/551567_video_v4.mp4 Hazards Around Bins And Hoppers (1978) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 917 Mining SafetyOccupational SafetyWorkplace HazardsSafety ProceduresMaterial HandlingMine Safety and Health AdministrationFederal Mine Safety and Health Act of 1977Industrial SafetyConstruction SafetyWorkplace SafetySafety TrainingHard HatsAnimationAbstract ArtMining https://avgeeks.videonest.co/videos/551568/av-geeks-16mm-lunch-6-27-2025 https://img.videonest.org/gamma/551568_thumbnail_resized_v2.webp https://gamma.videonest.org/551568_video_v4.mp4 AV Geeks 16mm Lunch 6-27-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 3892 16mm filmVertebratesInvertebratescashier trainingsupermarket cashiercustomer serviceHistorical EventsMetrotone NewsTechnological AdvancementsCold War1958Space Agefish anatomyMarine BiologyA/V Geeks https://avgeeks.videonest.co/videos/551569/faces-ontario-1975 https://img.videonest.org/gamma/551569_thumbnail_resized_v2.webp https://gamma.videonest.org/551569_video_v4.mp4 Faces Ontario (1975) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 912 OntarioCanadaNiagara FallsThousand IslandsTorontoCN TowerStratford FestivalUpper Canada VillageParliament Hillchanging of the guardFort HenryTulip FestivalVIA Rail Canadatraveltourism https://avgeeks.videonest.co/videos/551570/hopscotch-1971 https://img.videonest.org/gamma/551570_thumbnail_resized_v2.webp https://gamma.videonest.org/551570_video_v4_360.mp4 Hopscotch (1971) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 631 hopscotchanimationshort filmchildren's filmbicyclejumping ropeChurchill Filmsanimated filmdaydreamingchildhoodhopscotch gamebeing yourselfCartoonChildren playing https://avgeeks.videonest.co/videos/551571/av-geeks-16mm-lunch-6-26-2025 https://img.videonest.org/gamma/551571_thumbnail_resized_v2.webp https://gamma.videonest.org/551571_video_v5_360.mp4 AV Geeks 16mm Lunch 6-26-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 4225 16mm filmvintage animationfire preventionfire safetyfront-end loadersafety traininggeometryrespiratory systemhuman bodyanimationpublic service announcementmining safetyworkplace safetyeducational filmLeave it to Beaver https://avgeeks.videonest.co/videos/551572/how-do-you-tell https://img.videonest.org/gamma/551572_thumbnail_resized_v2.webp https://gamma.videonest.org/551572_video_v4_360.mp4 How Do You Tell? 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 858 Public service announcementPSADrug AbuseDrug EducationHealthPeer PressureAddictionanti-drug messagedrug preventionsaying nomarijuanaalcoholgun safetycigarette smokingskateboard stunts https://avgeeks.videonest.co/videos/551573/have-a-wonderful-evening-a-babysitters-guide-to-fire-safety-1968 https://img.videonest.org/gamma/551573_thumbnail_resized_v2.webp https://gamma.videonest.org/551573_video_v4_360.mp4 Have A Wonderful Evening - A Babysitter's Guide To Fire Safety (1968) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 898 BabysittingFire SafetyChildren's SafetyEmergency PreparednessFire DrillEvacuation PlanHouse FireSmoke InhalationFiretruckEmergency ServicesChildrenTelephonePartyAir ForceOfficers Club https://avgeeks.videonest.co/videos/551575/av-geeks-16mm-lunch-6-25-2025 https://img.videonest.org/gamma/551575_thumbnail_resized_v2.webp https://gamma.videonest.org/551575_video_v5_360.mp4 AV Geeks 16mm Lunch 6-25-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 4247 16mm filmA/V Geeksspecial educationvisually impaired studentsOntarioCanadatravelvintage filmforest managementsustainable forestryloggingNiagara FallsSkip AlzheimerStuart Finleychild welfare https://avgeeks.videonest.co/videos/551576/first-aid-for-children-1974 https://img.videonest.org/gamma/551576_thumbnail_resized_v2.webp https://gamma.videonest.org/551576_video_v4_360.mp4 First Aid For Children (1974) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 940 First AidChildrenEmergency CareChild SafetyChildcareBurnsPoisoningSnake BiteDog BitesFeverDrowning VictimAsthma AttackBleedingAirwayCirculation https://avgeeks.videonest.co/videos/551577/for-today-and-tomorrow-1967 https://img.videonest.org/gamma/551577_thumbnail_resized_v2.webp https://gamma.videonest.org/551577_video_v4.mp4 For Today And Tomorrow (1967) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 943 physical therapyrehabilitationexercisehealthfracturecervical sprainmuscle testwheelchaircareer pathhealthcarePoliocollege studiespatient carevocational rehabilitationpool therapy https://avgeeks.videonest.co/videos/551578/av-geeks-16mm-lunch-6-24-2025 https://img.videonest.org/gamma/551578_thumbnail_resized_v2.webp https://gamma.videonest.org/551578_video_v4_360.mp4 AV Geeks 16mm Lunch 6-24-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 3743 16mm filmHealth educationFire safetyLumber industryEffective argumentsAddictionPeer pressureBabysittingForest fireA/V GeeksStaying healthyTree farmingSmokingMarijuanaSelf-esteem https://avgeeks.videonest.co/videos/551579/free-car-services-tire-check-and-windshield-clean https://img.videonest.org/gamma/551579_thumbnail_resized_v2.webp https://gamma.videonest.org/551579_video_v3_360.mp4 Free Car Services: Tire Check & Windshield Clean! Our attendant checks your tires and washes your windshield! Using an air hose, they inflate tires to the correct pressure. Every button press adds more air until it's perfect! All this and more, for free! #CarMaintenance #FreeServices #TireCheck #WindshieldCleaning #AutoCare #CarTips #ServiceStation #CarCleaning #VehicleCare #Automotive 2025-06-25T00:00:00.000Z yes A/V Geeks 16mm Films no 67 Flying A ServiceService StationCar MaintenanceTire CheckWindshield CleaningAuto CareCar TipsVehicle CareAutomotiveClassic CarVintage Cars https://avgeeks.videonest.co/videos/551580/gas-station-what-attendants-do-and-how-they-help https://img.videonest.org/gamma/551580_thumbnail_resized_v2.webp https://gamma.videonest.org/551580_video_v3_360.mp4 Gas Station: What Attendants Do and How They Help We explore what happens at a gas station, from ordering gasoline to checking fluids. We'll see how the attendant prepares the pump, fills the tank, and ensures your car runs smoothly. We also learn about essential car maintenance checks. #GasStation #CarMaintenance #Automotive #FuelingUp #CarCare #VehicleService #OilChange #RoadTrip #AutoTips #CarBasics 2025-06-25T00:00:00.000Z yes A/V Geeks 16mm Films no 72 Gas StationCar ServiceCar MaintenanceVintage CarAuto ServiceAutomotiveCar CareVehicle ServiceOil Change https://avgeeks.videonest.co/videos/551581/debugging-programs-understanding-computer-bugs-and-cpus https://img.videonest.org/gamma/551581_thumbnail_resized_v2.webp https://gamma.videonest.org/551581_video_v3_360.mp4 Debugging Programs: Understanding Computer Bugs & CPUs Uncover the world of computer bugs and the central processing unit (CPU)! We explore what happens inside a computer when processing data and how to debug programs. Join us to understand basic programming concepts and how CPUs work. #computerbugs #programming #CPU #debugging #computerscience #programmingbasics #tech #education #learnprogramming #computer 2025-06-25T00:00:00.000Z yes A/V Geeks 16mm Films no 44 Computer BugsCPUDebuggingComputer ScienceProgrammingProgramming BasicsCentral Processing UnitsProcessing Data https://avgeeks.videonest.co/videos/551582/computer-vs-people-who-processes-information-faster https://img.videonest.org/gamma/551582_thumbnail_resized_v2.webp https://gamma.videonest.org/551582_video_v3.mp4 Computer vs. People: Who Processes Information Faster? We explore the fundamental nature of computers as information-handling machines. We dissect how both humans and computers process data, highlighting the speed advantage computers possess. #ComputerScience #InformationProcessing #Technology #ArtificialIntelligence #MachineLearning #TechExplained #DataAnalysis #TechComparison #ComputerVsHuman #Innovation 2025-06-25T00:00:00.000Z yes A/V Geeks 16mm Films no 21 Information ProcessingComputerMachine LearningData AnalysisHumanTech Comparison https://avgeeks.videonest.co/videos/551583/av-geeks-16mm-lunch-6-23-2025 https://img.videonest.org/gamma/551583_thumbnail_resized_v2.webp https://gamma.videonest.org/551583_video_v4.mp4 AV Geeks 16mm Lunch 6-23-2025 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 4197 16mm filmvintage filmpublic healthsafety filmarchival filmeducational filmfluoridationdrug abusefirst aid https://avgeeks.videonest.co/videos/551584/the-failing-marriage-1977 https://img.videonest.org/gamma/551584_thumbnail_resized_v2.webp https://gamma.videonest.org/551584_video_v4.mp4 The Failing Marriage (1977) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 1204 marital disputedomestic violencefamily dynamicpower strugglemarriagedivorcemarital conflictcommunication issuesfamily psychologyanger managementrelationship analysisinterpersonal conflictargumentfilm grainold film https://avgeeks.videonest.co/videos/551585/from-trees-to-lumber-1953 https://img.videonest.org/gamma/551585_thumbnail_resized_v2.webp https://gamma.videonest.org/551585_video_v4.mp4 From Trees To Lumber (1953) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 750 lumber industrytimber harvestsawmillslumberloggingwoodworkingforestconstructionlumber productsplywoodveneerkilnstree farmingrenewable resourcewooden https://avgeeks.videonest.co/videos/551586/forest-for-the-future-1977 https://img.videonest.org/gamma/551586_thumbnail_resized_v2.webp https://gamma.videonest.org/551586_video_v4.mp4 Forest For The Future (1977) 2025-07-03T14:33:37.373Z yes A/V Geeks 16mm Films no 1422 Westvacoforest managementforestrytimberlandtreesseedlingsharvestingreforestationclear-cuttingwood chipssaw timbercontrolled burningwildfire managementloggingplant improvement https://avgeeks.videonest.co/videos/551603/backyard-dreams-building-a-family-pool-silent-1956 https://img.videonest.org/gamma/551603_thumbnail_resized_v2.webp https://gamma.videonest.org/551603_video_v3.mp4 Backyard Dreams: Building a Family Pool (silent, 1956) This 1956 home movie, "Building the Pool," captures the process of constructing a backyard swimming pool, likely in suburban St. Louis, Missouri. Filmed in Kodachrome and black-and-white, it showcases the efforts of workers and the family's interaction with the project. A young boy observes the construction, and the mother and children play in the partially completed pool, adding a personal and charming touch to this slice-of-life depiction. The film ends with the pool still partially filled, leaving its final state a bit of a mystery. We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-01-04T00:00:00.000Z yes A/V Geeks 16mm Films no 223 https://avgeeks.videonest.co/videos/552597/simple-machines-the-inclined-plane-family-1959 https://img.videonest.org/gamma/552597_thumbnail_resized_v2.webp https://gamma.videonest.org/552597_video_v4.mp4 Simple Machines: The Inclined Plane Family (1959) 2025-07-03T16:14:53.678Z yes A/V Geeks 16mm Films no 665 inclined planesimple machinesscrewrampEgyptian pyramidsforcedistanceworktypes of screwsrollercoastertheme parkforce measurementhistoric educational film https://avgeeks.videonest.co/videos/575182/av-geeks-16mm-lunch-7-4-2025 https://img.videonest.org/gamma/575182_thumbnail_resized_v2.webp https://gamma.videonest.org/575182_video_v5_360.mp4 AV Geeks 16mm Lunch 7-4-2025 2025-07-04T18:03:43.508Z yes A/V Geeks 16mm Films no 4015 A/V Geeks16mm LunchCivil Defense Filmfire safetyfire bombincendiary bombExplosivesBomb Safetypolice trainingexplosive devicedetonationbomb squadhigh explosivesbomb threatpublic safety https://avgeeks.videonest.co/videos/575183/companions-1982 https://img.videonest.org/gamma/575183_thumbnail_resized_v2.webp https://gamma.videonest.org/575183_video_v4.mp4 Companions (1982) 2025-07-04T18:03:43.508Z yes A/V Geeks 16mm Films no 774 Companions programanimal therapysenior citizensnursing homepet therapyelderlypuppieskittenscare homesanimal companionshipdachshundsenior livinganimal visitsdogelderly woman https://avgeeks.videonest.co/videos/575184/av-geeks-16mm-lunch-7-3-2025 https://img.videonest.org/gamma/575184_thumbnail_resized_v2.webp https://gamma.videonest.org/575184_video_v4_360.mp4 AV Geeks 16mm Lunch 7-3-2025 2025-07-04T18:03:43.508Z yes A/V Geeks 16mm Films no 3652 16mm filmeducational filmfarmingbaby foodroofingwater cycleBritish countrysideinfant nutritionroofing installationdairy farmingweatherfirst foodsfilm reelvintage filmA/V Geeks https://avgeeks.videonest.co/videos/575185/rensselaer-polytechnic-institute-admission-film-1976-version https://img.videonest.org/gamma/575185_thumbnail_resized_v2.webp https://gamma.videonest.org/575185_video_v4_360.mp4 Rensselaer Polytechnic Institute Admission Film (1976 Version) 2025-07-04T18:03:43.508Z yes A/V Geeks 16mm Films no 820 Rensselaer Polytechnic Institutestudent lifeclub sportsWRPI radiofilm productionprospective studentsmechanical engineeringelectrical engineeringcollege lifeGrand Marshal Weekstudent unionstudent activitiescollege studentsRPI1970s https://avgeeks.videonest.co/videos/575213/astronauts-walk-in-space-circa-1965 https://img.videonest.org/gamma/575213_thumbnail_resized_v2.webp https://gamma.videonest.org/575213_video_v4_360.mp4 Astronauts Walk in Space (circa 1965) 2025-07-05T05:00:15.755Z yes A/V Geeks 16mm Films no 1604 AstronautSpacewalkOuter SpaceSpace ExplorationSpacecraftEarthSpace MissionMoon RocksSpace ShuttleCollectingLunar MissionCameraCloudBaja CaliforniaAtmospheric Conditions https://avgeeks.videonest.co/videos/653332/av-geeks-16mm-lunch-7-9-2025 https://img.videonest.org/gamma/653332_thumbnail_resized_v2.webp https://gamma.videonest.org/653332_video_v3.mp4 A/V Geeks 16mm Lunch 7 9 2025 Happy birthday Stephen! #avgeeks #16mmfilms Three Faces of Stanley Inside Magoo Pitch-In Vicious Cycles 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 2918 Skip Elsheimer16mm filmAV GeeksHappy Birthday StephenThree Faces of StanleyMr. MagooPitch-InVicious CyclesAnimated FilmsAmerican Cancer Societycancer preventionanti-littering campaignenvironmentalismpublic service announcement1970s https://avgeeks.videonest.co/videos/653333/focus-1958-1982 https://img.videonest.org/gamma/653333_thumbnail_resized_v2.webp https://gamma.videonest.org/653333_video_v3.mp4 Focus 1958 (1982) Discusses the significant events and changes that occurred in 1958, highlighting the impact of these events on the future. It emphasizes the importance of understanding the past to address current issues, particularly focusing on technological advancements, political changes, and cultural phenomena. Key highlights include the launch of the first artificial satellite by the Soviet Union, America's entry into the space age with the launch of the first satellite, the introduction of the Boeing 707, the USS Nautilus's historic underwater journey, and the emergence of new leaders like Pope John XXIII and Nikita Khrushchev. The text also touches on cultural aspects, such as the popularity of the hula hoop and the success of American athletes and entertainers. Overall, 1958 is portrayed as a pivotal year that shaped the course of history. Keywords: 1958, space age, technological advancements, Sputnik, USS Nautilus, Pope John XXIII, Nikita Khrushchev, hula hoop, American culture, political changes, Van Cliburn, Alaska statehood, Cold War, Bob Hope, Elvis Presley, baseball, national pastime, peace on earth. 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 944 1958SputnikSpace AgeCold WarTechnological AdvancementsElvis PresleyNikita KhrushchevHula HoopAlaska StatehoodUSS NautilusBoeing 707Dwight EisenhowerVan CliburnJackie KennedyFilm Stock https://avgeeks.videonest.co/videos/653334/fire-breaks-out-emergency-response-and-safety https://img.videonest.org/gamma/653334_thumbnail_resized_v2.webp https://gamma.videonest.org/653334_video_v3_converted.mp4 Fire Breaks Out! Emergency Response & Safety Our team saw smoke and quickly called the fire department. We are heading to the back of the house while Sarah is calling. The boys' room is on this side. #FireEmergency #HouseFire #EmergencyResponse #SafetyFirst #CommunitySupport #FireDepartment #QuickResponse #NeighborhoodWatch #ProtectingLives #FireSafety 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 35 House FireFire EmergencyFire DepartmentEmergency ResponseCommunity SupportSafety FirstNeighborhood WatchProtecting Lives https://avgeeks.videonest.co/videos/653335/fire-safety-what-to-do-if-you-smell-smoke https://img.videonest.org/gamma/653335_thumbnail_resized_v2.webp https://gamma.videonest.org/653335_video_v3_converted.mp4 Fire Safety: What to Do if You Smell Smoke We discuss crucial fire safety steps, emphasizing what to do if you suspect a fire. Our guide covers checking door temperatures and alternative escape routes when faced with smoke. #FireSafety #EmergencyPreparedness #SafetyTips #FirePrevention #HomeSafety #EscapeRoute #SmokeSafety #SafetyFirst #FireDrill #SafetyEducation 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 26 Fire SafetyEmergency PreparednessSafety TipsFire PreventionHome SafetyEscape RouteSmoke SafetySafety FirstFire DrillSafety Education https://avgeeks.videonest.co/videos/653336/av-geeks-16mm-lunch-7-8-2025 https://img.videonest.org/gamma/653336_thumbnail_resized_v2.webp https://gamma.videonest.org/653336_video_v3.mp4 AV Geeks 16mm Lunch 7-8-2025 Coffee? Clear broth? non-red gelatin? 16mm films? We got them all today! #16mmfilms #avgeeks Les Trottoirs De Paris The Game - What Should I Do? Gravity, Weight, and Weightlessness Taper Keys: Installation and Removal Fifty Thousand Lives 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 3859 16mm filmvintage filmParisFrancefirst aidresuscitationartificial respirationgravityweightlessnesseducational videoA/V GeeksCPRmedical emergencyrescue breathingscience https://avgeeks.videonest.co/videos/653337/how-a-hindu-worships-at-a-home-shrine-1968 https://img.videonest.org/gamma/653337_thumbnail_resized_v2.webp https://gamma.videonest.org/653337_video_v3_converted.mp4 How A Hindu Worships: At A Home Shrine (1968) Describes the daily worship rituals in a traditional middle-class Brahman home in Madras, South India. The shrine, a dedicated space for worship, is prepared by the lady of the house, who cleans and decorates it with fresh flowers and auspicious designs made of rice flour. The husband, dressed respectfully, performs the worship rituals, which include offering water, leaves, and food to the household deity, Lord Krishna. The rituals involve multiple water libations, a milk bath for the deity, and the recitation of prayers and holy texts. The family shares the sanctified food and water as a form of communion, emphasizing that Hindu worship can occur at home without the need for temple visits. **Keywords:** shrine, worship, Brahman, Madras, rituals, household deity, Krishna, offerings, water libations, milk bath, prayers, Tamil, family, communion, Hinduism, home worship. 2025-07-09T00:00:00.000Z yes A/V Geeks 16mm Films no 1047 Hindu worshiphome shrineBrahman homeMadrasSouth IndiaLord Krishnareligious ritualHinduismVishnuDeityfood offeringdeityIndian culturepietySyracuse University https://avgeeks.videonest.co/videos/653338/focus-on-downers-1971 https://img.videonest.org/gamma/653338_thumbnail_resized_v2.webp https://gamma.videonest.org/653338_video_v3.mp4 Focus On Downers (1971) Shows how drug addiction may take place in the young experimenter in four to five weeks, how taking barbiturates and alcohol together may easily lead to death and how easy it is to accidentally take a lethal dose. Utilizes dramatizations to show that the personal problemswhich motivate drug use are common to all and cannot be solved by drugs. Includes questions, definitions and vocabulary. Narrated by Greg Mlved by drugs. Includes questions, definitions and vocabulary. Narrated by Greg Morris.. 2025-07-08T00:00:00.000Z yes A/V Geeks 16mm Films no 846 drug overdosebarbiturate addictionsedativesdrug abusebarbituratesdrug addictionteenage addictionprescription medicationoverdosewithdrawalpeer pressuremedical emergency911 calldriving impairmentfatal car crash https://avgeeks.videonest.co/videos/653339/av-geeks-16mm-lunch-7-7-2025 https://img.videonest.org/gamma/653339_thumbnail_resized_v2.webp https://gamma.videonest.org/653339_video_v3.mp4 AV Geeks 16mm Lunch 7-7-2025 Happy 7/7. I hope everybody is safe. We dodged a major flooding. #16mmfilms #avgeeks Characteristics of Weather Theory Poem as Evocation Me A Teenage Father Hazards Around Bins and Hoppers 2025-07-08T00:00:00.000Z yes A/V Geeks 16mm Films no 3781 16mm filmweather theoryteenage pregnancyindustrial safetymining safetyweatherpoempoetryfilm reelfilm projectorhazards around binssafety proceduresmining equipmentworker safetyhealth act 1977 https://avgeeks.videonest.co/videos/653340/english-farm-family-1948 https://img.videonest.org/gamma/653340_thumbnail_resized_v2.webp https://gamma.videonest.org/653340_video_v3.mp4 English Farm Family (1948) Discusses Britain's reliance on imported food and the efforts of British farmers to increase local production. It highlights a modern farm in southern England, managed by John Doel, which utilizes advanced machinery and methods to maximize yield. The farm produces dairy and poultry, and the Doel family is actively involved in its operations. The narrative also touches on the challenges of farming in Britain, including high taxes and food rationing, while showcasing the pride and satisfaction of the Doel family in their successful farming practices. Keywords: British food dependence, imported food, economic crisis, farming, John Doel, modern farm, mechanization, dairy production, poultry farming, food rationing, agricultural modernization, family involvement, harvest time. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-08T00:00:00.000Z yes A/V Geeks 16mm Films no 705 British farmEnglandfarmingharvestdairy farminglivestockfarming equipmentmodernizationfamily farmrural lifeGreat Britainfood supplyfarm productionCombine harvesterwheat harvest https://avgeeks.videonest.co/videos/653341/v-belts-proper-care-1979 https://img.videonest.org/gamma/653341_thumbnail_resized_v2.webp https://gamma.videonest.org/653341_video_v3_converted.mp4 V-Belts: Proper Care (1979) The V-B belt is a widely used power transmission method known for its ease of installation and reliability. Proper maintenance is crucial for optimal performance, focusing on four key areas: shiv groove inspection, belt installation, alignment, and tensioning. Regular inspections should include checking for dirt, wear, and proper tension, as most issues arise from inadequate tension. When replacing belts, it's essential to use matched sets and avoid mixing new and used belts. Proper storage and handling are also important to prevent deterioration. Following these guidelines ensures the longevity and efficiency of V-B belts. **Keywords:** V-B belt, power transmission, maintenance, shiv groove inspection, belt installation, alignment, tensioning, dirt, wear, matched sets, storage, handling, longevity, efficiency. 2025-07-07T00:00:00.000Z yes A/V Geeks 16mm Films no 852 V-beltsBelt installationBelt tensioningsheave alignmentbelt replacementmachine maintenancesheave groovebelt tensionmotor mountDayco Super Blue Ribbonv-belt tensionbelt whipsheave sidewallsdrive maintenanceDayco Corp https://avgeeks.videonest.co/videos/653342/natures-plan-1953 https://img.videonest.org/gamma/653342_thumbnail_resized_v2.webp https://gamma.videonest.org/653342_video_v3.mp4 Nature's Plan (1953) Describes the water cycle as nature's plan for providing all living things with life-giving water. Natural and time-lapse photography and animated drawings are used to clarify the mechanics of the water cycle and to study the various water cycle patterns. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-07T00:00:00.000Z yes A/V Geeks 16mm Films no 732 water cycleevaporationcondensationrainsnowsuncloudswater distributionwatershedrocky mountainscalifornia coastwaternatural processsoilplants https://avgeeks.videonest.co/videos/653343/taper-keys-installation-and-removal-1960s https://img.videonest.org/gamma/653343_thumbnail_resized_v2.webp https://gamma.videonest.org/653343_video_v3_converted.mp4 Taper Keys Installation And Removal (1960s) Shows how to measure the keyway for correct size and taper, how the key is machined and how to fit the key for the best results. Demonstrates three different ways of removing a stubborn key. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-07T00:00:00.000Z yes A/V Geeks 16mm Films no 799 taper keysinstallation processremoval processkeywaytelescoping gaugemicrometerkey fittingmachiningmetalworkingkey removalthreaded rodhydraulic jacksstrong backgib key https://avgeeks.videonest.co/videos/653344/how-electricity-makes-light-science-explained https://img.videonest.org/gamma/653344_thumbnail_resized_v2.webp https://gamma.videonest.org/653344_video_v3_converted.mp4 How Electricity Makes Light: Science Explained! We explain how electricity produces light. Our filament, made of tungsten, resists the flow of electricity, heats up, and glows instantly, creating light. Learn the science behind instant illumination. #Electricity #LightBulb #ScienceExplained #Physics #HowItWorks #Tungsten #Filament #ElectricalEngineering #DIYScience #Education 2025-07-06T00:00:00.000Z yes A/V Geeks 16mm Films no 31 ElectricityLight BulbSciencePhysicsElectrical EngineeringTungstenFilamentMetal https://avgeeks.videonest.co/videos/653345/electrical-safety-circuit-breakers-and-home-fire-prevention https://img.videonest.org/gamma/653345_thumbnail_resized_v2.webp https://gamma.videonest.org/653345_video_v3_converted.mp4 Electrical Safety: Circuit Breakers and Home Fire Prevention Our home faces electrical issues, potentially causing a fire hazard. We delve into circuit breakers, short circuits, and appliance malfunctions, emphasizing safety and troubleshooting methods. Repairing appliances is crucial to avoid electrical risks. #ElectricalSafety #CircuitBreakers #HomeSafety #ElectricalWiring #ApplianceRepair #ShortCircuit #FireHazard #DIY #HouseholdTips #ElectricalProblems 2025-07-06T00:00:00.000Z yes A/V Geeks 16mm Films no 85 electrical safetycircuit breakershome safetyelectrical wiringappliance repairshort circuitfire hazardDIYhousehold tipselectrical problems https://avgeeks.videonest.co/videos/653346/mans-problem-1953 https://img.videonest.org/gamma/653346_thumbnail_resized_v2.webp https://gamma.videonest.org/653346_video_v3.mp4 Man's Problem (1953) Discusses the critical need for water in human activities, highlighting the challenges faced in water supply management, particularly in urban areas like Los Angeles. It explains how the demand for water has led to over-extraction from natural sources, resulting in declining water levels and the need for extensive infrastructure like aqueducts and dams. While these structures can help manage water supply, they also create environmental issues, such as harming fish populations and altering ecosystems. The text emphasizes the importance of sustainable land and water management practices to preserve natural reservoirs and ensure a reliable water supply for future generations. Keywords: water, demand, supply, Los Angeles, aqueducts, dams, environmental issues, sustainability, land management, reservoirs, pollution, conservation, ecosystems, infrastructure, future generations. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-06T00:00:00.000Z yes A/V Geeks 16mm Films no 1093 water supplywater demandwater conservationLos Angeleswater resourceswater managementaqueductsdamsenvironmental issuessustainabilityland managementreservoirswater pollutionColorado RiverCalifornia https://avgeeks.videonest.co/videos/653347/why-is-it-hard-to-quit-smoking-a-friends-advice https://img.videonest.org/gamma/653347_thumbnail_resized_v2.webp https://gamma.videonest.org/653347_video_v3_converted.mp4 Why Is It Hard To Quit Smoking? A Friend's Advice We discuss the dangers of smoking cigarettes and why it's so hard to quit, and why it's important to care for our friends and their health. Discover the impact of nicotine and the importance of quitting. #quit #smoking #health #nicotine #cigarettes #friends #healthylifestyle #wellbeing #stopsmoking #addiction 2025-07-05T00:00:00.000Z yes A/V Geeks 16mm Films no 19 quit smokinghealthnicotinecigarettesaddictionfriendshealthy lifestylewellbeingstopsmokingtobacco https://avgeeks.videonest.co/videos/653348/how-to-tell-your-friend-theyre-making-a-mistake https://img.videonest.org/gamma/653348_thumbnail_resized_v2.webp https://gamma.videonest.org/653348_video_v3_converted.mp4 How To Tell Your Friend They're Making a Mistake In a world where making your way around town is a skill, we explore how to gently advise a friend about their choices to prevent them from harm. Our video offers advice on delicate communication. #FriendshipAdvice #CommunicationSkills #RelationshipTips #HealthyRelationships #KindnessMatters #Empathy #SelfCare #PositiveInfluence #SupportSystem #RelationshipGoals 2025-07-05T00:00:00.000Z yes A/V Geeks 16mm Films no 25 Friendship AdviceCommunication SkillsRelationship TipsHealthy RelationshipsKindness MattersEmpathySelf-CarePositive InfluenceSupport SystemRelationship Goals https://avgeeks.videonest.co/videos/653349/risk-factors-for-coronary-disease-1979 https://img.videonest.org/gamma/653349_thumbnail_resized_v2.webp https://gamma.videonest.org/653349_video_v3.mp4 Risk Factors For Coronary Disease (1979) Discusses the importance of understanding and managing heart disease risks. The speaker emphasizes that heart disease is a leading cause of death, often developing silently over many years. Key risk factors include smoking, high blood pressure, and high cholesterol, which can be controlled or eliminated. The speaker encourages proactive health management, including regular check-ups, a healthy diet, and stress reduction, to potentially add years to one's life. Keywords: heart disease, lifespan, risk factors, smoking, high blood pressure, high cholesterol, atherosclerosis, health management, diet, stress reduction, prevention, heart attack, stroke. 2025-07-05T00:00:00.000Z yes A/V Geeks 16mm Films no 752 Heart diseaseCoronary diseaseRisk factorsHigh blood pressureHigh cholesterolSmokingAtherosclerosisHeart attackStrokeHeart healthHealth risksHealthy dietRegular exerciseReduce stressQuit smoking https://avgeeks.videonest.co/videos/653350/first-foods-1978 https://img.videonest.org/gamma/653350_thumbnail_resized_v2.webp https://gamma.videonest.org/653350_video_v3.mp4 First Foods (1978) The first year of a baby's life is a crucial period of growth and development, where they transition from helpless infants to active little individuals. During this time, babies typically triple their weight and grow significantly in height. Proper nutrition is essential, and for the first few months, babies should only consume breast milk or formula, as solid foods can lead to allergies and obesity if introduced too early. Parents are encouraged to wait until their baby is ready, usually around three months, to introduce simple solid foods. Homemade baby food can be nutritious and safe if prepared correctly, while commercial baby foods should be chosen carefully, avoiding unnecessary additives. As babies grow, they can gradually transition to more varied textures and types of food, learning to feed themselves and developing their own preferences. Keywords: first year, baby growth, nutrition, breast milk, formula, solid foods, allergies, obesity, homemade baby food, commercial baby food, feeding, self-feeding, development, preferences. 2025-07-05T00:00:00.000Z yes A/V Geeks 16mm Films no 851 baby developmentparentingsolid foodsbaby nutritionhomemade baby foodcommercial baby foodfood safetyhygienebaby's foodnutritionself-feedingchild developmentinfant nutritionhealth tipsvegetable brush https://avgeeks.videonest.co/videos/732799/the-time-of-your-life-1985 https://img.videonest.org/gamma/732799_thumbnail_resized_v2.webp https://gamma.videonest.org/732799_video_v3.mp4 The Time Of Your Life (1985) Emphasizes the importance of time management, equating time with life itself. It discusses how we often feel we lack time and how to effectively manage the 168 hours we have each week. Key strategies include setting goals, prioritizing tasks, creating daily to-do lists, and focusing on high-value activities (A's) rather than low-value ones (C's). The author, Alan Leaken, provides practical advice on handling paperwork, avoiding procrastination, and making the best use of time. Ultimately, the message is to live life fully by managing time wisely. Keywords: time, life, time management, goals, priorities, daily to-do list, high-value activities, low-value activities, procrastination, paperwork, Alan Leaken, effective use of time, control, living fully, time robbers, 168 hours, productivity. LIMITED DISTRIBUTION. 2025-07-27T00:00:00.000Z yes A/V Geeks 16mm Films no 1607 time managementAlan Lakeinproductivity tipstask prioritizationgoal settingsetting prioritiesdaily to-do listswork life balancevalue of timedelegationhandle paperworkavoid procrastinationliving lifeuse of timecontrol your time https://avgeeks.videonest.co/videos/732800/snuffy-smokey-bears-pal-1958 https://img.videonest.org/gamma/732800_thumbnail_resized_v2.webp https://gamma.videonest.org/732800_video_v3.mp4 Snuffy: Smokey Bear's Pal (1958) In this vintage film segment, Snuffy, a forest ranger's helper, emphasizes the importance of preventing forest fires. He shares his experiences assisting Smokey the Bear in educating visitors about fire safety while enjoying their picnics. Snuffy encourages everyone to be cautious with fire and reminds viewers that they play a crucial role in preventing wildfires. Keywords Snuffy, Smokey the Bear, forest ranger, fire prevention, picnic safety, wildfires, children, fire safety education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-27T00:00:00.000Z yes A/V Geeks 16mm Films no 238 SnuffySmokey the BearForest RangerFire PreventionPicnic SafetyWildfires1958Fire Safety EducationPublic Service AnnouncementUS Department of Agriculture Forest Service https://avgeeks.videonest.co/videos/732801/av-geeks-16mm-lunch-7-25-2025 https://img.videonest.org/gamma/732801_thumbnail_resized_v2.webp https://gamma.videonest.org/732801_video_v4.mp4 AV Geeks 16mm Lunch 7-25-2025 2025-07-26T00:00:00.000Z yes A/V Geeks 16mm Films no 3782 16mm filmAV GeeksSafety Womanfire safetytraffic safetyhome safetyeducational filmsKaren Kingsleyfilm projectorsafety tipsfirst aidemergency preparednessfilm reelA/V Geeksfire prevention https://avgeeks.videonest.co/videos/732802/snorkling-skills-and-rescue-techniques-1972 https://img.videonest.org/gamma/732802_thumbnail_resized_v2.webp https://gamma.videonest.org/732802_video_v3.mp4 Snorkling Skills And Rescue Techniques (1972) Discusses essential snorkeling equipment, including masks, snorkels, and fins, emphasizing their importance in search and recovery operations. Key features for masks include a good fit, comfort, and materials like tempered glass and flexible rubber. The text also covers techniques for using the equipment, such as proper fitting, clearing water from masks and snorkels, and safe entry methods into the water. It highlights the buddy system for safety during snorkeling and rescue operations, as well as the importance of practicing skills like surface diving and porposing. Finally, it stresses that while these skills are valuable for lifesaving, a certified skin diving course is recommended for those interested in the sport. Keywords: snorkeling, mask, snorkel, fins, search and recovery, fit, comfort, tempered glass, purge valve, buddy system, entry techniques, surface diving, porposing, lifesaving, certified course. 2025-07-26T00:00:00.000Z yes A/V Geeks 16mm Films no 811 Snorkeling SkillsRescue Techniquesdiving equipmentmasksnorkelfinssnorkeling techniquesskin divingsurface divingdiving safetylifesavingrescue swimmingAmerican National Red Crosswater safetygroup search https://avgeeks.videonest.co/videos/732803/how-blood-clots-1969 https://img.videonest.org/gamma/732803_thumbnail_resized_v2.webp https://gamma.videonest.org/732803_video_v3.mp4 How Blood Clots (1969) The circulatory system is essential for human cells, providing food, oxygen, and waste removal through blood pumped by the heart. Blood circulates through vessels, containing nutrients and waste, and can clot to repair damaged vessels. Blood consists of plasma (90% water) and solid components, including red and white blood cells and platelets. Red blood cells transport oxygen, while white blood cells fight infections. Platelets are crucial for clotting, forming a mesh of fibrin that traps cells to create a clot. Clots dissolve after healing, aided by plasmin. Despite understanding clotting, challenges like preventing dangerous clots and treating hemophilia remain. Keywords: circulatory system, blood, heart, oxygen, waste removal, blood vessels, clotting, plasma, red blood cells, white blood cells, platelets, fibrin, healing, plasmin, hemophilia, blood clotting. 2025-07-25T00:00:00.000Z yes A/V Geeks 16mm Films no 787 Blood ClottingHuman Circulatory SystemRed CorpusclesBlood PlasmaFibrinogenProthrombinred blood cellswhite blood cellsplateletsfibrinplasminwound healingHemophiliableeder's diseaseCalcium https://avgeeks.videonest.co/videos/732804/av-geeks-16mm-lunch-7-24-2025 https://img.videonest.org/gamma/732804_thumbnail_resized_v2.webp https://gamma.videonest.org/732804_original_360.mp4 AV Geeks 16mm Lunch 7-24-2025 2025-07-25T00:00:00.000Z yes A/V Geeks 16mm Films no 4535 https://avgeeks.videonest.co/videos/732805/causes-of-the-seasons-1979 https://img.videonest.org/gamma/732805_thumbnail_resized_v2.webp https://gamma.videonest.org/732805_video_v3.mp4 Causes Of The Seasons (1979) Explains how the tilt of the Earth's axis and its orbit around the sun cause the changing seasons. In January, the northern hemisphere experiences winter with shorter days and lower sun angles, while the southern hemisphere enjoys summer with longer days and higher sun angles. The Earth's axis is tilted at an angle of 23.5°, which affects how sunlight reaches different parts of the Earth throughout the year. Key dates include the spring equinox (around March 21), summer solstice (around June 22), autumnal equinox (around September 22), and winter solstice (around December 22). The text emphasizes that as the Earth orbits the sun, the tilt of its axis results in varying amounts of sunlight and heat, leading to seasonal changes. Keywords: seasons, Earth's axis, tilt, orbit, sunlight, equator, winter, summer, spring equinox, summer solstice, autumnal equinox, winter solstice, northern hemisphere, southern hemisphere, daylight, sunlight angle. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-25T00:00:00.000Z yes A/V Geeks 16mm Films no 741 Causes of the SeasonsEarth's axisEarth's orbitEarth's seasonschanging seasonsSpring EquinoxSummer SolsticeAutumnal EquinoxWinter SolsticeNorthern HemisphereSouthern HemisphereEarth's revolutionaxissun's raystilt https://avgeeks.videonest.co/videos/732806/safe-play-danger-places-1975 https://img.videonest.org/gamma/732806_thumbnail_resized_v2.webp https://gamma.videonest.org/732806_video_v3.mp4 Safe Play : Danger Places (1975) Safe Play: Danger Places is a 14-minute educational film produced by Jarvis Couillard Associates and distributed by Churchill Films in 1975. The film uses pantomime to illustrate various potentially dangerous locations where children might play or hide. It features children engaging in a game of hide-and-seek with a mime, showcasing unsafe hiding spots such as the trunk of a car, a construction pipe, an abandoned house, a railroad car, and an unused freezer. The film concludes on an open-ended note, with the mime unable to find the children, emphasizing the importance of safety education and awareness of hazardous environments for children. 2025-07-24T00:00:00.000Z yes A/V Geeks 16mm Films no 882 Safe PlayDanger Placeschild safetymimesafety tipschildrenhide and seekabandoned housejunkyardconstruction sitetrainperformance1970seducational film https://avgeeks.videonest.co/videos/732807/av-geeks-16mm-lunch-7-23-2025 https://img.videonest.org/gamma/732807_thumbnail_resized_v2.webp https://gamma.videonest.org/732807_video_v4.mp4 AV Geeks 16mm Lunch 7-23-2025 2025-07-24T00:00:00.000Z yes A/V Geeks 16mm Films no 3561 16mm filmanimationcartoonlung healthmedical presentationexperimental filmbeach scenecancer researchcigarette smokeNational Film Board of CanadaEggnapperWalter Lantzabstract animationLutheran Churchvocation https://avgeeks.videonest.co/videos/732808/characteristics-of-weather-theory-1950s https://img.videonest.org/gamma/732808_thumbnail_resized_v2.webp https://gamma.videonest.org/732808_video_v3.mp4 Characteristics Of Weather Theory (1950s) Describes the dynamics of cold and warm air masses, focusing on the formation and movement of cold and warm fronts. It explains how cold dry air from the northeast creates a low-pressure area by obstructing warm moist air from the southwest. The interaction of these air masses leads to the development of weather phenomena, including clouds and precipitation. As the cold front advances, it lifts the warm air, resulting in various cloud types and weather conditions. The process of occlusion occurs when the cold front overtakes the warm front, lifting the warm air off the ground. The text also illustrates the progression of a weather wave and its impact on precipitation patterns. Keywords: cold air, warm air, low pressure, high pressure, cold front, warm front, occlusion, precipitation, air masses, weather dynamics, cloud formation, northeast winds, southwest winds, Earth's rotation, atmospheric wave. 2025-07-24T00:00:00.000Z yes A/V Geeks 16mm Films no 768 air massmeteorologyweather patternscold frontwind directionatmospheric pressurewarm airearth rotationAtmospheric WaveCloud formationPolar FrontWarm FrontPrecipitationweather systemsoccluded front https://avgeeks.videonest.co/videos/732809/the-game-what-should-i-do-1969 https://img.videonest.org/gamma/732809_thumbnail_resized_v2.webp https://gamma.videonest.org/732809_video_v3.mp4 The Game: What Should I Do? (1969) Discusses the challenges of making decisions in everyday situations, illustrated through a scenario involving three characters—Red, George, and John—who are playing a game. Red is frustrated with the rules, George is conflicted about his role as the umpire, and John is trying to mediate. Each character contemplates their options and the consequences of their actions, ultimately highlighting the importance of thinking through problems and making choices. The narrative emphasizes that when faced with dilemmas, individuals must consider various solutions and the impact of their decisions. **Keywords:** decision-making, problems, rules, game, characters, Red, George, John, consequences, choices, thinking, conflict, mediation. 2025-07-23T00:00:00.000Z yes A/V Geeks 16mm Films no 387 The GameWhat Should I Do?decision makingproblem solvinggame rulesruleschoicesconsequencesconflictRedGeorgeJohnAnimationchildrenbaseball https://avgeeks.videonest.co/videos/732810/av-geeks-16mm-lunch-7-22-2025 https://img.videonest.org/gamma/732810_thumbnail_resized_v2.webp https://gamma.videonest.org/732810_video_v4.mp4 AV Geeks 16mm Lunch 7-22-2025 2025-07-23T00:00:00.000Z yes A/V Geeks 16mm Films no 3436 industrial safetyoperator safetymachine safetysocial experimentnonverbal communicationhardwoodwoodworkinglumber productionchildren's music16mm FilmA/V Geeksfactory safetypersonal spacefurnitureanimation https://avgeeks.videonest.co/videos/732811/indian-influences-in-the-united-states-1964 https://img.videonest.org/gamma/732811_thumbnail_resized_v2.webp https://gamma.videonest.org/732811_video_v3.mp4 Indian Influences In The United States (1964) European explorers found North America to be a primitive land, but it was already home to numerous Native American tribes who had cherished it for centuries. The Europeans learned essential survival skills from these tribes, including hunting techniques and knowledge of local resources. Many modern U.S. place names, crops, and cultural practices trace their origins to Native American influences. For instance, names of states, rivers, and cities often derive from Native languages. Additionally, crops like corn, cotton, and various fruits were first cultivated by Native Americans. The influence extends to clothing, language, and art, with many Indian words and cultural elements integrated into American society. Despite the changes brought by colonization, the legacy of Native Americans remains a vital part of American heritage. **Keywords:** European explorers, North America, Native Americans, tribes, hunting, resources, place names, crops, corn, cotton, clothing, language, art, heritage. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-23T00:00:00.000Z yes A/V Geeks 16mm Films no 637 native americansunited statesindian tribesamerican historyamerican heritageindian settlementsAmerican IndianIndian influenceLacrosseClothing stylesNative AmericanFood croproadscity skylineAmerican literature https://avgeeks.videonest.co/videos/732812/les-trottoirs-de-paris-1962 https://img.videonest.org/gamma/732812_thumbnail_resized_v2.webp https://gamma.videonest.org/732812_video_v3.mp4 Les Trottoirs De Paris (1962) We are invited explore the historic Île de la Cité in Paris, highlighting its significance and beauty, including the Sainte Chapelle and the flower market. They discuss the cultural importance of flowers in France, contrasting it with their own country. The speaker also mentions various markets, restaurants, and cafés, explaining the differences between them. They describe the ambiance of the Champs-Élysées, the café culture, and the enjoyment of leisurely activities in cafés. As the speaker prepares to leave to meet their uncle, they express gratitude and say goodbye. Keywords: Île de la Cité, Paris, Sainte Chapelle, marché aux fleurs, culture, fleurs, restaurants, cafés, Champs-Élysées, stationnement, soldes, ambiance, café, tourisme, départ. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-22T00:00:00.000Z yes A/V Geeks 16mm Films no 392 ParisÎle de la CitéChamps-Élyséesflower marketFrench cafeEiffel TowerFrenchcafetourismcity centermeeting uncleCoca-Colalemonade https://avgeeks.videonest.co/videos/732813/follow-mr-willoughby-1971 https://img.videonest.org/gamma/732813_thumbnail_resized_v2.webp https://gamma.videonest.org/732813_video_v3_360.mp4 Follow Mr. Willoughby (1971) Jamie interacts with Mr. Willoughby while shopping for a surprise gift for his grandson, Billy. Jamie, who is nearly nine, decides to buy a model airplane for Billy. After some playful banter, Jamie realizes he has to hurry back home for lunch. Later, Jamie encounters some challenges while trying to deliver the gift to Mr. Willoughby, who has forgotten it. After some confusion and a bit of a rush, Jamie successfully returns the bag to Mr. Willoughby just in time before the ship departs. Keywords: Jamie, Mr. Willoughby, grandson, Billy, model airplane, gift, shopping, lunch, ship, delivery, confusion, hurry, surprise. 2025-07-22T00:00:00.000Z yes A/V Geeks 16mm Films no 750 Follow Mr. WilloughbyJamieMr. Willoughbysurprise giftmodel airplanegiftdeliveryshipcontainer shipharbordocksea travelboychildlost bag https://avgeeks.videonest.co/videos/732814/study-in-choreography-for-camera-1945-silent https://img.videonest.org/gamma/732814_thumbnail_resized_v2.webp https://gamma.videonest.org/732814_video_v3_360.mp4 Study In Choreography For Camera (1945, silent) "Study in Choreography for Camera" is an 11-minute silent black-and-white film directed by Maya Deren. The film explores the relationship between dance and cinematography, presenting the camera as an active participant in the choreography rather than merely a passive observer. Deren emphasizes the collaborative nature of movement, where both the dancer and the camera contribute to the overall expression of the dance. This film is particularly recommended for audiences interested in the interplay between dance and film techniques. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-22T00:00:00.000Z yes A/V Geeks 16mm Films no 171 Maya DerenTalley BeattyChoreographyDanceExperimental FilmSilent filmBlack and white194516mm filmA/V geeks https://avgeeks.videonest.co/videos/732815/av-geeks-lunch-7-21-2025 https://img.videonest.org/gamma/732815_thumbnail_resized_v2.webp https://gamma.videonest.org/732815_video_v4_360.mp4 AV Geeks Lunch 7 21 2025 2025-07-22T00:00:00.000Z yes A/V Geeks 16mm Films no 3437 Skateboard SafetyNative Americans16mm filmFlight AwarenessSkateboardingAmerican historyAviationVintage footageHang GlidingEnvironmentalismBasketballSports InstructionPyramid FilmsHang Ten SkateboardsFreestyle Skateboarding https://avgeeks.videonest.co/videos/732816/where-safety-starts-1947 https://img.videonest.org/gamma/732816_thumbnail_resized_v2.webp https://gamma.videonest.org/732816_video_v3_360.mp4 Where Safety Starts (1947?) Discusses the importance of driver education and tire safety in reducing accidents on highways. It emphasizes the need for proper driving training in high schools and demonstrates how different tire technologies, particularly the General Squeegee tire, enhance stopping ability and overall vehicle safety. The video features tests comparing standard tires with the new General Squeegee tires, showcasing their superior performance in emergency stopping scenarios. It concludes with a reminder that investing in driver training and quality tires is crucial for safety on the roads. Keywords driver education, tire safety, General Squeegee, accident prevention, high school training, emergency stopping, mechanical reaction, human reaction, road safety, automobile technology Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-21T00:00:00.000Z yes A/V Geeks 16mm Films no 856 driver educationtire safetyGeneral Squeegeeaccident preventionhigh school trainingemergency stoppingRoad safetyTire technologydriving safetyRoad trainingSafer tiresBrakingGeneral TireSqueegee Tiretire test https://avgeeks.videonest.co/videos/732817/rumplestiltskin-1950s https://img.videonest.org/gamma/732817_thumbnail_resized_v2.webp https://gamma.videonest.org/732817_video_v3.mp4 Rumplestiltskin (1950s?) A greedy king desires more gold and imprisons a miller's daughter, demanding she spin straw into gold or face dire consequences. The miller's daughter, unable to fulfill the task, is helped by a dwarf who spins the straw for her in exchange for her necklace. As the king continues to demand more gold, the dwarf returns, asking for her firstborn child as payment. After marrying the prince and becoming queen, she forgets her promise until the dwarf returns to claim the child. He offers her a chance to keep her baby if she can guess his name within three days. After several failed attempts, she learns his name from a page who overheard the dwarf singing in the forest, ultimately freeing herself from the dwarf's claim. **Keywords:** greedy king, miller, daughter, dream, straw, gold, dwarf, payment, prince, queen, promise, name, child. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-21T00:00:00.000Z yes A/V Geeks 16mm Films no 505 Rumpelstiltskinspin strawfairy talegreedy kingmiller's daughterspinning wheelturn to golddwarf appearsmarry the princeguess the name https://avgeeks.videonest.co/videos/732818/photographic-slides-for-instruction-1957 https://img.videonest.org/gamma/732818_thumbnail_resized_v2.webp https://gamma.videonest.org/732818_video_v3.mp4 Photographic Slides For Instruction (1957) Produced by the Indiana University Audio Visual Center in 1957, this 11-minute instructional film focuses on the fundamental techniques for creating photographic slides and their application in educational settings. The film introduces viewers to the use of the Polaroid camera and emphasizes the integration of tape recordings as narration to accompany groups of slides. Through practical demonstrations, it showcases how slides can enhance instructional materials, making them more effective for teaching purposes. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-20T00:00:00.000Z yes A/V Geeks 16mm Films no 654 photographic slidesinstructional materialseducational authorIndiana Universityphotography techniquesslide productionclassroom toolscamera equipmentclassroom activitiesslide projectorlens openingshutter speedfilm processingcowsfish https://avgeeks.videonest.co/videos/732819/for-safetys-sake-1940s https://img.videonest.org/gamma/732819_thumbnail_resized_v2.webp https://gamma.videonest.org/732819_video_v3.mp4 For Safety's Sake (1940s?) Discusses the importance of safety when using portable power tools, highlighting the need for proper precautions to prevent accidents. Joe Worker shares his experience of a near-miss accident due to neglecting safety measures, emphasizing the significance of wearing protective gear, grounding tools, and following safety guidelines. The video outlines ten essential safety rules from the National Safety Council for handling electric tools, encouraging workers to take responsibility for their safety while using powerful equipment. Keywords safety, power tools, accidents, precautions, goggles, grounding, electric tools, National Safety Council, workplace safety, training Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-20T00:00:00.000Z yes A/V Geeks 16mm Films no 770 Power toolsSafety precautionsWorkplace safetyPower tool safetyElectrical safetyTool maintenanceSafety practicesNational Safety CouncilIndustrial safetyPortable electric toolsFactory safetyJoe workerdrillgrinderelectric saw https://avgeeks.videonest.co/videos/732820/safety-is-always-1950s https://img.videonest.org/gamma/732820_thumbnail_resized_v2.webp https://gamma.videonest.org/732820_video_v3.mp4 Safety Is Always (1950s) Emphasizes the importance of safety for telephone employees both at work and at home. It highlights the company's achievements in reducing accidents through careful planning and continuous efforts. The video showcases various safety practices, such as using handrails, keeping workspaces organized, and maintaining awareness while driving and at home. It stresses that safety is a daily commitment and not just a workplace concern, with a notable statistic that more accidents occur off the job than on it. Keywords safety, workplace, accidents, awareness, prevention, first aid, home safety, driving safety, planning, employee training Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-20T00:00:00.000Z yes A/V Geeks 16mm Films no 501 workplace safetydriving safetyindustrial filmBell Telephonesafety recordhome safetyaccident preventionBell Telephone Companycarpet paddingtool storagepoison storage https://avgeeks.videonest.co/videos/732821/bicycling-with-complete-safety-1939 https://img.videonest.org/gamma/732821_thumbnail_resized_v2.webp https://gamma.videonest.org/732821_video_v3.mp4 Bicycling With Complete Safety (1939) Emphasizes the importance of bicycle safety for children, urging them to follow traffic rules and be cautious while riding. It highlights the role of civic authorities and police in promoting safety and encourages kids to ride bicycles responsibly for their health and enjoyment. The message stresses the need for proper equipment, including working brakes and lights, and the importance of being aware of one's surroundings to prevent accidents. Keywords bicycle safety, traffic rules, children, civic responsibility, police, riding tips, equipment maintenance, awareness, health benefits, community cooperation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-20T00:00:00.000Z yes A/V Geeks 16mm Films no 571 bicycle safetytraffic safetychildren safetybicycle ridingsafe riding practicesvintage safety filmpolice officerschool safetypublic servicebicycle hornvintage bicycles https://avgeeks.videonest.co/videos/732822/teeth-are-to-keep-1949 https://img.videonest.org/gamma/732822_thumbnail_resized_v2.webp https://gamma.videonest.org/732822_video_v3.mp4 Teeth Are To Keep (1949) "Teeth Are To Keep" is a 1949 Canadian animated film produced by the National Film Board of Canada (NFBC). The film uses animated paper cutouts to tell the story of a child who learns about the importance of good dental hygiene through posters displayed in his home. The child later encounters a mysterious man in the park, who is eventually revealed to be his dentist. The film serves as an educational piece on dental care. 2025-07-19T00:00:00.000Z yes A/V Geeks 16mm Films no 659 dental hygienebrushing teethtooth decaydental carevisiting dentistDental HealthStrong TeethHealthy EatingDentist Visitcartoon animationCanadaeating appleseating celeryraw carrotsRoger https://avgeeks.videonest.co/videos/732823/av-geeks-16mm-lunch-7-18-2025 https://img.videonest.org/gamma/732823_thumbnail_resized_v2.webp https://gamma.videonest.org/732823_video_v4.mp4 AV Geeks 16mm Lunch 7-18-2025 2025-07-19T00:00:00.000Z yes A/V Geeks 16mm Films no 4324 16mm film1928 world tourShanghaiHong Kongvintage carsworkplace safetysafety filmbicycle safetydriving safetyGeneral Squeegee tirestire safetyhistorical footagehome movieA/V Geeksfilm archive https://avgeeks.videonest.co/videos/732824/av-geeks-16mm-lunch-7-17-2025 https://img.videonest.org/gamma/732824_thumbnail_resized_v2.webp https://gamma.videonest.org/732824_video_v5_360.mp4 AV Geeks 16mm Lunch 7-17-2025 2025-07-18T00:00:00.000Z yes A/V Geeks 16mm Films no 4697 1928world tourhome movieJapanEarth structuregeologyeducational filmFranceindustrial safetysafety trainingworkplace safety16mm filmA/V Geeksaccident preventionsafety equipment https://avgeeks.videonest.co/videos/732825/av-geeks-16mm-lunch-7-16-2025 https://img.videonest.org/gamma/732825_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/732825_video_v5_360.mp4 AV Geeks 16mm Lunch 7-16-2025 2025-07-17T00:00:00.000Z yes A/V Geeks 16mm Films no 4078 16mm filmeducational filmtriangleEastersolderingplumbingfree enterpriseeconomic freedomolder computersslide scannergeometrybrazingvintage educational filmbusinesstaxes https://avgeeks.videonest.co/videos/732826/general-insurance-careers-1971 https://img.videonest.org/gamma/732826_thumbnail_resized_v2.webp https://gamma.videonest.org/732826_video_v4.mp4 General Insurance Careers (1971) 2025-07-18T00:00:00.000Z yes A/V Geeks 16mm Films no 1090 insurance careersunderwritingclaims adjusterrisk assessmentinsurance policyinsurance agentinsurancefield inspectionaccident investigationliabilitycar crashesfire accidentscustomer servicecollision insurancehighway traffic act https://avgeeks.videonest.co/videos/732827/soldering-brazing-copper-tubing-1973 https://img.videonest.org/gamma/732827_thumbnail_resized_v2.webp https://gamma.videonest.org/732827_video_v4.mp4 Soldering Brazing Copper Tubing (1973) 2025-07-17T00:00:00.000Z yes A/V Geeks 16mm Films no 769 copper tubingsolderingbrazingplumbingtube cuttermetalworkinghome improvementcopper pipepipe fittingbrazing alloycopper fittingsoldering processfiller metalplumbing repair https://avgeeks.videonest.co/videos/732828/av-geeks-16mm-lunch-7-15-2025 https://img.videonest.org/gamma/732828_thumbnail_resized_v2.webp https://gamma.videonest.org/732828_video_v5_360.mp4 AV Geeks 16mm Lunch 7-15-2025 2025-07-16T00:00:00.000Z yes A/V Geeks 16mm Films no 4511 16mm filmvintage filmhome movieYosemitePortrait of JennieNorman McLarenhigh jumpCanadian historyWorld War IIreligionexperimental filmblack and whiteNational Film BoardCanadafilm projector https://avgeeks.videonest.co/videos/732829/the-earth-its-structure-1960 https://img.videonest.org/gamma/732829_thumbnail_resized_v2.webp https://gamma.videonest.org/732829_video_v4.mp4 The Earth: Its Structure (1960) 2025-07-17T00:00:00.000Z yes A/V Geeks 16mm Films no 657 EarthEarth StructureEarth's crustrock typesigneous rocksedimentary rockmetamorphic rockformation of earthnatural forcesContinentsOceansCoronet FilmEducational filmSolar SystemScientist https://avgeeks.videonest.co/videos/732830/modeling-careers-1970 https://img.videonest.org/gamma/732830_thumbnail_resized_v2.webp https://gamma.videonest.org/732830_video_v4.mp4 Modeling Careers (1970) 2025-07-16T00:00:00.000Z yes A/V Geeks 16mm Films no 1036 Modeling CareersFashionPhotographyFashion ModelModelingFashion IndustryMakeup ClassPhotoshootRunway ModelCatalog ModelingModeling Agency1960sClothingHairdressingBaleewyn Films https://avgeeks.videonest.co/videos/732831/av-geeks-16mm-lunch-7-14-2025 https://img.videonest.org/gamma/732831_thumbnail_resized_v2.webp https://gamma.videonest.org/732831_video_v4.mp4 AV Geeks 16mm Lunch 7-14-2025 2025-07-15T00:00:00.000Z yes A/V Geeks 16mm Films no 3993 16mm filmdental healthphotography slidesSears freezervintage commercialadvertisinganimationoral healthfilm projectorexposure settingsfrozen foodteeth cleaningeducationalfilm collectingA/V Geeks https://avgeeks.videonest.co/videos/732832/captain-quest-1953 https://img.videonest.org/gamma/732832_thumbnail_resized_v2.webp https://gamma.videonest.org/732832_video_v4.mp4 Captain Quest (1953) 2025-07-15T00:00:00.000Z yes A/V Geeks 16mm Films no 802 Captain QuestSouth Africasnake farmsnake milkingPort Elizabethvenom extractioncoconut farmcoconut harvestingsisal plantsisal harvestingsisal leavessisal fiberharvestingtropical agricultureRichard Coogan https://avgeeks.videonest.co/videos/732833/flashing-roof-openings-1973 https://img.videonest.org/gamma/732833_thumbnail_resized_v2.webp https://gamma.videonest.org/732833_video_v4.mp4 Flashing Roof Openings (1973) 2025-07-15T00:00:00.000Z yes A/V Geeks 16mm Films no 771 roof repairroofing feltflashing installroof flashingroofingflashingroof maintenanceplastic cementweldingflangeflashing roof openingscaulkpitch pocketroofing cementroof coating https://avgeeks.videonest.co/videos/732834/points-and-lines-1961 https://img.videonest.org/gamma/732834_thumbnail_resized_v2.webp https://gamma.videonest.org/732834_video_v4.mp4 Points And Lines (1961?) 2025-07-15T00:00:00.000Z yes A/V Geeks 16mm Films no 833 pointslinesgeometrymathmathematical characteristicsthree-dimensionaltrue lengthtrue slopeplanar linesplanar pointshorizontal linefrontal linesprofile linesoblique linespring steel https://avgeeks.videonest.co/videos/732835/canada-1944 https://img.videonest.org/gamma/732835_thumbnail_resized_v2.webp https://gamma.videonest.org/732835_video_v4.mp4 Canada (1944) 2025-07-15T00:00:00.000Z yes A/V Geeks 16mm Films no 631 CanadacanadianprovincesNorth AmericaWorld War IIIndustrializationCanadian cultureHalifaxMontrealTorontoVancouverOgdensburg AgreementLand-Lease ProgramUnited Kingdomspeech https://avgeeks.videonest.co/videos/732836/republic-of-the-philippines-1959 https://img.videonest.org/gamma/732836_thumbnail_resized_v2.webp https://gamma.videonest.org/732836_video_v4.mp4 Republic Of The Philippines (1959) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 1057 PhilippinesPhilippine IslandsManilaRepublic of PhilippinesIsland geographyCultural diversityTropical climateRice farmingPineapple canningPhilippine AirlineIndustrial developmentEducationMount MayonPhilippine mahoganyWWII history https://avgeeks.videonest.co/videos/732837/running-broad-jump-1960 https://img.videonest.org/gamma/732837_thumbnail_resized_v2.webp https://gamma.videonest.org/732837_video_v4.mp4 Running Broad Jump (1960) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 833 Running Broad JumpTrack and FieldDr. Frank RyanYale UniversityAthletic TrainingJump TrainingBroad JumpJumping TechniqueLeg ExercisesConditioning ProgramPop UpMental Focuslong jumpathlete landingrunning jump https://avgeeks.videonest.co/videos/732838/easter-season-1952 https://img.videonest.org/gamma/732838_thumbnail_resized_v2.webp https://gamma.videonest.org/732838_video_v4.mp4 Easter Season (1952) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 609 Easter seasonEaster traditionsreligious celebrationspring festivalsegg decoratinghot cross bunsreligious traditionscultural customsEaster Sundayeaster eggsCoronet Filmspring timenew birthbakingeaster song https://avgeeks.videonest.co/videos/732839/av-geeks-16mm-lunch-7-11-2025 https://img.videonest.org/gamma/732839_thumbnail_resized_v2.webp https://gamma.videonest.org/732839_video_v4.mp4 AV Geeks 16mm Lunch 7-11-2025 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 3770 filmvintageSouth AfricaAfrican FarmingInsurance Careersinsuranceanimationstop motion animationmodeling careersfashionNasr-ed-din HojaEmperor's Elephantcareer opportunitiesAgriculturerope making https://avgeeks.videonest.co/videos/732840/triangles-an-introduction-1965 https://img.videonest.org/gamma/732840_thumbnail_resized_v2.webp https://gamma.videonest.org/732840_video_v4.mp4 Triangles: An Introduction (1965) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 604 Film Associatestrianglegeometrymathshapeeducational consultantline segmentequilateral triangleisosceles trianglescalene trianglegeometric shapeintroduction https://avgeeks.videonest.co/videos/732841/the-poem-as-evocation-roblins-mill-1975 https://img.videonest.org/gamma/732841_thumbnail_resized_v2.webp https://gamma.videonest.org/732841_video_v4.mp4 The Poem as evocation: Roblin's mill (1975) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 527 Roblin's Millhistoric millAmerican Historypoetrywater wheelgraveyardcemeterytombstonesAl PurdyLearning CorporationRoblin's Millsrowing boat https://avgeeks.videonest.co/videos/732842/gravity-weight-and-weightlessness-1963 https://img.videonest.org/gamma/732842_thumbnail_resized_v2.webp https://gamma.videonest.org/732842_video_v4.mp4 Gravity, Weight, And Weightlessness (1963) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 628 gravityweightweightlessnessAstronautsSpace TravelOrbital Mechanicseducational videoroller coasterspace capsuleFilm Associates of Californiafilm grainfilm damageArtificial Satellitesabstract animation https://avgeeks.videonest.co/videos/732843/av-geeks-16mm-lunch-7-10-2025 https://img.videonest.org/gamma/732843_thumbnail_resized_v2.webp https://gamma.videonest.org/732843_video_v5_360.mp4 AV Geeks 16mm Lunch 7-10-2025 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 4010 16mm filmpoisonous plantsplumbing repairspoison ivyplant identificationclogged drainfaucet repairDIY plumbingplant safetytoilet repairtoxic plantseducational filmav geeksvintage filmdrain cleaner https://avgeeks.videonest.co/videos/732844/me-a-teen-father-1980 https://img.videonest.org/gamma/732844_thumbnail_resized_v2.webp https://gamma.videonest.org/732844_video_v4.mp4 Me, A Teen Father (1980) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 808 Centron FilmsTeen pregnancyTeen parentingComing of ageTeenage relationshipsTeen sexPeer pressureGuiltPregnancyAdoptionParentingTeenagerLouise Lee FloetheRonald FloetheAbortion https://avgeeks.videonest.co/videos/732845/rigging-equipment-over-the-floor-1980 https://img.videonest.org/gamma/732845_thumbnail_resized_v2.webp https://gamma.videonest.org/732845_video_v4.mp4 Rigging Equipment Over The Floor (1980) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 986 rigging equipmentsafety trainingheavy liftingmoving loadsmaterial handlingsafety precautionsheavy equipmentjacksdollieswinchsnatch blockroller methodsteel dolliesskidtimber skids https://avgeeks.videonest.co/videos/732846/fluoridation-a-white-paper-1974 https://img.videonest.org/gamma/732846_thumbnail_resized_v2.webp https://gamma.videonest.org/732846_video_v4_360.mp4 Fluoridation: A White Paper (1974) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 832 fluoridewater fluoridationtooth decaydental healthpublic healthdental expertsoral healthdental carepreventive medicineFluoridationPreventive DentistryAmerican Dental AssociationFluoride treatmentmobile dental unitwater treatment https://avgeeks.videonest.co/videos/732847/too-small-too-soon-1984 https://img.videonest.org/gamma/732847_thumbnail_resized_v2.webp https://gamma.videonest.org/732847_video_v4_360.mp4 Too Small Too Soon (1984) 2025-07-14T00:00:00.000Z yes A/V Geeks 16mm Films no 913 March of DimesPremature birthBirth defectspregnancy challengeRobert CreasyDES daughterpreterm laborbed restpregnancyDr. Creasypreterm programprematurity preventionhigh-risk pregnancycontractionsGail Weaver https://avgeeks.videonest.co/videos/732868/av-geeks-lunch-9-15 https://img.videonest.org/gamma/732868_thumbnail_resized_v2.webp https://gamma.videonest.org/732868_video_v4_360.mp4 AV Geeks Lunch 9-15 2021-07-28T00:00:00.000Z yes A/V Geeks 16mm Films no 3154 safetymachinerycaterpillarheavy equipmentsignalsworkplace safety https://avgeeks.videonest.co/videos/732869/av-geeks-lunch-9-15 https://img.videonest.org/gamma/732869_thumbnail_resized_v2.webp https://gamma.videonest.org/732869_video_v4_360.mp4 AV Geeks Lunch 9-15 2021-07-28T00:00:00.000Z yes A/V Geeks 16mm Films no 2038 16mm filmnewsreelsarchival footagevintagedisastersbaseballmusicorchestra https://avgeeks.videonest.co/videos/784659/av-geeks-16mm-lunch-7-28-2025 https://img.videonest.org/gamma/784659_thumbnail_resized_v2.webp https://gamma.videonest.org/784659_video_v4.mp4 AV Geeks 16mm Lunch 7-28-2025 2025-07-28T00:00:00.000Z yes A/V Geeks 16mm Films no 3630 AV Geeks16mm filmfilm scanningfirst aidpolice dispatcherdefensive drivinganimationvintage filmemergency callradio communicationdriving safetyfilm reelfilm projectoractresstraffic safety https://avgeeks.videonest.co/videos/784660/parable-1964 https://img.videonest.org/gamma/784660_thumbnail_resized_v2.webp https://gamma.videonest.org/784660_video_v3.mp4 Parable (1964) Parable (1964) is a 15-minute film directed by Rolf Forsberg, presented in pantomime. The story follows a white-faced clown who joins a circus parade and selflessly takes on the burdens of the lowly, abused, and humiliated individuals he encounters. His acts of love and compassion ultimately lead to his death, reminiscent of the crucifixion of Jesus. The film serves as a poignant parable, open to various interpretations, and encourages discussions on ethics, Christian faith, and human involvement. It is produced by the National Council of the Churches of Christ. 2025-07-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1211 Parable filmcircusclownvintage filmmime artistpuppet showCircus World MuseumBaraboo WisconsinClarence MitchellRolf ForsbergMagnus The Greatliving marionettesparade floatselephantsfilm artifacts https://avgeeks.videonest.co/videos/784661/marine-compilation-1940s https://img.videonest.org/gamma/784661_thumbnail_resized_v2.webp https://gamma.videonest.org/784661_video_v3.mp4 [Marine Compilation, 1940s?] The film provides a historical overview of the United States Marine Corps, highlighting their traditions, uniforms, and significant battles throughout history, particularly during the Civil War and World War II. It emphasizes the evolution of the Marine uniform and the pride associated with it, while also recounting the experiences of Marine Barney Ross, a former boxing champion who served in the Marines during WWII. The film details the brutal combat faced by Marines during the invasion of Guam, showcasing their resilience and commitment to duty despite heavy casualties. Keywords Marine Corps, history, uniforms, Barney Ross, WWII, Guam, battles, traditions, pride, combat Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-28T00:00:00.000Z yes A/V Geeks 16mm Films no 1692 Marine CorpsUnited States Marine CorpsUS MarinesWorld War IIGuamPacific TheaterBarney RossMilitary HistoryMarine uniformleathernecksisland hoppingJapanese forcesGuadalcanalAmphibious LandingPacific War https://avgeeks.videonest.co/videos/879256/av-geeks-16mm-lunch-8-1-2025 https://i.ytimg.com/vi/YS7dXsN0jSQ/hqdefault.jpg?sqp=-oaymwEbCKgBEF5IVfKriqkDDggBFQAAiEIYAXABwAEG&rs=AOn4CLCFfPVXL1LS2VCfQmxCs-qyr7Xacw https://gamma.videonest.org/879256_video_v5_360.mp4 AV Geeks 16mm Lunch 8- 1-2025 2025-08-01T00:00:00.000Z yes A/V Geeks 16mm Films no 4247 https://avgeeks.videonest.co/videos/879257/furious-flycycle-1980 https://img.videonest.org/gamma/879257_thumbnail_resized_v2.webp https://gamma.videonest.org/879257_video_v3.mp4 Furious Flycycle (1980) Melvin Spitzagel, an aspiring inventor, lives in a house with an apple tree and a barn used as his workshop. He has a knack for fixing mechanical devices, earning him the title of "mechanical wizard." One day, he helps fix a broken freezer at his father's ice cream plant, which leads to a reward of a new bicycle. Melvin admires the famous inventor Professor Mickey, who has moved to his town but remains reclusive. After a chance encounter with the professor, Melvin expresses his desire to become an inventor. Despite the professor's warnings about the challenges of invention, Melvin remains determined. When his relatives go missing during a canoe trip, he uses his inventions to rescue them, realizing the difficulties of being a mechanical wizard. Keywords: Melvin Spitzagel, inventor, mechanical wizard, apple tree, barn, ice cream plant, Professor Mickey, reclusive, ambition, workshop, canoe expedition, rescue, challenges, determination. 2025-08-01T00:00:00.000Z yes A/V Geeks 16mm Films no 704 Melvin SpitznagleFlying BicycleFamily Rescueanimated storyanimationChurchill FilmsProfessorwild duckhomecomingNick Bosustowscientific wizardProfessor MickymackeyLaboratoryElectrocarbon BoxManasacqui River https://avgeeks.videonest.co/videos/879258/av-geeks-16mm-lunch-7-31-2025 https://img.videonest.org/gamma/879258_thumbnail_resized_v2.webp https://gamma.videonest.org/879258_video_v4.mp4 AV Geeks 16mm Lunch 7-31-2025 2025-08-01T00:00:00.000Z yes A/V Geeks 16mm Films no 3899 16mm FilmA/V GeeksWaterEducational FilmUS HistoryGerald FordRichard NixonWatergate ScandalAnti-Drug EducationDrug UseWater ScienceStates of MatterAnimationPuppet ShowStorytelling https://avgeeks.videonest.co/videos/879259/you-bring-your-lunch-and-ill-bring-mine-1980 https://img.videonest.org/gamma/879259_thumbnail_resized_v2.webp https://gamma.videonest.org/879259_video_v3.mp4 You Bring Your Lunch And I'll Bring Mine (1980) Children discussing their aspirations of growing up, comparing themselves to caterpillars, moths, and butterflies. They explore themes of identity, acceptance, and understanding, particularly in relation to a new, quiet classmate. The children engage in games that encourage participation and self-expression, culminating in a song about love and connection among all children. Keywords: children, love, caterpillars, moths, butterflies, identity, acceptance, understanding, games, self-expression, connection 2025-08-01T00:00:00.000Z yes A/V Geeks 16mm Films no 732 ButterflyChildrenClassroomLearningSingingChildhoodSchoolKidsHappyCartoonGrowing UpSandy Offenheimzitherautoharpname song https://avgeeks.videonest.co/videos/879260/farm-boy-of-hungary-1974 https://img.videonest.org/gamma/879260_thumbnail_resized_v2.webp https://gamma.videonest.org/879260_video_v3.mp4 Farm Boy Of Hungary (1974) **Farm Boy of Hungary** (1974, 19 min) is a quiet, observational portrait of rural life in 1970s Hungary, seen through the eyes of a young boy. As he accompanies his uncle to the village market, viewers experience the rhythms of the countryside—working on the family farm, attending school, and participating in daily chores. The film emphasizes traditional values, community life, and the bond between generations in an agrarian setting. Produced by Barr Films, it captures both the simplicity and richness of a child's life in a Hungarian farming village. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-01T00:00:00.000Z yes A/V Geeks 16mm Films no 1140 Hungaryfarm lifefamily farmharvestingmaking cheesebaking breadpet rabbitsfamily visitRural lifeFarmChildhoodHungarian schoolEastern europeSummerFamily https://avgeeks.videonest.co/videos/879261/yours-to-keep-and-protect-spanish https://img.videonest.org/gamma/879261_thumbnail_resized_v2.webp https://gamma.videonest.org/879261_video_v3.mp4 Yours To Keep And Protect (Spanish) The film features performances by María Mano as the die-cutting machine operator, Miguel Grande as the production manager, and Juan Índice as the maintenance manager. The narrative begins with a tense situation where María, an experienced operator, recounts a near-accident involving a new operator who bypassed safety barriers. The film emphasizes the importance of training, common sense, and various safety mechanisms, such as fixed barriers, automatic feeders, and protective devices like wrist straps and two-hand controls. It also highlights the role of engineering in designing safer equipment and processes, the necessity of proper lighting, and the use of electronic sensors to prevent accidents. The film concludes by stressing the importance of safety in all aspects of manufacturing, from design to maintenance, and the benefits of protecting personnel for the overall success of the business. 2025-07-31T00:00:00.000Z yes A/V Geeks 16mm Films no 994 industrial safetyworkplace safetypunch pressmachineryaccident preventionsafety trainingfixed barrieroperator safetysafety measurestwo-hand controlelectronic sensorsmanufacturing safetyEngineering designnoise reductionsafety maintenance https://avgeeks.videonest.co/videos/879262/av-geeks-16mm-lunch-7-30-2025 https://i.ytimg.com/vi/a6doHICrQPI/hqdefault.jpg?sqp=-oaymwE1CKgBEF5IVfKriqkDKAgBFQAAiEIYAXABwAEG8AEB-AH-CYAC0AWKAgwIABABGGUgQChMMA8=&rs=AOn4CLCmalDVvNq7-htCM0iGyVVYjWsIyQ https://gamma.videonest.org/879262_video_v5_360.mp4 AV Geeks 16mm Lunch 7-30-2025 2025-07-31T00:00:00.000Z yes A/V Geeks 16mm Films no 4406 https://avgeeks.videonest.co/videos/879263/invisible-walls-1968 https://img.videonest.org/gamma/879263_thumbnail_resized_v2.webp https://gamma.videonest.org/879263_video_v3.mp4 Invisible Walls (1968) Discusses the importance of social interaction and personal space within a culture. It explains how members of a society develop shared expectations and behaviors that facilitate communication, including non-verbal cues and gestures. As individuals grow, they learn cultural norms regarding personal space, which varies across cultures. The film describes an experiment where actors invade the personal space of unsuspecting subjects, revealing common reactions such as body stances, eye aversions, and fidgeting. It highlights differences in how men and women respond to personal space violations and notes that children have different boundaries compared to adults. The film concludes by suggesting that as populations grow, personal space may become increasingly limited. Keywords: social interaction, personal space, cultural norms, non-verbal communication, gestures, body language, reactions, men, women, children, expectations, society, boundaries, population growth. 2025-07-31T00:00:00.000Z yes A/V Geeks 16mm Films no 713 social interactionpersonal spacecultural normsnon-verbal communicationbody languagesocial behaviorsocial psychologyphysical contactsocial normsUnited Stateschildrenculturecrowded countriesInvisible WallsRichard A. Cowan https://avgeeks.videonest.co/videos/879264/primitive-man-in-our-world https://img.videonest.org/gamma/879264_thumbnail_resized_v2.webp https://gamma.videonest.org/879264_video_v3.mp4 Primitive Man In Our World Primitive man still exists on the island of New Guinea, where tribes live a simple life, largely untouched by modern civilization. The tropical climate supports dense jungles, providing the natives with food, clothing, and shelter. They rely on canoes for transportation, as rivers serve as the main highways due to the challenging terrain. The people create their own tools and homes using materials from the jungle, and they engage in traditional cooking methods for communal feasts. Their artistic expressions, including masks and carvings, are integral to their culture and spirituality. Overall, life in New Guinea is characterized by a close relationship with nature. Keywords: New Guinea, primitive man, tribes, tropical climate, jungles, transportation, canoes, food, clothing, shelter, rivers, communication, cooking, communal feasts, art, spirituality, nature. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-30T00:00:00.000Z yes A/V Geeks 16mm Films no 726 New GuineaPrimitive ManTropical climateNative peopleIndigenous PeopleTraditional housesRiver TravelTraditional FeastJungleSwampprimitive villageHouse Tambaramreligious arttribal maskssago palm https://avgeeks.videonest.co/videos/879265/av-geeks-16mm-lunch-7-29-2025 https://img.videonest.org/gamma/879265_thumbnail_resized_v2.webp https://gamma.videonest.org/879265_video_v4.mp4 AV Geeks 16mm Lunch 7-29-2025 2025-07-30T00:00:00.000Z yes A/V Geeks 16mm Films no 3691 16mm LunchSkip ElsheimerParable of the Good SamaritanTin miningMalaysiaProblem solvingA/V Geeks16mm filmBiblical storyJesusShort filmFamily lifeChristianityFilm preservationreligious film https://avgeeks.videonest.co/videos/879266/flight-a-new-awareness-1973 https://img.videonest.org/gamma/879266_thumbnail_resized_v2.webp https://gamma.videonest.org/879266_video_v3.mp4 Flight.. A New Awareness (1973) Produced by Barr Films in 1973, "Flight - A New Awareness" is a 14-minute film that explores the relationship between humanity and the Earth through the lens of flight. The film emphasizes our responsibilities to ourselves and the environment, highlighting how the perspective gained from flight can alter our understanding of the world. By showcasing the beauty and fragility of the planet from above, it encourages viewers to reflect on their role in preserving the environment and fostering a deeper connection with the Earth. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-30T00:00:00.000Z yes A/V Geeks 16mm Films no 821 flightaerial viewearthnaturelandscapeaerial footagemountainsmountain rangeglidinghang glidingairplanesailplaneair sportsnatural beautyforest https://avgeeks.videonest.co/videos/879267/safety-peril-rides-the-road-1978 https://img.videonest.org/gamma/879267_thumbnail_resized_v2.webp https://gamma.videonest.org/879267_video_v3.mp4 Safety: Peril Rides The Road (1978) The long lost third film featuring Safety Woman/Guardiana! Ms. Karen Kingsley is a talented freelance architect who volunteers as a crossing guard in her community. After a visit to her aunt, she gains extraordinary powers from a group called the Stellen, who give her a ring that symbolizes her new role as "Guardiana," the safety woman. She is tasked with teaching children about safety, including rules for walking and biking, and emphasizes the importance of being aware, alert, and alive. Throughout her day, she interacts with children, reminding them of safety practices and encouraging them to join the "Danger Dodger Club." Keywords: Karen Kingsley, freelance architect, crossing guard, extraordinary powers, Stellen, Guardiana, safety woman, community service, safety rules, children, awareness, alertness, alive, Danger Dodger Club, biking safety, pedestrian safety, volunteer. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-29T00:00:00.000Z yes A/V Geeks 16mm Films no 937 Safety WomanKaren Kingsleysafety educationwalking safetybiking safetypedestrian safetytraffic rulesrules of the roadcrossing guardbicycle safetycar safetybus safetysafetyBarr Filmsschool bus https://avgeeks.videonest.co/videos/879268/shooting-in-basketball-1946 https://img.videonest.org/gamma/879268_thumbnail_resized_v2.webp https://gamma.videonest.org/879268_video_v3.mp4 Shooting In Basketball (1946) Discusses the importance of scoring in basketball and emphasizes the need for players to practice both set and running shots. It focuses on the two-handed set shot, detailing the proper stance, grip, and shooting mechanics. Key points include foot positioning, body posture, the motion of the shot, and the significance of shot trajectory for scoring success. The text also highlights the differences in individual shooting styles and the importance of practice for achieving a graceful shooting technique. Keywords: scoring, basketball, set shots, two-handed set shot, stance, grip, shooting mechanics, trajectory, practice, individual style, accuracy, follow-through, knee dip, body posture. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-07-29T00:00:00.000Z yes A/V Geeks 16mm Films no 566 basketballbasketball shootingset shotinstructional videoWilbur JohnsNorman Spertwo-handed set shotbasketball techniquesbasketball skillsbasketball trainingball handlingbasketball formscoring shots https://avgeeks.videonest.co/videos/924381/av-geeks-16mm-lunch-8-5-2025 https://i.ytimg.com/vi/FTscKZmF7dc/hqdefault.jpg?sqp=-oaymwEbCKgBEF5IVfKriqkDDggBFQAAiEIYAXABwAEG&rs=AOn4CLCCXAJlle9WuEARF7QJ2XlTPYGvxA https://gamma.videonest.org/924381_video_v5_360.mp4 AV Geeks 16mm Lunch 8-5-2025 2025-08-05T00:00:00.000Z yes A/V Geeks 16mm Films no 4273 https://avgeeks.videonest.co/videos/924382/parable-of-the-good-samaritan-1950s https://img.videonest.org/gamma/924382_thumbnail_resized_v2.webp https://gamma.videonest.org/924382_video_v3.mp4 Parable of the Good Samaritan (1950s?) **Good Samaritan** (15 min, 16mm) is a puppet-based retelling of the classic biblical parable, produced by Yale University Divinity School. Using simple yet expressive puppetry, the film brings to life the story of compassion, kindness, and moral duty as a Samaritan aids an injured man ignored by others. Designed for educational or religious instruction, the film emphasizes themes of empathy, mercy, and crossing cultural divides to help those in need. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-05T00:00:00.000Z yes A/V Geeks 16mm Films no 587 Good Samaritanparablereligious studiesBiblical storyReligious parableCompassionChristian teachingsJesusJerusalemJerichotheftMinistryJesus Christ https://avgeeks.videonest.co/videos/924383/av-geeks-16mm-lunch-8-4-2025 https://img.videonest.org/gamma/924383_thumbnail_resized_v2.webp https://gamma.videonest.org/924383_video_v4.mp4 AV Geeks 16mm Lunch 8-4-2025 2025-08-05T00:00:00.000Z yes A/V Geeks 16mm Films no 3834 AV Geeks16mm filmfilm projectorcycling racehuntinganimal crueltybicycle raceendurance athletecountrysideCornfieldbirds of preyEli WallachArthur MillerJohn MarinoNew York https://avgeeks.videonest.co/videos/924384/defensive-driving-tactics-1964 https://img.videonest.org/gamma/924384_thumbnail_resized_v2.webp https://gamma.videonest.org/924384_video_v3.mp4 Defensive Driving Tactics (1964) **Defensive Driving Tactics** (1964, 12 min) is a safety education film that dramatizes the dangers posed by so-called “offender-type drivers.” Through a series of vignettes, it illustrates reckless behaviors on the road and highlights the consequences of aggressive or careless driving. A staged road test reveals that a driver who rushed to save a few minutes committed 138 traffic violations—proving that speed and shortcuts aren’t worth the risk. Produced by Charles Cahill and Associates, the film promotes defensive driving as the smarter, safer approach behind the wheel. 2025-08-05T00:00:00.000Z yes A/V Geeks 16mm Films no 630 defensive drivingroad safetytraffic safetydriving safetycar accidentdriving spacealternate planright of waydriving testChicagoEvanstonHoward PyleNational Safety CouncilABC's https://avgeeks.videonest.co/videos/924385/lifeline-dispatcher-communications-1976 https://img.videonest.org/gamma/924385_thumbnail_resized_v2.webp https://gamma.videonest.org/924385_video_v3.mp4 Lifeline – Dispatcher Communications (1976) Lifeline – Dispatcher Communications (1976) is a brief but focused educational film produced by the Motorola Teleprogram Center. It emphasizes the critical role of dispatchers in supporting police officers on duty, portraying them as a vital communication link—or "lifeline"—between officers in the field and the resources they need. The film highlights how effective dispatcher communication ensures officer safety, rapid response, and coordinated law enforcement operations. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-04T00:00:00.000Z yes A/V Geeks 16mm Films no 992 Police DispatcherRadio CommunicationPolice Officer911 callsEmergency ServicesLaw EnforcementMotorola Teleprograms Inc.Robbery ReportVehicle StopCar accidentPossible burglaryAmbulance requestPolice Station10-4City Police https://avgeeks.videonest.co/videos/924386/money-money-money-1983 https://img.videonest.org/gamma/924386_thumbnail_resized_v2.webp https://gamma.videonest.org/924386_video_v3.mp4 Money, Money, Money (1983) Money, Money, Money (1983, color) is a short educational segment from Screen News Digest that explores the central role of money in shaping modern society. It presents money as both a driving force and a unifying element in economic and social systems. Featuring archival footage—such as FDR's "fear itself" speech, scenes from the Great Depression, factory assembly lines, and an early ATM—the film also looks ahead, predicting the rise of home banking. Produced by Hearst, it offers a brief but impactful look at the evolving financial landscape. 2025-08-04T00:00:00.000Z yes A/V Geeks 16mm Films no 931 moneyGreat DepressionbanksFederal Reserveeconomic prosperitycentral bankingcurrencymoney supplyinflationfiscal policyWorld War IIbank loansfinancial securityATM MachineHome Banking https://avgeeks.videonest.co/videos/924387/too-much-of-a-good-thing-1982 https://img.videonest.org/gamma/924387_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/924387/too-much-of-a-good-thing-1982 Too Much Of A Good Thing (1982) The story follows two boys, Dwayne and Gerald, who are best friends despite their differing socioeconomic backgrounds—Dwayne is wealthy while Gerald is poor. They enjoy watching TV together, but Dwayne neglects his studies, leading to poor academic performance. Gerald studies hard and eventually graduates, while Dwayne does not. As adults, Gerald becomes a successful architect, while Dwayne inherits his father's business but fails to manage it and ends up bankrupt. Dwayne finds work as a handyman in one of Gerald's buildings, where he continues to watch TV. Keywords: Dwayne, Gerald, friendship, socioeconomic differences, television, school, studies, graduation, success, failure, architect, handyman, bankruptcy. 2025-08-03T00:00:00.000Z yes A/V Geeks 16mm Films no 736 DwayneGeraldfriendshipsocioeconomic differencestelevision habitsschoolstudiesgraduationsuccessfailurearchitecthandymanbankruptcychildhoodbest friends https://avgeeks.videonest.co/videos/924388/reading-growth-reading-creatively-1968 https://img.videonest.org/gamma/924388_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/924388/reading-growth-reading-creatively-1968 Reading Growth: Reading Creatively (1968) Discusses the difference between a good reader and a creative reader. While a good reader can understand and remember facts, a creative reader engages with the material critically, questioning and comparing information from various sources. The creative reader not only retains facts but also reflects on them, leading to personal growth and a deeper understanding of the content. Examples include questioning historical facts about Benjamin Franklin and Paul Revere, and relating them to contemporary events. Ultimately, the text emphasizes that creative reading involves thoughtful engagement, critical questioning, and the application of knowledge to enrich one’s life. Keywords: good reader, creative reader, reading skills, critical thinking, questioning, comparing sources, personal growth, historical facts, engagement, enrichment, American Revolution, Benjamin Franklin, Paul Revere, reflective reading. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-03T00:00:00.000Z yes A/V Geeks 16mm Films no 795 reading growthreading creativelycreative readergood readerscritical thinkingcritical readingAmerican RevolutionBenjamin FranklinPaul Reveretextbook analysisreading skillstext analysisreading comprehensionhistorical factsengagement https://avgeeks.videonest.co/videos/924389/hard-water-1959 https://img.videonest.org/gamma/924389_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/924389/hard-water-1959 Hard Water (1959) Discusses the properties and reactions of alkaline earth metals: calcium, barium, and strontium. It describes experiments demonstrating their reactions with hydrochloric acid and sulfuric acid, highlighting the solubility differences of their sulfates. The text also covers the formation of colored flames when these metals are heated, the precipitation of calcium carbonate from calcium hydroxide, and the effects of hard water containing calcium and magnesium ions. It explains the concept of hardness in water, distinguishing between permanent and temporary hardness, and describes methods for measuring and removing hardness using ion exchange resins and titration techniques. Keywords: calcium, barium, strontium, alkaline earth metals, hydroxides, carbonates, hydrochloric acid, sulfuric acid, solubility, sulfates, colored flames, calcium carbonate, hard water, hardness, temporary hardness, permanent hardness, ion exchange resin, titration, phenolphthalein, soap, precipitate, calcium hydroxide, copper ammonia complex. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1711 hard wateralkaline earth metalscalciumbariumstrontiumchemistrycalcium hydroxidecalcium carbonatetemporary hardnesspermanent hardnession exchangetitrationhydrochloric acidsoap solutionchemical reaction https://avgeeks.videonest.co/videos/924390/now-what-1971 https://img.videonest.org/gamma/924390_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/924390/now-what-1971 Now, What? (1971) The film "Now What?" addresses humanity's fundamental obsession with materialism. It aims to provoke thought and stimulate discussion about the implications of this preoccupation on individuals and society. The film encourages viewers to reflect on their values and priorities in a materialistic world. 2025-08-02T00:00:00.000Z yes A/V Geeks 16mm Films no 719 Now What?animated shortmaterialismwealthcivilizationeconomic transactionanimation filmGeometric Shapesfamily momentsvintage fashionMcGraw-HillContemporary Filmanti-war protestsjob seekingLutheran Church https://avgeeks.videonest.co/videos/989398/av-geeks-16mm-lunch-8-14-2025 https://img.videonest.org/gamma/989398_thumbnail_resized_v2.webp https://gamma.videonest.org/989398_original_360.mp4 AV Geeks 16mm Lunch 8-14-2025 Feeling like you are in a jam..? We are too with our old pal Jam Handy! #16mmfilms #avgeeks A Safe Day Parade of the Relays Jimmy of the Safety Patrol Smooth Sale-ing American Beauty 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 4121 https://avgeeks.videonest.co/videos/989399/citizen-harold-1971 https://img.videonest.org/gamma/989399_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/989399/citizen-harold-1971 Citizen Harold (1971) Animated. In a chaotic scene, Harold, a resident, is frustrated by the noise and the cutting down of trees in his community. He attempts to address the issue at city hall but faces bureaucratic obstacles and indifference from officials. Despite his efforts to seek help, he is met with delays and dismissive attitudes. Harold's friends encourage him to be tougher and take action, but he struggles with how to confront the situation effectively. The scene highlights themes of community frustration, bureaucracy, and the challenge of making one's voice heard. **Keywords:** bowling tournament, noise, Harold, trees, community, city hall, bureaucracy, frustration, action, friends, confrontation, indifference. 2025-08-14T00:00:00.000Z yes A/V Geeks 16mm Films no 557 Citizen Haroldanimated shortcity hallcommunitybureaucracypolitical satirecutting down treesmunicipal governmentfrustrationHaroldactionfriendsindifferenceplanninglocal community https://avgeeks.videonest.co/videos/989400/av-geeks-16mm-lunch-8-13-2025 https://img.videonest.org/gamma/989400_thumbnail_resized_v2.webp https://gamma.videonest.org/989400_video_v5_360.mp4 AV Geeks 16mm Lunch 8-13-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 4065 https://avgeeks.videonest.co/videos/989401/eyes-seeing-the-light-1981 https://img.videonest.org/gamma/989401_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/989401/eyes-seeing-the-light-1981 Eyes: Seeing The Light (1981) Eyes: Seeing The Light (1981) is an educational film that combines animation and live-action photography to explore the structure and functioning of the human eye. The film begins by explaining the protective features of the eyes, including eyelids, eyebrows, eyelashes, and ears. It details how six muscles control eye movements and outlines the sight process, identifying the thirteen major parts of the human eye. The film also uses animation to illustrate common vision issues such as nearsightedness and farsightedness. In its concluding section, the film offers precautions to help prevent eye injuries. Overall, it serves as an informative resource on eye anatomy and health. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-14T00:00:00.000Z yes A/V Geeks 16mm Films no 933 eye anatomyeye healthhuman eyecorneairispupilretinaeye safetyeye carefarsightednesseye protectionvision carelight raysoptical nerveCentron Films https://avgeeks.videonest.co/videos/989402/drugs-are-for-jelly-brains-1988 https://img.videonest.org/gamma/989402_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/989402/drugs-are-for-jelly-brains-1988 Drugs Are For Jelly Brains (1988) Drugs Are For Jelly Brains "Drugs Are For Jelly Brains" is a dramatization aimed at educating children about the importance of respecting medicines and the dangers of misusing drugs. The film emphasizes that taking pills for fun can be harmful and reinforces the message that it is acceptable to say no to drugs and alcohol. The presentation has a style reminiscent of the 1980s, which may come across as somewhat outdated or "lame" by contemporary standards. 2025-08-13T00:00:00.000Z yes A/V Geeks 16mm Films no 721 anti-drug messagedrug abuse preventionmedicinechildren1980speer pressuresaying nodrug usealcohol uselife skillspharmacyHalcionBirthday partyOutdoor gamesBarr Films https://avgeeks.videonest.co/videos/989403/av-geeks-16mm-lunch-8-12-2025 https://img.videonest.org/gamma/989403_thumbnail_resized_v2.webp https://gamma.videonest.org/989403_video_v4_360.mp4 AV Geeks 16mm Lunch 8-12-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 3791 16mm filmA/V Geeks1940s1950sskiingoffice etiquettealfalfa hayHesston Windrowervintage footagetraining filmoffice workwinter sportshay harvestingCaterpillar machineryfilm https://avgeeks.videonest.co/videos/989404/zoo-animals-in-the-wild-ostriches-1981 https://img.videonest.org/gamma/989404_thumbnail_resized_v2.webp https://gamma.videonest.org/989404_video_v3.mp4 Zoo Animals In The Wild: Ostriches (1981) The film "Ostriches," part of the "Zoo Animals in the Wild Series," produced by Coronet in 1981, is a 5-minute educational piece that explores the lifestyle of ostriches. It highlights key characteristics of these remarkable birds, noting that they are the tallest and heaviest birds on Earth. The film emphasizes their impressive speed, capable of running as fast as a horse, and their unique reproductive trait of laying eggs that are 20 times heavier than those of chickens. The film is available in various formats, including videocassette and film reel. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-13T00:00:00.000Z yes A/V Geeks 16mm Films no 327 ostrichflightless birdsostrich eggsAfrican wildlifebird habitsanimal behaviorzoo animalsanimal documentaryCoronetcolor test chartpink backgroundstatichigh pitched tonebuzzing sound https://avgeeks.videonest.co/videos/989405/s-p-l-a-s-h-1982 https://img.videonest.org/gamma/989405_thumbnail_resized_v2.webp https://gamma.videonest.org/989405_video_v3.mp4 S P L A S H (1982) "SPLASH," produced by the National Film Board of Canada in 1982, is a 12-minute film that employs animation to tell a story centered around water droplets. The film illustrates the water cycle, highlighting the significance of water in urban life and addressing the effects of pollution on this vital natural resource. Through its engaging animation, "SPLASH" aims to educate viewers about the importance of preserving water and understanding its role in the environment. 2025-08-12T00:00:00.000Z yes A/V Geeks 16mm Films no 779 Splashwater cyclewater pollutionanimationwater dropletspollutionnational film board of canadawater dropsanimated cartoonwater systemenvironment canadaCRM/McGraw-Hillwatershedfloodoil https://avgeeks.videonest.co/videos/989406/family-krishnappa-1977 https://img.videonest.org/gamma/989406_thumbnail_resized_v2.webp https://gamma.videonest.org/989406_video_v3.mp4 Family Krishnappa (1977) "The Family Krishnappa" is a short film produced by Benchmark Films, Inc. in 1977. With a runtime of 18 minutes, the film is presented in 16 mm format with optical sound. It offers a glimpse into the daily life of a typical rural family and their village in Southern India, capturing the cultural and social dynamics of the community. The film aims to portray the simplicity and challenges of rural living, providing viewers with an intimate look at the family's interactions and environment. 2025-08-12T00:00:00.000Z yes A/V Geeks 16mm Films no 1075 Krishnappa familySouthern Indiadaily lifevillage lifeIndian villageIndian culturetraditional agriculturerural communityrice farminglivestockharvest seasonFarm workersSchool childrenGrain harvestAralamallige https://avgeeks.videonest.co/videos/989407/av-geeks-16mm-lunch-8-11-2025 https://img.videonest.org/gamma/989407_thumbnail_resized_v2.webp https://gamma.videonest.org/989407_video_v4.mp4 AV Geeks 16mm Lunch 8-11-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 3917 16mm filmA/V GeeksPrelinger Archivesfilm scanningtraffic safetysafe drivingpublic healthhygieneSan Francisco Bayenvironmental rehabilitationrailroad crossingcar accidenthealth educationhighway safetyvintage film https://avgeeks.videonest.co/videos/989408/forward-together-1974 https://img.videonest.org/gamma/989408_thumbnail_resized_v2.webp https://gamma.videonest.org/989408_video_v3.mp4 Forward Together (1974) "Forward Together" is a 14-minute film from the Screen News Digest Series, produced by Hearst Metrotone News in 1974. The film documents the significant political transition in the United States following Richard Nixon's resignation and the subsequent swearing-in of Gerald Ford as President. It features key excerpts from Nixon's farewell address, highlighting the circumstances surrounding his departure from office. The film also includes early public addresses made by Ford after taking office, providing insight into his leadership style and priorities. Additionally, it offers a brief biography of Gerald Ford, outlining his background and political career. Overall, the film serves as a historical account of a pivotal moment in American politics. 2025-08-11T00:00:00.000Z yes A/V Geeks 16mm Films no 771 Richard NixonGerald FordWatergate ScandalimpeachmentUS historypolitical crisisOval officeWhite HousePresidential Addresspolitical historyHenry KissingerVice PresidentOath of Officepresidential transitionRepublican National Convention https://avgeeks.videonest.co/videos/989409/smokers-lungs https://img.videonest.org/gamma/989409_thumbnail_resized_v2.webp https://gamma.videonest.org/989409_video_v3.mp4 Smokers' Lungs WARNING - lots of gross damaged lung footage. "Smokers' Lungs" is a documentary that presents compelling evidence about the detrimental effects of cigarette smoking on lung health, as observed by pathologist Dr. D. W. Thompson. The film details the physiological changes that occur in the lungs shortly after a person begins smoking, highlighting the early alterations that can lead to serious conditions, including cancer. It serves as an informative resource for both the general public and medical professionals, providing a clear and authoritative demonstration of the harmful impact of smoking on lung tissue. 2025-08-11T00:00:00.000Z yes A/V Geeks 16mm Films no 809 Smokers' LungsLung DiseaseCigarette Smokinglung tissuecigarette smokecellular damagelung cancersmoking effectsD.W. ThompsonPulmonary Tissuecancer cellscancerous changeabnormal tissuex-rayNational Film Board of Canada https://avgeeks.videonest.co/videos/989410/water-you-up-to-1987 https://img.videonest.org/gamma/989410_thumbnail_resized_v2.webp https://gamma.videonest.org/989410_video_v3.mp4 Water You Up To? (1987) Professor Einzeit and his companion Irving explore the importance of water in various forms: solid (ice), liquid (water), and gas (steam). Professor Einite shares his experiences from a scientific expedition in the Sahara Desert, emphasizing the significance of water for survival and daily activities. He demonstrates the water cycle, the concept of water pressure, and surface tension through experiments. The film highlights that water is essential for all life forms and discusses the need to protect our water sources from pollution. The episode concludes with a reminder of the vital role water plays in health and science. **Keywords:** water, Professor Einzeit, Irving, Sahara Desert, solid, liquid, gas, water cycle, surface tension, water pressure, dehydration, pollution, experiments, importance of water, survival, daily activities, clean water. 2025-08-10T00:00:00.000Z yes A/V Geeks 16mm Films no 1199 Professor EinzeitSahara Desertwatersolidliquidgaswater cyclewater pressuresurface tensiondehydrationwater purificationdrinking watersoil filtrationwater tableWater conservation https://avgeeks.videonest.co/videos/989411/the-reason-why-1970 https://img.videonest.org/gamma/989411_thumbnail_resized_v2.webp https://gamma.videonest.org/989411_video_v3.mp4 The Reason Why (1970) "The Reason Why" is a 14-minute film produced by Phoenix/BFA Films in 1970. The film features two characters, portrayed by Eli Wallach and Robert Ryan, who sit in front of an isolated country house and candidly share their personal reflections on the acts of killing they have committed throughout their lives. The narrative explores the darker impulses of humanity, delving into themes of war, violence, and murder. Written by renowned playwright Arthur Miller, the film prompts viewers to confront the moral complexities and psychological motivations behind such actions, ultimately questioning the nature of human violence. 2025-08-10T00:00:00.000Z yes A/V Geeks 16mm Films no 795 Arthur MillerThe Reason WhyEli WallachRobert RyanWarViolenceMurder1970s16mm filmConversationsHuntingrifle shootingAddictionDepressionanimal https://avgeeks.videonest.co/videos/989412/sooper-puppy-the-puff-of-smoke-1988 https://img.videonest.org/gamma/989412_thumbnail_resized_v2.webp https://gamma.videonest.org/989412_video_v3.mp4 Sooper Puppy: The Puff Of Smoke (1988) "The Puff of Smoke" is a 1988 educational film featuring the puppet character Sooper Puppy, who embarks on an adventure to understand the effects of nicotine addiction on the mind and body. Through engaging storytelling and puppetry, the film emphasizes the importance of avoiding smoking altogether. The production is part of the series "The Further Adventures of Sooper Puppy" and includes performances by puppeteers Brian Narelle, Peter Babakitas, and Lee Armstrong, with Michael Chin as the cameraperson. The film is designed to educate viewers, particularly children, about the dangers of smoking in an accessible and entertaining manner. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-09T00:00:00.000Z yes A/V Geeks 16mm Films no 932 Sooper PuppysmokingcigarettePuppet Showpuppetsaddictioncigaretteshealth advicestop smokingnicotineeducational cartoonBig JohnBrian Narelledogcookie https://avgeeks.videonest.co/videos/989413/av-geeks-16mm-lunch-8-8-2025 https://img.videonest.org/gamma/989413_thumbnail_resized_v2.webp https://gamma.videonest.org/989413_video_v4.mp4 AV Geeks 16mm Lunch 8-8-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 3649 16mm filmwatersoil conservationwater treatmentenvironmentalchemistry experimentflood controlirrigation farmingwater pollutionhard waterwater softenerUS Department of AgricultureSoil Conservation ServicereservoirsA/V Geeks https://avgeeks.videonest.co/videos/989414/red-light-return-1965 https://img.videonest.org/gamma/989414_thumbnail_resized_v2.webp https://gamma.videonest.org/989414_video_v3.mp4 Red Light Return (1965) "Red Light Return" is a 1965 film produced by Charles Cahill and Associates that explores the effects of a 40-mile-per-hour auto collision on windshields, doors, and passengers. The film features collision tests using different types of glass, door latches, and safety devices like seat belts and harnesses. It also draws a comparison between the velocity of a car dropped from a helicopter and that of a car involved in a collision, highlighting the impact forces experienced during such accidents. The film aims to educate viewers on the importance of vehicle safety features and the potential consequences of car crashes. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-09T00:00:00.000Z yes A/V Geeks 16mm Films no 686 Car crashSafety glassCollision factorsCar safetyTraffic engineeringAutomobile crash studyCrash test dummyInstitute of Transportationimpact testhead traumaseatbelt safetyUCLA-ITTEcrash testsafety beltshuman body https://avgeeks.videonest.co/videos/989415/harmonize-1976 https://img.videonest.org/gamma/989415_thumbnail_resized_v2.webp https://gamma.videonest.org/989415_video_v3.mp4 Harmonize (1976) A collection of anecdotes and reflections on storytelling, family traditions, and memories shared among family members. It highlights the importance of storytelling in building relationships, the humorous and silly traditions that families create, and the nostalgia associated with childhood memories. The narrator reminisces about their father's storytelling abilities, the significance of family gatherings, and the unique traditions that have developed over time, such as St. Grun's Day. The text also touches on the playful interactions between siblings and the joy of shared experiences. Keywords: storytelling, family traditions, memories, anecdotes, humor, nostalgia, relationships, childhood, St. Grun's Day, sibling interactions, cooking, adventures, storytelling ability, family gatherings. 2025-08-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1289 storytellingfamily traditionschildhood memoriesfamily storiesfamily historyhome moviesoral traditionssingingmusicKurzman familyCookingRecipesRoad tripBoard gamesFamily games https://avgeeks.videonest.co/videos/989416/av-geeks-16mm-lunch-8-7-2025 https://img.videonest.org/gamma/989416_thumbnail_resized_v2.webp https://gamma.videonest.org/989416_video_v4.mp4 AV Geeks 16mm Lunch 8-7-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 3594 A/V Geeks16mmAviation filmAir travelAmerican industryVintage advertisementAirportsTourismCar rentalCigar smokingUnited StatesTravelChrysler ImperialSanta Fe Cigars1950s https://avgeeks.videonest.co/videos/989417/food-more-for-your-money-2nd-ed-1989 https://img.videonest.org/gamma/989417_thumbnail_resized_v2.webp https://gamma.videonest.org/989417_video_v3.mp4 Food: More For Your Money (2nd Ed, 1989) Discusses strategies for getting the best value for food purchases. It emphasizes the importance of planning, comparing prices, and evaluating nutritional value. Key tips include making a shopping list, checking food ads for sales and coupons, understanding unit pricing, and considering the cost per serving. The text also highlights the benefits of buying fresh produce in season, opting for plain wrap brands, and being cautious with convenience foods. Ultimately, the main takeaway is to compare and evaluate options to maximize food value for money. Keywords: food value, shopping list, price comparison, nutritional value, unit pricing, fresh produce, convenience foods, sales, coupons, meal planning, cost per serving, plain wrap brands, evaluate options. 2025-08-08T00:00:00.000Z yes A/V Geeks 16mm Films no 1169 saving moneygrocery shoppingprice comparisonunit pricingcouponsfood adsfresh producenutrition informationfood budgethealthy dietcompare and evaluategrocery listreading labelsconvenience foodsfood purchase https://avgeeks.videonest.co/videos/989418/chinese-tin-miner-of-chendrong-1971 https://img.videonest.org/gamma/989418_thumbnail_resized_v2.webp https://gamma.videonest.org/989418_video_v3.mp4 Chinese Tin Miner Of Chendrong (1971) recounts the history and current life of a Chinese family in Chendrong, Malaysia, which was established during a guerilla war in British Malaya. The family, particularly the son Afo, is focused on education and aspirations for a better future, with Afo aiming to become a doctor. The family works hard in the tin mining industry, with both parents contributing to the household income. Despite the challenges, they are committed to their community and the future of Malaysia. Keywords: Chendrong, Malaysia, guerilla war, Chinese family, education, Afo, doctor, tin mining, community, hard work, future, multi-racial, independence, family responsibilities. 2025-08-07T00:00:00.000Z yes A/V Geeks 16mm Films no 666 MalaysiaChinese peopletin miningChinese cultureguerrilla warChendrong new villageKinta ValleyBritish Malayafamily lifedaily routineAffoStudyingAV-ED Films https://avgeeks.videonest.co/videos/989419/av-geeks-16mm-lunch-8-6-2025 https://img.videonest.org/gamma/989419_thumbnail_resized_v2.webp https://gamma.videonest.org/989419_video_v4.mp4 AV Geeks 16mm Lunch 8-6-2025 2025-08-14T17:14:24.918Z yes A/V Geeks 16mm Films no 4081 16mm filmA/V Geeksdental hygienehuman bodyautomationindustrial filmmanufacturingvintage filmpuppet showKarius and Baktusmetalworkingeconomic impactjob lossmedical educationtechnology https://avgeeks.videonest.co/videos/989420/why-is-it-always-me-1980 https://img.videonest.org/gamma/989420_thumbnail_resized_v2.webp https://gamma.videonest.org/989420_video_v3.mp4 Why Is It Always Me? (1980) Why Is It Always Me? (1980, 14 min) is a teen-focused educational film that stars a young John Cusack in one of his earliest roles. Produced by Gerald T. Rogers Productions, the film tackles common adolescent struggles, portraying realistic conflicts with family and peers. Through relatable scenarios, it models constructive communication and problem-solving strategies, encouraging teens to approach personal challenges with empathy and self-awareness. A staple in classrooms and guidance sessions, the film blends drama and education to help young viewers navigate the complexities of growing up. 2025-08-07T00:00:00.000Z yes A/V Geeks 16mm Films no 863 John Cusackteenage angstproblem-solvingcommunicationparent-child relationshippeer conflictschool librarylessonidentifyevaluateactretro countdownGene Jensenteachersolving problems https://avgeeks.videonest.co/videos/989421/first-aid-bleeding-poisoning-broken-bones-1957 https://img.videonest.org/gamma/989421_thumbnail_resized_v2.webp https://gamma.videonest.org/989421_video_v3.mp4 First Aid: Bleeding, Poisoning, Broken Bones (1957) Provides essential first aid instructions for various emergencies, including controlling bleeding, handling poisoning, managing fractures and dislocations, responding to fainting, dealing with epileptic seizures, and addressing heart attacks. Key techniques include applying direct pressure to wounds, using improvised tourniquets, diluting poisons, immobilizing fractures, and ensuring the safety of victims during seizures and heart attacks. The importance of seeking medical assistance is emphasized throughout. Keywords: first aid, bleeding control, circulatory system, heart chambers, direct pressure, tourniquet, poisoning, antidote, fractures, dislocations, fainting, seizures, heart attack, medical assistance, artificial respiration. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-06T00:00:00.000Z yes A/V Geeks 16mm Films no 853 First AidBleedingPoisoningBroken BonesFractureTourniquetDirect PressureCirculatory SystemMedical EmergencyArtificial RespirationHeart AttackEpileptic SeizureFainting TreatmentMedical AidCPR Techniques https://avgeeks.videonest.co/videos/989422/answering-objections-in-witnessing-part-1-1961 https://img.videonest.org/gamma/989422_thumbnail_resized_v2.webp https://gamma.videonest.org/989422_video_v3.mp4 Answering Objections In Witnessing, Part 1 (1961) Discusses the challenges of witnessing to individuals who express objections to Christianity, particularly focusing on the hypocrisy of church members and the need for personal accountability to God. It features a dialogue between Mr. Walcott and various individuals, including Mr. Baxter and Mr. Clemens, who voice their concerns about church hypocrisy and their own perceived goodness. The conversation emphasizes that one's relationship with God is personal and not influenced by others' actions. Key biblical references are used to illustrate that salvation is based on faith in Jesus Christ rather than personal righteousness or feelings. The text concludes by encouraging believers to be prepared to witness and share their faith with others. Keywords: witnessing, objections, hypocrisy, church members, accountability, salvation, faith, personal relationship, scripture, personal witness. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-06T00:00:00.000Z yes A/V Geeks 16mm Films no 950 Gregory WalcottBroadman FilmsEd PrentissBibleChristianitywitnessingBible studypersonal accountabilityspiritual guidancereligious teachingSalvationFaithPersonal WitnessScriptureSoul-Winning https://avgeeks.videonest.co/videos/1037557/av-geeks-16mm-lunch-8-25-2025 https://img.videonest.org/gamma/1037557_thumbnail_resized_v2.webp https://gamma.videonest.org/1037557_video_v4.mp4 A/V Geeks 16mm Lunch 8-25-2025 2025-08-25T22:03:51.305Z yes A/V Geeks 16mm Films no 3089 16mm filmsRiver TransportCargo ShipsMaritime NavigationMississippi RiverBargesNew OrleansRiverTransportation1953Inland Waterwaysfreight transportationriver towboatcargo transportAmerican industry https://avgeeks.videonest.co/videos/1037558/karius-and-backtus-1955 https://img.videonest.org/gamma/1037558_thumbnail_resized_v2.webp https://gamma.videonest.org/1037558_video_v4.mp4 Karius And Backtus (1955) 2025-08-25T22:03:51.305Z yes A/V Geeks 16mm Films no 874 dental hygienepuppet showtooth decayCaries and Bactuscavitiestoothachedental healthtooth carehygieneBaktusCariusCarioustooth brushanimated shortpuppets https://avgeeks.videonest.co/videos/1037559/telemarketing-getting-the-order-1984 https://img.videonest.org/gamma/1037559_thumbnail_resized_v2.webp https://gamma.videonest.org/1037559_video_v4.mp4 Telemarketing: Getting The Order (1984) 2025-08-25T22:03:51.305Z yes A/V Geeks 16mm Films no 1037 TelemarketingSalesmanshipCold callingSales tacticsSales strategyTelephone salesSales techniquesSales presentationClosing the orderCustomer objectionsCustomer serviceProduct benefitsRichard MaizeBetsy LaurenPayment plans https://avgeeks.videonest.co/videos/1037560/crimes-of-carelessness-1947 https://img.videonest.org/gamma/1037560_thumbnail_resized_v2.webp https://gamma.videonest.org/1037560_video_v4.mp4 Crimes of Carelessness (1947) 2025-08-25T22:03:51.305Z yes A/V Geeks 16mm Films no 596 FireFire safetySmokingForest fireGasolinefire preventionfire departmentselectrical safetyhousehold hazardsUnderwriters Laboratoriesfire alarm https://avgeeks.videonest.co/videos/1037561/development-of-surfaces-1940 https://img.videonest.org/gamma/1037561_thumbnail_resized_v2.webp https://gamma.videonest.org/1037561_video_v4.mp4 Development Of Surfaces (1940) 2025-08-25T22:03:51.305Z yes A/V Geeks 16mm Films no 915 Purdue UniversityJ. RisingW.J. LuzadderH.L. MinklerTechnical DrawingSurface Developmentgeometric drawingscompassrulertrianglegeometric shapeengineeringmathematical equationcone creationgeometric principles https://avgeeks.videonest.co/videos/1037562/i-am-a-doctor-ca-1959 https://img.videonest.org/gamma/1037562_thumbnail_resized_v2.webp https://gamma.videonest.org/1037562_video_v4.mp4 I Am a Doctor (ca. 1959) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1483 doctormedicalmedical educationmedical ethicsmedical professionhealth professionsurgerypsychiatrymedical researchpatient carehospital settingmedicine careerclinical practiceleukemiacancer https://avgeeks.videonest.co/videos/1037563/av-geeks-16mm-lunch-8-22-2025 https://img.videonest.org/gamma/1037563_thumbnail_resized_v2.webp https://gamma.videonest.org/1037563_video_v4.mp4 AV Geeks 16mm Lunch 8-22-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 3786 A/V Geeksturtletoadanimationpond life16mm filmvintage filmstop motionsnapping turtleturtle racewildlifeeducationalanimal safetyMr. Toadpond animals https://avgeeks.videonest.co/videos/1037564/alcohol-pink-elephant-1976 https://img.videonest.org/gamma/1037564_thumbnail_resized_v2.webp https://gamma.videonest.org/1037564_video_v4.mp4 Alcohol: Pink Elephant (1976) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 878 Pink ElephantAlcoholismBritannicaAnimationEducationalSocial issuesdelirium tremenspink elephantsalcohol abusealcoholicAddiction RecoveryMental HealthHealthTreatment FacilityRelapse https://avgeeks.videonest.co/videos/1037565/av-geeks-16mm-lunch-8-21-2025 https://img.videonest.org/gamma/1037565_thumbnail_resized_v2.webp https://gamma.videonest.org/1037565_video_v4.mp4 AV Geeks 16mm Lunch 8-21-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 3591 16mm filmsA/V GeeksGasoline PromoAtlantic Imperial GasolineTales of The RiverbankToad And The Turtle Racevintage advertisement16mm filmCertsbicycle safetytraffic safetyvowel soundslearn englishanimalsgrammar lesson https://avgeeks.videonest.co/videos/1037566/health-eye-care-fantasy-1972 https://img.videonest.org/gamma/1037566_thumbnail_resized_v2.webp https://gamma.videonest.org/1037566_video_v4.mp4 Health: Eye Care Fantasy (1972) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 441 eye carevisioneyesighteye healtheye doctorglassesfar sightednessnear sightednessEye examOphthalmologistEye chartReading glassesVision problems https://avgeeks.videonest.co/videos/1037567/exploring-planet-earth-1978 https://img.videonest.org/gamma/1037567_thumbnail_resized_v2.webp https://gamma.videonest.org/1037567_video_v4.mp4 Exploring Planet Earth (1978) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1131 Earth's crustigneous rocksedimentary rockmetamorphic rockerosionearth scienceglaciersvolcanoearthquakestectonic platesvolcanic activitymountain buildinggeological eventsoceanographyastronomy https://avgeeks.videonest.co/videos/1037568/av-geeks-16mm-lunch-8-20-2025 https://img.videonest.org/gamma/1037568_thumbnail_resized_v2.webp https://gamma.videonest.org/1037568_video_v4.mp4 AV Geeks 16mm Lunch 8-20-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 3824 16mm filmAV GeeksLunch Moneyethical dilemmaEvolutionNatural selectionIranian villageblue tilestile makinghistorical restorationWalt Disneyanimationfirst aidmedical educationfilm vault https://avgeeks.videonest.co/videos/1037569/brushing-up-on-multiplication-1961 https://img.videonest.org/gamma/1037569_thumbnail_resized_v2.webp https://gamma.videonest.org/1037569_video_v4.mp4 Brushing Up On Multiplication (1961) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 632 Coronet filmBrushing UpMultiplication lessonPartial productPlace valueMultiplierMultiplicandmultiplicationmatharithmeticeducationproblem solvingCoronet Instructional Films https://avgeeks.videonest.co/videos/1037570/thailand-land-of-rice-1957 https://img.videonest.org/gamma/1037570_thumbnail_resized_v2.webp https://gamma.videonest.org/1037570_video_v4.mp4 Thailand: Land Of Rice (1957) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 832 ThailandLand of RiceSiamBangkokRice FarmingThai CultureFloating MarketsChao Phraya RiverRiver TrafficThai VillagesRice CultivationThai PeopleRice PaddiesAgricultureFood Export https://avgeeks.videonest.co/videos/1037571/av-geeks-16mm-lunch-8-19-2025 https://img.videonest.org/gamma/1037571_thumbnail_resized_v2.webp https://gamma.videonest.org/1037571_video_v4.mp4 AV Geeks 16mm Lunch 8-19-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 3957 16mm filmA/V Geekscavemencartoonexplosives engineeringGrand Coulee DamPanama CanalSt. Augustinephotographyfilm projectorvintage filmconstructionblastingfilm collectionhistorical attire https://avgeeks.videonest.co/videos/1037572/what-is-a-reptile-1961 https://img.videonest.org/gamma/1037572_thumbnail_resized_v2.webp https://gamma.videonest.org/1037572_video_v4.mp4 What is A Reptile? (1961) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1022 reptilessnakeslizardsturtlesevolutionland eggdinosaursnake venomIguanaMonitor LizardAfrican ChameleonAmerican AlligatorGalapagos Tortoisesnake eggswildlife https://avgeeks.videonest.co/videos/1037573/give-your-eggs-a-break-1966 https://img.videonest.org/gamma/1037573_thumbnail_resized_v2.webp https://gamma.videonest.org/1037573_video_v4.mp4 Give Your Eggs A Break (1966) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 542 eggsfood preparationomelettescrambled eggscooking eggsfried eggspoached eggsshirred eggsthree-minute eggegg preparationArden brand https://avgeeks.videonest.co/videos/1037574/av-geeks-16mm-lunch-8-18-2025-part-3 https://img.videonest.org/gamma/1037574_thumbnail_resized_v2.webp https://gamma.videonest.org/1037574_video_v4.mp4 AV Geeks 16mm Lunch 8-18-2025 part 3 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1218 16mm filmJapanJapanese cultureJapanese BoyTaroTaro MurataElementary schoolSilk productionFarmingShinto shrinesBuddhist templesTokyoA/V Geeksfield tripsilkworms https://avgeeks.videonest.co/videos/1037575/av-geeks-16mm-lunch-8-18-2025 https://img.videonest.org/gamma/1037575_thumbnail_resized_v2.webp https://gamma.videonest.org/1037575_video_v4.mp4 AV Geeks 16mm Lunch 8-18-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1522 16mm filmsVintage AdvertisementHurricaneWeather forecastCookingTuna RarebitPlumbing issueEducational filmAmerican Gas AssociationNational Hurricane CenterStorm surgeGulf CoastCivil DefenseA/V GeeksVintage film https://avgeeks.videonest.co/videos/1037576/working-worlds-1974 https://img.videonest.org/gamma/1037576_thumbnail_resized_v2.webp https://gamma.videonest.org/1037576_video_v4.mp4 Working Worlds (1974) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 832 public servicelaw enforcementcareer opportunitiesjudicial systemcivil servicegovernment agenciespostal servicefirefightersenvironmental careerssocial servicesclerical workgovernment jobsmilitary careertechnical assistanceinternational affairs https://avgeeks.videonest.co/videos/1037577/av-geeks-16mm-lunch-8-18-2025-part-2 https://img.videonest.org/gamma/1037577_thumbnail_resized_v2.webp https://gamma.videonest.org/1037577_video_v4.mp4 AV Geeks 16mm Lunch 8-18-2025 part 2 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 823 16mm filmhome movieschildrenpetdogcatoutdoor playfilm reelsdomestic animalskittydog bathcat bathinflatable poolAlamo DrafthouseRaleigh NC https://avgeeks.videonest.co/videos/1037578/image-of-god-1964 https://img.videonest.org/gamma/1037578_thumbnail_resized_v2.webp https://gamma.videonest.org/1037578_video_v4.mp4 Image Of God (1964) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1664 Image of Godhigh schoolteen dramarelationshipsdatinggriefreligionGodJesusChristianityfaith-based discussionNew Testamentpersonal viewsHigh Schoolreligious belief https://avgeeks.videonest.co/videos/1037579/mathematics-for-primary-division-1978 https://img.videonest.org/gamma/1037579_thumbnail_resized_v2.webp https://gamma.videonest.org/1037579_video_v4.mp4 Mathematics For Primary: Division (1978) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 529 MathematicsEducationDivisionmathmathematical sentenceshoeschairsballsParamount Communications https://avgeeks.videonest.co/videos/1037580/united-states-territorial-expansion-1783-1853-1938 https://img.videonest.org/gamma/1037580_thumbnail_resized_v2.webp https://gamma.videonest.org/1037580_video_v4.mp4 United States Territorial Expansion (1783-1853) 1938 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1316 Territorial ExpansionUnited States17831853Louisiana PurchaseTexas IndependenceMexican-American WarOregon TerritoryGadsden PurchaseSeminole WarsAndrew JacksonJames PolkTreaty of Guadalupe HidalgoManifest DestinyWestward Expansion https://avgeeks.videonest.co/videos/1037581/ivy-baldwin-newsreel https://img.videonest.org/gamma/1037581_thumbnail_resized_v2.webp https://gamma.videonest.org/1037581_video_v4.mp4 [Ivy Baldwin newsreel] 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 93 Ivy Baldwinhigh wire actDaredevilMarsdale ColoradoSpanish American Warcircus performerballoon ascensionSantiago Cubacounty fairschurch bazaars https://avgeeks.videonest.co/videos/1037582/the-land-of-liberty-pt2-1939 https://img.videonest.org/gamma/1037582_thumbnail_resized_v2.webp https://gamma.videonest.org/1037582_video_v4_360.mp4 The Land Of Liberty, Pt2 (1939) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1169 War of 1812United StatesTexas RevolutionThe AlamoSlaveryAbraham LincolnStephen DouglasWestward MovementMexican disputeTexas annexationNew OrleansAndrew JacksonState RightsAmerican UnionCalifornia Purchase https://avgeeks.videonest.co/videos/1037583/av-geeks-16mm-lunch-8-15-2025 https://img.videonest.org/gamma/1037583_thumbnail_resized_v2.webp https://gamma.videonest.org/1037583_video_v4_360.mp4 AV Geeks 16mm Lunch 8-15-2025 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 3269 Skip ElsheimerA/V Geeks16mm filmsalcoholismjob searchingfirst aidartificial respirationaircraft maintenanceenvironmental issuestypinginterviewingmental healthaddiction recoveryhealthjob application https://avgeeks.videonest.co/videos/1037584/psychling-1981 https://img.videonest.org/gamma/1037584_thumbnail_resized_v2.webp https://gamma.videonest.org/1037584_video_v4_360.mp4 Psychling (1981) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 1477 John Marinocyclingendurance cyclingTrans Americabicycle racingworld recordultra-distance cyclingroad cyclingrecord attemptsports documentaryPeugeotSanta MonicaNew Yorkmileagespeed https://avgeeks.videonest.co/videos/1037585/gold-and-you-1968 https://img.videonest.org/gamma/1037585_thumbnail_resized_v2.webp https://gamma.videonest.org/1037585_video_v4_360.mp4 Gold And You (1968) 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 874 Gold reservesBalance of paymentsU.S. Dollarcurrency devaluation1968 crisiseconomic recoveryWorld War IICommon MarketGreat Britaingold miningdairy productsPET Dairysteel productionmanufactured goodsLyndon B. Johnson https://avgeeks.videonest.co/videos/1037586/basic-tumbling-skills-silent-1970s https://img.videonest.org/gamma/1037586_thumbnail_resized_v2.webp https://gamma.videonest.org/1037586_video_v4.mp4 [Basic Tumbling Skills, silent, 1970s] 2025-08-25T22:03:51.306Z yes A/V Geeks 16mm Films no 916 tumblinggymnasticstrampolinetrainingexerciseindoorgymacrobaticspartner stuntstumbling skillsbasic tumblingphysical educationgymnastic stuntsbalance skillschildren https://avgeeks.videonest.co/videos/1460742/jobs-for-high-school-graduate-no-14-24-silent-1940s https://img.videonest.org/gamma/1460742_thumbnail_resized_v2.webp https://gamma.videonest.org/1460742_video_v4.mp4 Jobs for High School Graduate, no 14-24 (silent, 1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:00:25 The segment begins by detailing the role of a bundle boy in a department store, focusing on packaging and organizing items for customers. 00:00:33 It then transitions to an administrative setting, showing a man sorting documents, highlighting office-related tasks. 00:04:23 The film also covers childcare-related jobs, showcasing opportunities for high school graduates to assist with children. 00:05:42 Finally, the segment illustrates industrial roles, depicting a mechanical process of cutting metal sheets and an assembly line in operation. 00:07:33 - 00:15:35 Job Opportunities for High School Graduates 00:07:33 A circulating library is shown, suggesting job opportunities in community-focused spaces for high school graduates interested in library or retail work. 00:07:54 The role of an 'order-filler' in a large mail-order company is highlighted, emphasizing the crucial importance of speed in fulfilling customer orders efficiently. 00:10:48 Two men are seen discussing in an office, possibly representing an interview or job consultation, indicating professional environment opportunities. 00:14:04 The segment likely discusses various employment opportunities and career paths accessible to high school graduates, offering practical advice for entering the workforce. 2025-11-18T05:01:05.000Z yes A/V Geeks 16mm Films no 935 high school graduatesentry level jobsvocational jobscareer optionsfactory productionoffice workdepartment storemail orderorder fillerstock clerkoffice clerkproduction workerclerical dutiesOakland CaliforniaJob Hunting https://avgeeks.videonest.co/videos/1460743/southern-american-vista-silent https://img.videonest.org/gamma/1460743_thumbnail_resized_v2.webp https://gamma.videonest.org/1460743_video_v4.mp4 Southern American Vista (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This captivating journey showcases the stunning interplay of rivers, forests, and snow-capped mountains, reflecting the diverse terrain of the region. Alongside these natural wonders, experience vibrant scenes from local city streets, bustling with life, and serene coastal landscapes that offer a peaceful contrast. This visual exploration captures the essence of southern America, revealing both its breathtaking environments and the dynamic spirit of its communities. #Southern American Landscape #Cultural Heritage #Coastal Beauty #Nature Exploration #Historic Cityscapes Timeline 00:00:19 - 00:00:59 Southern American Vista 00:00:19 A serene landscape unfolds with a flowing river, dense forests, and snow-capped mountains under a clear sky, showcasing the picturesque beauty of the natural environment. 00:00:22 A panoramic view reveals a majestic snow-capped mountain towering over a lush forest, with a river flowing below, emphasizing the dramatic interplay of nature. 00:00:44 A close-up shot of a person in traditional clothing, possibly a kimono, against a background of a tiled roof and a utility pole, suggests a blend of cultural heritage and modern life. 00:00:59 - 00:06:00 Journey Through Peru 00:00:59 The segment begins with an overview of Peru's cultural heritage, emphasizing the Incan civilization and the region's significant historical sites and natural beauty. 00:02:38 A grand monument with intricate sculptures and reliefs is showcased in a clear, bright, black and white scene, suggesting an older historical setting. 00:04:11 Three individuals are seen in a wooden boat on a waterway, with two playing musical instruments, set against a serene, rural backdrop of trees and a structure. 00:06:00 - 00:09:52 Southern American Coastal Views 00:06:00 A busy urban street in the 1930s is filled with pedestrians in period attire and vintage cars, reflecting daily life in a historic cityscape. 00:08:30 Capacabana Beach and Avenida Beira Mar are shown, highlighting the vibrant culture and coastal beauty of a Southern American urban shoreline. 00:08:37 A quiet beachfront promenade with patterned pavement, vintage cars, and hills in the background creates a timeless, nostalgic atmosphere in black and white. 00:09:20 A silent visual presentation emphasizes the natural beauty and picturesque environment of a stunning South American landscape. 2025-11-18T05:00:09.000Z yes A/V Geeks 16mm Films no 593 South AmericaPeruArgentinaRio de JaneiroBrazilCopacabana BeachGauchosBuenos AiresFolk dancesAvenida Beira MarCastle FilmsWorld ParadeSugarloaf MountainMateNative Tea https://avgeeks.videonest.co/videos/1460744/av-geeks-16mm-lunch-11-17-2025 https://img.videonest.org/gamma/1460744_thumbnail_resized_v2.webp https://gamma.videonest.org/1460744_video_v5_converted.mp4 AV Geeks 16mm Lunch 11-17-2025 Hanging out? Doing laundry? Watching old 16mm films? Us too! #avgeeks #16mmfilms It's Your War Too! Mathematics of a Honeycomb Bitter Welcome 2025-11-17T19:08:31.000Z yes A/V Geeks 16mm Films no 4216 https://avgeeks.videonest.co/videos/1460745/six-polka-soundies-1940s https://img.videonest.org/gamma/1460745_thumbnail_resized_v2.webp https://gamma.videonest.org/1460745_video_v4.mp4 Six Polka Soundies (1940s) Lucky Polka Polka Dot Polka Pumpernickel Polka Jolly Joe Fiddle Polka Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-17T17:01:30.000Z yes A/V Geeks 16mm Films no 834 Lucky PolkaPolka Dot PolkaFiddle PolkaSoundies1940spolka dancedancevintage performanceband performanceorchestraAnn ParkerLanny RossCarroll HoodJolly Joepumpernickel https://avgeeks.videonest.co/videos/1460746/consumer-reports-presents-the-car-show-1981 https://img.videonest.org/gamma/1460746_thumbnail_resized_v2.webp https://gamma.videonest.org/1460746_video_v4.mp4 Consumer Reports presents The Car Show (1981) "Consumer Reports presents The Car Show" discusses various aspects of car buying and maintenance, focusing on small cars, diesel engines, tire maintenance, child safety, and used car buying tips. It emphasizes the importance of fuel efficiency, proper tire inflation, and child restraint systems to enhance safety. The show also debunks the effectiveness of many gas-saving gadgets and provides practical advice for purchasing used cars. 2025-11-17T05:00:23.000Z yes A/V Geeks 16mm Films no 1423 Consumer Reportscar showautomotive showsmall carDiesel engineTire inflationchild safetycar seatsused carcar buying tipsCar maintenancecar inspectioncar brakesFuel savingautomobile https://avgeeks.videonest.co/videos/1460747/joseph-schultz-1973 https://img.videonest.org/gamma/1460747_thumbnail_resized_v2.webp https://gamma.videonest.org/1460747_video_v4.mp4 Joseph Schultz (1973) Recreates an actual event in which Schultz is given a direct order as a member of a firing squad to shoot a group of civilians. 2025-11-16T17:00:23.000Z yes A/V Geeks 16mm Films no 817 World War IIJoseph SchultzGerman soldierfiring squadexecutionmilitarywar scenesoldiersbattle sceneexplosionsZastava FilmWombat ReleaseEastern frontYugoslaviaOrahovica https://avgeeks.videonest.co/videos/1460748/breakdown-1951 https://img.videonest.org/gamma/1460748_thumbnail_resized_v2.webp https://gamma.videonest.org/1460748_video_v4.mp4 Breakdown (1951) Discusses the struggles of Anne, a young woman who experiences a mental breakdown, leading to her hospitalization. It explores the challenges her family faces in understanding her illness, the stigma surrounding mental health, and the treatment she receives in a mental hospital. The narrative highlights the importance of proper diagnosis, individual treatment, and the need for societal awareness regarding mental health issues. 2025-11-16T05:00:37.000Z yes A/V Geeks 16mm Films no 2245 Mental HealthMental IllnessMental HospitalPsychotherapyElectroshock TherapyPatient CareFamily DramaSchizophreniaPsychotic BreakPatient SupportSocial WorkerCommunity ClinicsRecoveryReturning HomeCanadian Film https://avgeeks.videonest.co/videos/1460749/av-geeks-16mm-lunch-11-14-2025 https://img.videonest.org/gamma/1460749_thumbnail_resized_v2.webp https://gamma.videonest.org/1460749_video_v4.mp4 AV Geeks 16mm Lunch 11-14-2025 Celebrating 16mm films everyday! #avgeeks #16mmfilms Boswelle's Bon Voyage New Leash On Life Gaines Dog Food TV commercials 2025-11-15T07:11:27.000Z yes A/V Geeks 16mm Films no 3960 16mm filmvintage filmAV Geeksdog foodGaines Dog Foodvintage commercialtraveldog nutritionpet fooddog healthfirst class travelpet caredog adoptionanimal shelterprojector https://avgeeks.videonest.co/videos/1460750/the-red-trap-this-is-the-life-1959 https://img.videonest.org/gamma/1460750_thumbnail_resized_v2.webp https://gamma.videonest.org/1460750_video_v4_360.mp4 The Red Trap - This is the Life (1959) Film revolves around Carl Brandt (played by John Banner from Hogan's Heroes) , a local attorney who is being considered for a judge position, while he grapples with his son Paul's involvement in communist activities on campus. The story highlights the tension between father and son regarding political beliefs, the influence of communism, and the implications of Paul's actions on Carl's career. The narrative also touches on themes of faith, freedom, and the moral responsibilities of individuals in society. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-15T05:00:21.000Z yes A/V Geeks 16mm Films no 1797 This Is the LifeCarl BrandtCommunismCold WarFather SonPolitical Debate1950sFBI agentJ. Edgar HooverEspionageSoviet agentChristianityIdeologiesFederal Bureau of InvestigationSpiritual Values https://avgeeks.videonest.co/videos/1460751/introducing-the-mentally-retarded-1963 https://img.videonest.org/gamma/1460751_thumbnail_resized_v2.webp https://gamma.videonest.org/1460751_video_v4_360.mp4 Introducing The Mentally Retarded (1963) **OUTDATED TERMINOLOGY** Discusses the challenges and potential of children with mental disabilities, highlighting their dreams, capabilities, and the importance of individualized education and social interaction. It categorizes individuals into educable, trainable, and custodial, explaining their learning abilities and needs. The film emphasizes that despite their disabilities, many can lead fulfilling lives and contribute to society with the right support and opportunities. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-15T05:00:17.000Z yes A/V Geeks 16mm Films no 1358 mental retardationintellectual disabilityspecial education1963vintage educationalchild developmentsocial skillslife skillsjob trainingvocational guidancesocial interactionchild activitiesphysical therapymental healthinstitutional care https://avgeeks.videonest.co/videos/1460752/norstar-vision-union-station-reborn-1986 https://img.videonest.org/gamma/1460752_thumbnail_resized_v2.webp https://gamma.videonest.org/1460752_video_v4_360.mp4 Norstar Vision: Union Station Reborn (1986) Discusses the history and restoration of Alby's Union Station in Albany, New York, which had fallen into disrepair after its closure in 1968. After years of neglect and failed attempts at selling the building, Northstar Bank Corp expressed interest in purchasing and renovating it in 1984. The project aimed to preserve the station's historic character while adapting it for modern use as corporate offices. The restoration involved significant structural changes and careful attention to historical details, ultimately leading to the revitalization of this landmark as Northstar Plaza. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-14T17:01:23.000Z yes A/V Geeks 16mm Films no 1061 Albany Union StationUnion StationAlbanyNew Yorkhistoric landmarkhistoric preservationbuilding restorationbuilding renovationrestoration projectNorstar Bancorpadaptive usereal estateabandoned buildingcorporate headquarters https://avgeeks.videonest.co/videos/1460753/av-geeks-16mm-lunch-11-13-2025 https://img.videonest.org/gamma/1460753_thumbnail_resized_v2.webp https://gamma.videonest.org/1460753_video_v5_360.mp4 AV Geeks 16mm Lunch 11-13-2025 It's a great day to sit in front of a screen and watch old 16mm films and chat with friends! Join us! #avgeeks #16mmfilms George Acona Picnic 1967 (silent) How to Weld T-1 Steel Ask for the Order And Get It! 2025-11-14T07:11:08.000Z yes A/V Geeks 16mm Films no 4107 16mm filmvintage filmpicnic1960sweldingT-1 steelsales trainingsalesmanshipask for orderGeorge Anconasteel weldinglow hydrogen electrodesDartnellclosing techniquesUSS Steel https://avgeeks.videonest.co/videos/1460755/the-proof-is-everywhere-1964 https://img.videonest.org/gamma/1460755_thumbnail_resized_v2.webp https://gamma.videonest.org/1460755_video_v4_360.mp4 The Proof Is Everywhere (1964) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the advanced features and benefits of AC fire ring spark plugs, highlighting their historical significance, scientific superiority, and manufacturing quality. It emphasizes the innovative design elements that enhance performance, such as the hot tip for self-cleaning, durable materials, and precision engineering. The video showcases the rigorous quality control processes and the pride of the workforce in producing high-quality spark plugs that outperform competitors. 2025-11-13T17:00:17.000Z yes A/V Geeks 16mm Films no 527 AC Spark PlugsAC Fire-RingSpark PlugsManufacturing ProcessQuality ControlIsovole AlloyFlint PlantRing of FireHeat Sealinginternal combustion engines https://avgeeks.videonest.co/videos/1460756/av-geeks-16mm-lunch-11-12-2025 https://i.ytimg.com/vi/Dx1Cr_8HzNs/maxresdefault.jpg https://gamma.videonest.org/1460756_video_v5_360.mp4 AV Geeks 16mm Lunch 11-12-2025 We are watching old 16mm films today even though we are in a fog of cold medication. #avgeeks #16mmfilms The Community - Ecology Projecting Ideas on the Overhead Projector Give or Take: Private or Public? Mountain Farmers - Switzerland 2025-11-13T08:13:26.000Z yes A/V Geeks 16mm Films no 7185 https://avgeeks.videonest.co/videos/1460757/canaries-are-fun-1950s https://img.videonest.org/gamma/1460757_thumbnail_resized_v2.webp https://gamma.videonest.org/1460757_video_v4.mp4 Canaries Are Fun (1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Tom and Peggy decide to buy their mother a special gift for her birthday and choose a yellow canary named Pete. They learn about canaries, their care, and the joy they bring to a household. As Pete becomes part of the family, they also discover the rewarding hobby of breeding canaries, which leads to a thriving home aviary and the happiness that pets can bring. 2025-11-13T05:01:00.000Z yes A/V Geeks 16mm Films no 692 Canaries are Funyellow canarybird carePet BirdBird SeedFrench's bird seedcanary breedingPeteTomPeggypet carebird songbaby birdspet ownershipliving hobby https://avgeeks.videonest.co/videos/1460758/av-geeks-16mm-lunch-11-12-2025 https://img.videonest.org/gamma/1460758_thumbnail_resized_v2.webp https://gamma.videonest.org/1460758_video_v5_360.mp4 AV Geeks 16mm Lunch 11-12-2025 We are watching old 16mm films today even though we are in a fog of cold medication. #avgeeks #16mmfilms 2025-11-12T22:56:57.000Z yes A/V Geeks 16mm Films no 4160 A/V Geeks16mm filmecologyoverhead projectorSwiss mountain farmersSwitzerlandeducational filmcommunitypublic goodsprivate goodsfood webherbivorecarnivorecheese makingtraditional farming https://avgeeks.videonest.co/videos/1460759/kimono-1955 https://img.videonest.org/gamma/1460759_thumbnail_resized_v2.webp https://gamma.videonest.org/1460759_video_v4.mp4 Kimono (1955) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Showcases the cultural significance of the kimono in Japan, highlighting its historical roots and the intricate designs that reflect Japanese traditions. It follows the story of Hanukkah and her family as they prepare for her wedding, illustrating the various types of kimonos worn by different generations and the importance of these garments in Japanese society. The narrative emphasizes the blend of old and new in Japan, the beauty of the kimono, and its role in various ceremonies and daily life. #KimonoCulture #JapaneseTradition #WeddingCeremony 2025-11-12T17:01:18.000Z yes A/V Geeks 16mm Films no 1188 KimonoJapanese cultureJapanese clothingJapanese WeddingWedding KimonoTraditionKyotoSilkObiJapanese WomanJapanese ArtHeian PeriodFabric DyeingTokyoHanako https://avgeeks.videonest.co/videos/1460760/av-geeks-16mm-lunch-11-11-2025 https://img.videonest.org/gamma/1460760_thumbnail_resized_v2.webp https://gamma.videonest.org/1460760_video_v4.mp4 AV Geeks 16mm Lunch 11-11-2025 C'mon America, support your veterans! #avgeeks #16mmfilms Home Movie - Veteran's Day Parade (silent) One Minute A Day Unfinished Business Prescription OT 2025-11-12T07:11:51.000Z yes A/V Geeks 16mm Films no 4069 https://avgeeks.videonest.co/videos/1460761/daily-double-1948 https://img.videonest.org/gamma/1460761_thumbnail_resized_v2.webp https://gamma.videonest.org/1460761_video_v4.mp4 Daily Double (1948?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the importance of wine in enhancing dining experiences and driving repeat business in restaurants. It highlights various types of wines, their pairings with food, and the art of serving wine to customers. The speaker emphasizes that good food paired with the right wine creates lasting "taste memories," which lead to satisfied customers and increased profits. #WineEducation, #DiningExperience, #RestaurantBusiness 2025-11-12T05:00:09.000Z yes A/V Geeks 16mm Films no 977 Wine Advisory BoardCalifornia winewineserving winecustomer servicewine typesrestaurant winewine etiquetteAppetizer WinesWhite Table WinesRed Table WineBurgundy Winecheeserecommendationswhite wine https://avgeeks.videonest.co/videos/1460762/bitter-welcome-1959 https://img.videonest.org/gamma/1460762_thumbnail_resized_v2.webp https://gamma.videonest.org/1460762_video_v4_360.mp4 Bitter Welcome (1959) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A group of workers discusses hiring a man just released from a mental hospital. The conversation reveals their concerns and prejudices about mental health, as they worry about safety on the job and the stigma surrounding mental illness. One character, Tommy, struggles with acceptance from his peers while trying to prove he can work effectively despite his past. The narrative highlights themes of discrimination, understanding, and the importance of second chances. #MentalHealth #Stigma #SecondChances 2025-11-11T17:00:45.000Z yes A/V Geeks 16mm Films no 2130 https://avgeeks.videonest.co/videos/1460763/destination-unknown-this-is-the-life-1962 https://img.videonest.org/gamma/1460763_thumbnail_resized_v2.webp https://gamma.videonest.org/1460763_video_v4_360.mp4 Destination Unknown - This is the Life (1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A Christian drama featuring a young Leonard Nimoy aboard TWA flight 704, where passengers discuss their backgrounds, beliefs, and the contrasting ideologies of communism and Christianity. The conversation touches on themes of freedom, faith, and the search for meaning in life, culminating in a pastor's encouragement to a young man contemplating his beliefs and future. The narrative emphasizes the importance of questioning and the role of faith in finding purpose. #Faith #Freedom #Belief 2025-11-11T05:00:27.000Z yes A/V Geeks 16mm Films no 1779 Leonard NimoyTWAcommunismcold warairplaneChristianFaithFreedom of beliefTravelSan Francisco AirportSoviet UnionTWA flightflyingQuestioningThe life that counts https://avgeeks.videonest.co/videos/1460764/av-geeks-16mm-lunch-11-10-2025 https://img.videonest.org/gamma/1460764_thumbnail_resized_v2.webp https://gamma.videonest.org/1460764_video_v4_360.mp4 A/V Geeks 16mm Lunch 11-10-2025 Welcome! I hope "oil's well" with you and you are up for watching some 16mm films about oil! Oil Transport (silent) Atomic Oil This is Oil Oil for Victory 2025-11-10T18:00:06.000Z yes A/V Geeks 16mm Films no 3959 16mm filmoilpetroleumoil industryatomic oiloil transportworld war IIvintagegasolinediesel oiloil productionatomic sciencefuel oilEssoanimation https://avgeeks.videonest.co/videos/1460765/breakdown-1951 https://img.videonest.org/gamma/1460765_thumbnail_resized_v2.webp https://gamma.videonest.org/1460765_video_v4.mp4 Breakdown (1951) Discusses the mental health struggles of a young woman named Anne Morton, who experiences a breakdown and is eventually admitted to a mental hospital. The narrative highlights the misunderstandings surrounding mental illness, the importance of proper treatment, and the stigma that persists even after recovery. It emphasizes the need for societal awareness and support for mental health issues, showcasing the journey of Anne's family as they grapple with her condition and the complexities of mental health care. #MentalHealth #RecoveryJourney #Stigma 2025-11-10T17:01:12.000Z yes A/V Geeks 16mm Films no 2245 Mental HealthMental IllnessMental HospitalRecoveryPatient CareMedical TreatmentPsychotherapyElectroshock TreatmentGroup TherapyPublic HealthReturning HomeStigmaIsolationParanoiaAccepting Differences https://avgeeks.videonest.co/videos/1460766/an-industrial-lake-port-usa-buffalo-ny-1949 https://img.videonest.org/gamma/1460766_thumbnail_resized_v2.webp https://gamma.videonest.org/1460766_video_v4.mp4 An Industrial Lake Port (USA Buffalo, NY, 1949) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. "An Industrial Lake Port" showcases Buffalo, NY, as a pivotal lakeport in North America, facilitating the transport of agricultural and industrial goods. It highlights the role of the lighthouse in guiding ships safely into the harbor, the significance of hydroelectric power from Niagara Falls for local industries, and Buffalo's extensive transportation networks, including railroads. The video also details the processes involved in flour milling and steel manufacturing, emphasizing Buffalo's importance as an industrial hub. #BuffaloNY #IndustrialPorts #GreatLakes 2025-11-10T05:00:40.000Z yes A/V Geeks 16mm Films no 1202 Buffalo, NYIndustrial Lake PortGreat LakesFlour millingSteel productionShipping lanesRailroadFreight TrainsGrain elevatorsIron oreLake ErieNiagara FallsFreightersIron productionSteel https://avgeeks.videonest.co/videos/1460767/one-step-at-a-time-1960s https://img.videonest.org/gamma/1460767_thumbnail_resized_v2.webp https://gamma.videonest.org/1460767_video_v4.mp4 One Step at a Time (1960s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the effectiveness of the tutorial method of education, emphasizing the benefits of individualized attention from teachers and the use of auto instructional devices. It illustrates how these devices can facilitate learning at a personalized pace, helping students grasp complex concepts in subjects like physics. Research shows that auto instructional materials can significantly improve student achievement, making education more accessible and tailored to individual needs. #Education #Learning #AutoInstructionalDevices 2025-11-09T17:00:57.000Z yes A/V Geeks 16mm Films no 1679 One Step at a Timetutorial methodautoinstructional devicepersonalized learningteaching machinestudent achievementphysics courseelectricityprogrammed textindividual approachhigh schooleducational researchauto-instructional methodsclassroomphysics class https://avgeeks.videonest.co/videos/1460768/the-carters-meet-the-computer-1976 https://img.videonest.org/gamma/1460768_thumbnail_resized_v2.webp https://gamma.videonest.org/1460768_video_v4.mp4 The Carters Meet The Computer (1976) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This government training film dramatizes the consequences of human error within public labor service agencies by parodying the Silent Film era. Drawing inspiration from Charlie Chaplin’s Tramp, it follows a Chaplin-like figure and his wife through a series of tragicomic misadventures as they are thwarted by bureaucratic inefficiency. Using accelerated frame rates to mimic the jerky motion of early cinema and a desaturated palette to evoke black-and-white film, the production blends slapstick and pathos to underscore how small administrative mistakes can have serious human impacts. The film features intertitles and a silent-style score to complete its vintage pastiche. 2025-11-09T05:00:30.000Z yes A/V Geeks 16mm Films no 934 staff trainingunemployment insuranceemployment security administrationfiling claimjob serviceaddress changejob interviewscarpenterjob searchJob ServiceUS Department of LaborVintage filmEducational Film CenterCreditsinternal staff training package https://avgeeks.videonest.co/videos/1460769/av-geeks-16mm-lunch-11-7-2025 https://img.videonest.org/gamma/1460769_thumbnail_resized_v2.webp https://gamma.videonest.org/1460769_video_v4.mp4 AV Geeks 16mm Lunch 11-7-2025 Let's try that again with the proper date.. #avgeeks #16mmfilms Facial Changes (silent) Dr. Dial PSAs The Smiles Have It Teeth Are Good Things To Have Crest Cavity Creep Commercials, Dental PSAs, etc 2025-11-08T07:12:09.000Z yes A/V Geeks 16mm Films no 3972 16mm filmvintage filmdental healthdental caretooth decayCrestcavity creepsAmerican Dental Associationoral hygieneteeth cleaningDr. Dialfilm projectoranimated commercialFluorideAV Geeks https://avgeeks.videonest.co/videos/1460770/no-me-acorralen-spanish-1960s https://img.videonest.org/gamma/1460770_thumbnail_resized_v2.webp https://gamma.videonest.org/1460770_video_v4.mp4 No Me Acorralen (Spanish, 1960s) A satirical cartoon centered around themes of agrarian struggle, capitalist exploitation, and the quest for peaceful coexistence. Characters discuss the injustices faced by the oppressed, the absurdity of violence, and the need to dismantle barriers for a better society. The dialogue reflects a mix of humor and serious commentary on socio-political issues. #AgrarianStruggle #CapitalismCritique #PeacefulCoexistence Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-08T05:00:52.000Z yes A/V Geeks 16mm Films no 439 No me acorralenCold WarExploitationPeaceful coexistenceImperialismAnimated CartoonAgrarian StruggleCapitalism CritiqueSpanish wordDonkeybirdDibujos Animados S.A. https://avgeeks.videonest.co/videos/1460771/stapleton-that-luang-fair-silent-raw-footage-1971 https://img.videonest.org/gamma/1460771_thumbnail_resized_v2.webp https://gamma.videonest.org/1460771_video_v4.mp4 Stapleton: That Luang Fair (silent raw footage, 1971) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Stapleton: That Luang Fair The footage showcases a vibrant tapestry of everyday life in a small town. It opens with various street scenes, featuring a station wagon parked near a stop sign, the historic 'Pioneer Restaurant' building, and a vintage car alongside a moving pickup truck in front of a local store. The focus then shifts to a man in a straw hat who is seen holding newspapers outside a brick post office, underlining the community's daily activities and local services, with the post office displaying its operating hours. The segment concludes with glimpses of suburban life, including a person watching television indoors and a yellow school bus navigating the neighborhood, capturing the essence of routine and community connection. #small town life #community scenes #vintage cars #local services #suburban routine Timeline 00:00:00 - 00:02:00 Street Scenes and Pioneer Restaurant 00:00:00 A station wagon is parked on a street corner near a stop sign during the day, with a small white building and open space in the background. 00:01:24 An old, wooden, two-story building with a 'Pioneer Restaurant' sign is shown on a sunny day, featuring large front windows and a motorcycle parked nearby. 00:01:48 A parked vintage car and a moving blue pickup truck are seen in front of a store with a green awning, capturing a mid-20th-century street scene. 00:02:00 - 00:02:45 Stapleton, Nebraska Post Office 00:02:00 The segment opens with a sign for Stapleton, Nebraska 69163, establishing the location. 00:02:05 A man in a straw hat stands outside a brick post office in Lindsey, Oklahoma, holding newspapers. 00:02:07 The post office window displays service hours, emphasizing the small-town setting. 00:02:25 The man, wearing a pink shirt, holds a stack of newspapers, with a street scene visible in the background. 00:02:45 - 00:05:43 Suburban Life and Television 00:02:45 A person watches a man in a suit speak on television in a dimly lit room, surrounded by domestic items like a typewriter and framed photos. 00:03:20 A person holds a cowboy hat in front of a white house with a fenced yard, suggesting a suburban setting on a clear day. 00:05:20 A yellow school bus drives down a tree-lined suburban street under a clear blue sky, indicating a sunny day in a residential area. 2025-11-08T05:00:03.000Z yes A/V Geeks 16mm Films no 344 StapletonNebraskasmall towncountrysidelocal lifeschool busstation wagonyellow vehiclesStapleton Public School https://avgeeks.videonest.co/videos/1460772/missouri-state-traffic-psas https://img.videonest.org/gamma/1460772_thumbnail_resized_v2.webp https://gamma.videonest.org/1460772_video_v4.mp4 Missouri State Traffic PSAs The Missouri State Traffic PSAs emphasize the importance of traffic safety and fuel economy, urging drivers to obey speed limits, turn off engines when idle, maintain tire pressure, and use seat belts. Women are encouraged to join the Women in Traffic Safety (WITS) initiative to promote safety awareness. The campaign highlights a significant reduction in traffic deaths due to lower speeds and improved driving habits, and it calls for continued efforts to save lives on Missouri roads. Tags: #TrafficSafety #FuelEconomy #WITSEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-07T17:00:51.000Z yes A/V Geeks 16mm Films no 354 traffic safetyseatbeltsfuel economyMissouriTraffic deathsDriving safetyHighway safetyPedestrian safetyDriving habitsSam SmithPaul CollinsCarolyn BondChristopher Bond https://avgeeks.videonest.co/videos/1460773/av-geeks-16mm-lunch-11-6-2025 https://img.videonest.org/gamma/1460773_thumbnail_resized_v2.webp https://gamma.videonest.org/1460773_video_v4.mp4 AV Geeks 16mm Lunch 11-6-2025 Thursday and we got some films to show you! #avgeeks #16mmfilms From Dada to Surrealism (Intro) Principles of Development The Big A Thinking of You 2025-11-07T07:07:47.000Z yes A/V Geeks 16mm Films no 3683 16mm filmDada to Surrealismavant-gardeexperimental filmA/V Geekschild developmentvintage advertisementHallmark CardsThinking of Youagricultural machineryfertilizer applicationThe Big Afilm historyfilm preservationgreeting cards https://avgeeks.videonest.co/videos/1460774/fan-trip-to-silverton-fred-mcleod https://img.videonest.org/gamma/1460774_thumbnail_resized_v2.webp https://gamma.videonest.org/1460774_video_v4.mp4 Fan Trip to Silverton Fred McLeod 00:09:42 A train horn blows, cutting through the sound of wind, suggesting the presence of a railway. 00:12:43 - 00:20:02 Train Journey and Interactions 00:12:43 Passengers are enjoying a scenic journey aboard a train as it travels through a rural landscape, offering a nostalgic experience. 00:14:17 A conductor interacts with a passenger about their ticket, which needs to be punched. 00:16:37 Passengers are advised to be cautious when taking pictures and not get too close to the edge. 00:20:02 - 00:24:04 Journey Through Silverton's Scenic Landscapes 00:20:02 The journey begins with a scenic view of rugged, tree-dotted hills and distant mountain ranges under a cloudy sky, showcasing a tranquil and expansive vista. 00:20:58 A man points out a large pillar, humorously noting it is not 'lizard-headed', while admiring the beautiful Aspen trees and the gorgeous, faraway views. 00:21:24 The scene then shifts to a view 500 feet down, revealing the coal tank and the Toltak gorge, emphasizing the dramatic elevation and natural features of the area. 00:22:50 A group of people gathers near a railway track amidst lush green hills, interacting and taking photos, suggesting a recreational outing related to train travel or railfanning. 00:24:04 - 00:30:50 Journey Through Silverton 00:25:00 A voice expresses gratitude for a 'nice run' and mentions leveling up and snow. 00:27:12 The sounds of a train clacking and sirens blaring indicate activity and movement in the area. 00:29:42 The segment concludes with the distinct sound of a train chugging, followed by a request to be informed when something will start and a shout. 00:30:50 - 00:41:37 Scenic Train Journey 00:32:58 A conductor waves to spectators from a moving train as it travels through a lush, mountainous area, with people gathered along the tracks to watch. 00:39:15 The sounds of an engine rumbling and a train passing by are heard, emphasizing the presence and movement of the locomotive. 00:41:15 Passengers enjoy the scenic views from an orange vintage train as it curves through lush greenery and mountainous terrain, capturing the nostalgic charm of train travel. 2025-11-07T05:01:14.000Z yes A/V Geeks 16mm Films no 2498 steam enginetrain travelrailroadSilvertonColoradoFred McLeodsteam trainvintage trainrural landscapenarrow gaugecattle ranchmountain sceneryscenic viewsDenver & Rio Grande WesternToltec Gorge https://avgeeks.videonest.co/videos/1460775/barry-goldwater-speaks-out-1964 https://img.videonest.org/gamma/1460775_thumbnail_resized_v2.webp https://gamma.videonest.org/1460775_video_v4.mp4 Barry Goldwater Speaks Out (1964) Barry Goldwater addresses voters in New Hampshire during his presidential campaign, emphasizing the importance of a strong foreign policy to ensure peace and national strength. He critiques the current administration's foreign aid policies and advocates for personal responsibility in government. Goldwater expresses his commitment to social security while warning about inflation's impact on benefits. Throughout his campaign, he garners support by promoting individual freedom and the rejection of socialist policies. #BarryGoldwater #PoliticalSpeech #ForeignPolicyEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-07T05:00:38.000Z yes A/V Geeks 16mm Films no 717 Barry Goldwater1964 ElectionPolitical CampaignForeign PolicySocial SecurityIndividual FreedomRepublican PartyEconomic PolicyUnited NationsNew HampshireAmerican PolicyVoteCampaignFree EnterprisePolitical Rally https://avgeeks.videonest.co/videos/1460776/crystal-champions-1929 https://img.videonest.org/gamma/1460776_thumbnail_resized_v2.webp https://gamma.videonest.org/1460776_video_v4.mp4 Crystal Champions (1929) "Crystal Champions" showcases an underwater playground in Silver Springs, Florida, featuring stunning aquatic scenery and exceptional swimming talent. It highlights world champions Miss Neridius and Johnny, who demonstrate their swimming prowess and diving skills, showcasing various techniques and dives. The underwater environment is described as a magical paradise, enhancing the experience of the sport. #UnderwaterSports #SwimmingChampions #DivingSkillsEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-06T17:01:33.000Z yes A/V Geeks 16mm Films no 626 Crystal ChampionsSilver SpringsMartha NoreliusJohnny Weissmullerunderwater swimmingswimming techniquesswimming championUnderwater divingSwan diveSpringboard divingVintage sporthistorical film https://avgeeks.videonest.co/videos/1460777/av-geeks-16mm-lunch-11-5-2025 https://img.videonest.org/gamma/1460777_thumbnail_resized_v2.webp https://gamma.videonest.org/1460777_video_v5_360.mp4 AV Geeks 16mm Lunch 11-5-2025 More films for you! 16mm films are the best! #avgeeks #16mmfilms Leap From the Water Tower (silent) Magic Rails to Yesterday Norstar Vision: Union Station Reborn Fan Trip to Silverton 2025-11-06T07:42:18.000Z yes A/V Geeks 16mm Films no 5849 16mm filmrailroadsteam trainvintage filmsilent filmtrain travelSilverton Coloradorailroad historylocomotivetrainColoradoSan FranciscoUnion StationFred McLeodavgeeks https://avgeeks.videonest.co/videos/1460778/seeing-them-through-1940s https://img.videonest.org/gamma/1460778_thumbnail_resized_v2.webp https://gamma.videonest.org/1460778_video_v4.mp4 Seeing Them Through (1940s?) The film explores the significant impact of the American Red Cross during World War II, particularly in 1945, as they navigated the challenges posed by intense fighting on the European battlefronts. It captures the desperate resistance of German forces and the heavy toll on American and Allied soldiers, emphasizing the urgent need for Red Cross support. As American soldiers fought overseas, the Red Cross faced immense obligations, requiring an increasing number of volunteers and resources to assist the troops and alleviate their hardships. The organization played a crucial role in providing comfort and relaxation to soldiers on the front lines in both the European and Pacific theaters. The film highlights the Red Cross's support for medical units, ensuring that soldiers received the assistance they needed as the war progressed. Their efforts extended to hospital ships and docksides, where Red Cross workers helped returning soldiers, ensuring their comfort and continued support. Additionally, the Red Cross delivered vital supplies to American prisoners of war, facilitating communication with their families and providing essential resources. Blood donations emerged as a critical connection between soldiers on the battlefield and those on the home front, with recipients expressing deep gratitude for the life-saving support they received. The film ultimately underscores the indispensable role of the American Red Cross in supporting both soldiers and their families during wartime. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-06T05:01:11.000Z yes A/V Geeks 16mm Films no 509 World War IIAmerican Red Crossmilitary supportprisoner of warwar reliefRed CrossBlood donationsWar prisonersAmerican troopsBlood plasmaCombat zones https://avgeeks.videonest.co/videos/1460779/he-comes-from-another-room-1974 https://img.videonest.org/gamma/1460779_thumbnail_resized_v2.webp https://gamma.videonest.org/1460779_video_v4.mp4 He Comes From Another Room (1974) Discusses the experiences of two boys, Chris and David, who are part of a special education program. It highlights the importance of socialization, empathy, and support in their learning environments. Chris struggles with emotional outbursts and self-harm, while David, who has autism, is gradually integrating into a regular classroom. The educators emphasize the need for patience, understanding, and creating a secure environment for these children to thrive academically and socially. #SpecialEducation #AutismAwareness #ChildDevelopmentEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-05T17:01:15.000Z yes A/V Geeks 16mm Films no 1676 special educationemotional developmentsocial skillschild behaviorHillside Schoolclassroomelementary schoolnonverbal communicationchild developmentstudent interaction1970steachersstudentstrustautism https://avgeeks.videonest.co/videos/1460780/av-geeks-16mm-lunch-11-4-2025 https://img.videonest.org/gamma/1460780_thumbnail_resized_v2.webp https://gamma.videonest.org/1460780_video_v5_360.mp4 AV Geeks 16mm Lunch 11-4-2025 Have you voted yet? If not, go do that now and then join us for 16mm films! #avgeeks #16mmfilms Unknown Russian Music Video Raw Footage (silent) The Red Trap Six Polka Soundies 2025-11-05T07:16:36.000Z yes A/V Geeks 16mm Films no 4149 16mm filmRussian music videovintage music videosilent filmA/V GeeksThe Red Trapcommunismcold warred scareSoundiespolka musicvintage filmblack and whitepolkadancing https://avgeeks.videonest.co/videos/1460781/fbi-at-war-1940s https://img.videonest.org/gamma/1460781_thumbnail_resized_v2.webp https://gamma.videonest.org/1460781_video_v4.mp4 FBI at War (1940s) Discusses the role and operations of the FBI, highlighting its evolution under Director J. Edgar Hoover, its scientific approach to crime detection, and its significant contributions during World War II. The FBI collaborates with local law enforcement and has developed advanced techniques for crime-solving, which have proven effective in countering espionage and maintaining national security. #FBI #LawEnforcement #CrimeDetection Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-05T05:00:13.000Z yes A/V Geeks 16mm Films no 1027 Federal Bureau Investigationlaw enforcementJ. Edgar Hoovercrime detectionFBI AcademyAugust BaumeyerGerman American BundFBI agentNaziportable radio transmitterNazi spy ringWorld War IIEspionageNazi GermanyFBI https://avgeeks.videonest.co/videos/1460782/grass-on-the-roof-1979 https://img.videonest.org/gamma/1460782_thumbnail_resized_v2.webp https://gamma.videonest.org/1460782_video_v4.mp4 Grass on the Roof (1979?) "Grass on the Roof" features a character named Mortimer who learns about his late aunt Emma's unconventional earth-sheltered house. The conversation reveals the benefits of living in such a home, including energy efficiency, comfort, and protection from extreme weather. Mortimer explores the house with his aunt's spirit, discovering its unique features and the history behind earth-sheltered architecture. #EarthShelteredHousing #HomeDesign #SustainableLiving Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-04T17:00:25.000Z yes A/V Geeks 16mm Films no 1709 earth sheltered homeunderground housesustainable livingenergy efficiencyalternative livingearth sheltered housingunderground homesmodern architecturehome tourhouse tourMortimerEmmathermal masssolar heatingberming https://avgeeks.videonest.co/videos/1460783/mental-mechanisms-no-3-over-dependency-1949 https://img.videonest.org/gamma/1460783_thumbnail_resized_v2.webp https://gamma.videonest.org/1460783_video_v4.mp4 Mental Mechanisms: No 3, Over-Dependency (1949) Explores the psychological struggles of James Howard, a man who exhibits over-dependency stemming from his childhood experiences. He often feels sick to gain affection and attention, reflecting his inability to cope with adult responsibilities. Through a doctor's consultation, it is revealed that his emotional conflicts manifest as physical symptoms. The narrative highlights the importance of self-reliance and the need for support without excessive protection, emphasizing the journey towards independence and self-acceptance. #MentalHealth #EmotionalDependency #SelfAwareness 2025-11-04T17:00:05.000Z yes A/V Geeks 16mm Films no 1882 Mental HealthOver-DependencyRobert AndersonNational Film Board of CanadaMcGill Universityemotional difficultiestherapychildhoodparentingmarriagerelationshipsdoctorJim Howardoffice scenepersonal growth https://avgeeks.videonest.co/videos/1460784/av-geeks-16mm-lunch-11-3-2025 https://img.videonest.org/gamma/1460784_thumbnail_resized_v2.webp https://gamma.videonest.org/1460784_original_360.mp4 AV Geeks 16mm Lunch 11-3-2025 Hello November. Do you like old 16mm films? That's what we do on this channel. Watch old 16mm films! Join us! #avgeeks #16mmfilms Hermann Collection Home Movie (silent) Day without Numbers (complete!) King Calico Dick Whittington and his Cat Wonderful World of Trains 2025-11-04T07:20:28.000Z yes A/V Geeks 16mm Films no 4640 https://avgeeks.videonest.co/videos/1460785/wing-walkers-silent-1930s https://img.videonest.org/gamma/1460785_thumbnail_resized_v2.webp https://gamma.videonest.org/1460785_video_v4.mp4 Wing Walkers (silent, 1930s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This captivating footage showcases the thrilling world of wing walking, featuring daring stunts performed by skilled acrobats atop biplanes soaring through the sky. Viewers are treated to breathtaking scenes of individuals executing impressive aerial maneuvers against stunning backdrops, including urban landscapes. The excitement of early aviation is brought to life as these fearless performers prepare for their jaw-dropping feats. The presentation concludes with a heartfelt thanks to the audience, inviting them to engage further with the content and encouraging subscriptions for more exhilarating experiences. #Wing Walking #Aerial Stunts #Biplane Performances #Thrilling Acrobats #Sky Adventures Timeline 00:00:01 - 00:06:57 Wing Walking Stunts 00:02:04 A parachutist descends against an expansive sky, hinting at the aerial acrobatics to come. 00:02:15 A child is prepared for a wing walking performance, with an adult securing their harness and helmet near an aircraft. 00:03:52 A person performs a daring stunt by walking on the wing of a biplane flying low over a body of water, climbing a ladder attached to the aircraft. 00:05:23 A large crowd gathers on a bridge and grassy area, observing an aerial event, likely the wing walking demonstrations. 00:06:57 - 00:07:52 Wing Walkers 00:06:57 A large explosion engulfs a wooden structure, generating a thick cloud of dark smoke in an open area. 00:07:41 An aircraft flies above a cityscape with a person standing atop its wings, demonstrating the daring act of wing walking. 00:07:43 A young woman, dressed in a white outfit and wearing goggles, is captured in mid-motion against a stark white background, suggesting involvement in aerial stunts. 2025-11-04T05:00:36.000Z yes A/V Geeks 16mm Films no 477 wing walkingaerial stuntsbiplanevintage stuntsairplane stuntsaerial acrobaticsplane stuntsair showAviation stuntsStuntmanAirplane crashplane crasheswater skiing https://avgeeks.videonest.co/videos/1460786/dental-disease-why-our-oral-health-is-declining-shorts https://img.videonest.org/gamma/1460786_thumbnail_resized_v2.webp https://gamma.videonest.org/1460786_video_v4.mp4 Dental Disease: Why Our Oral Health is Declining #shorts We've conquered countless diseases and believe we're getting healthier. But dental disease is on the rise. Are we overlooking something crucial? #DentalHealth #OralHygiene #HealthFacts #Wellness 2025-11-04T01:50:28.000Z yes A/V Geeks 16mm Films no 21 dental healthoral hygienetooth decaydental diseaseoral health declinehealth factswellnessdental carehealthy teeth https://avgeeks.videonest.co/videos/1460787/mental-illness-understanding-types-and-different-perspectives-shorts https://img.videonest.org/gamma/1460787_thumbnail_resized_v2.webp https://gamma.videonest.org/1460787_video_v4.mp4 Mental Illness: Understanding Types and Different Perspectives #shorts Not all mental differences are disorders. Some are mild; some severe. But within each group, individuals handle issues differently. Understanding is key. #MentalHealth #MentalIllness #Understanding #Differences 2025-11-04T01:49:03.000Z yes A/V Geeks 16mm Films no 27 mental healthmental illnessunderstandingdifferencesmental disorder https://avgeeks.videonest.co/videos/1460788/isle-of-mystery-1959 https://img.videonest.org/gamma/1460788_thumbnail_resized_v2.webp https://gamma.videonest.org/1460788_video_v4.mp4 Isle of Mystery (1959) "Isle of Mystery" explores the eerie and historical Dry Tortugas, an abandoned fortress in Monroe County, Florida. Built in the mid-19th century as a military stronghold, it has a haunting past involving pirates, prisoners, and a devastating yellow fever epidemic. The fortress, known for its massive walls and ghostly silence, served not only as a military installation but also as a notorious federal prison. The narrative highlights legends of buried treasure, the tragic fate of prisoners, and the mysterious grave that continues to attract attention. #History #GhostStories #AbandonedPlacesEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-03T17:01:12.000Z yes A/V Geeks 16mm Films no 597 Fort JeffersonDry TortugasFlorida KeysAmerican GibraltarBuccaneer daysCivil WarGhost StoriesprisonSamuel MuddJohn Wilkes Boothyellow feverisland citadelMajor ArnoldCannon BallColumbiad https://avgeeks.videonest.co/videos/1460789/workshop-for-peace-2nd-edition-1960 https://img.videonest.org/gamma/1460789_thumbnail_resized_v2.webp https://gamma.videonest.org/1460789_video_v4.mp4 Workshop for Peace (2nd edition, 1960) Describes the United Nations headquarters in New York City, established in 1950 as a "workshop for peace" to prevent future wars. It details the functions of the General Assembly, the various councils, and the Secretariat, highlighting the importance of international cooperation and dialogue. The video emphasizes the role of the UN in promoting peace, social progress, and human rights, as well as its outreach through organizations like UNICEF. #UnitedNations #GlobalPeace #InternationalRelationsEmail Contact us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-03T05:00:20.000Z yes A/V Geeks 16mm Films no 1451 United NationsGeneral AssemblySecurity CouncilPeaceInternational RelationsNew York CityUN SecretariatUNICEFInternational AffairsPolitical MeetingDelegatesGhanaEconomic CouncilHuman RightsPeacekeeping https://avgeeks.videonest.co/videos/1460790/credit-mans-confidence-in-man-1950 https://img.videonest.org/gamma/1460790_thumbnail_resized_v2.webp https://gamma.videonest.org/1460790_video_v4.mp4 Credit : Man's Confidence in Man (1950) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the vital role of credit in commerce, illustrating how it facilitates trade and economic growth. It highlights various examples, from fishing hooks to business transactions, to demonstrate how credit operates on trust and mutual obligations. The narrative emphasizes that credit is essential for the functioning of modern economies, enabling the exchange of goods and services efficiently. It also touches on the historical development of credit systems and their impact on American prosperity. 2025-11-02T17:00:57.000Z yes A/V Geeks 16mm Films no 1958 creditEconomic growthAmerican economyDun & Bradstreetcredit historybusiness financecommercecredit obligation1800s tradeearly americawholesale traderetail storeAmerican standard of livingcredit riskcredit reporting https://avgeeks.videonest.co/videos/1460791/arthur-murray-cavalcade-1958 https://img.videonest.org/gamma/1460791_thumbnail_resized_v2.webp https://gamma.videonest.org/1460791_video_v4.mp4 Arthur Murray Cavalcade (1958) The Arthur Murray Cavalcade presents a delightful journey through classic dance styles from a bygone era. The program opens with a lively performance of the Charleston and the Turkey Trot, capturing the spirit and energy of the time. Following this, couples in formal attire take center stage to perform the Lambeth Walk in a grand ballroom, adorned with luxurious drapery and sparkling chandeliers, epitomizing sophistication. As the showcase continues, elegantly dressed dancers display their skills in various synchronized ballroom routines, illustrating a range of dance styles in the opulent setting. The performance features a medley of dances, including the Maxi and the Hesitation Waltz, with couples gracefully moving in harmony, enhancing the formal ambiance. The segment concludes with a moment of instrumental music accompanied by applause, marking the end of this enchanting celebration of dance. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-02T17:00:35.000Z yes A/V Geeks 16mm Films no 674 Arthur MurrayCharlestonLambeth Walkballroom dancesocial danceformal wearballroom dancingdanceblack and whiteArthur Murray StudioBooms-a-DaisyLittle Footdance contestintertitles https://avgeeks.videonest.co/videos/1460792/halloween-parade https://img.videonest.org/gamma/1460792_thumbnail_resized_v2.webp https://gamma.videonest.org/1460792_video_v4.mp4 Halloween Parade A montage of halloween costumes and activities drawn from home movies and stock footage clips. We added an eerie ambient soundtrack to get you in the mood. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-02T15:20:32.000Z yes A/V Geeks 16mm Films no 1668 HalloweenHalloween paradeHalloween costumestrick or treatvintage videohome movies1950scostume partyvintage fashionchildren costumespumpkin patchfamily gatheringcostumesHalloween maskspicking pumpkins https://avgeeks.videonest.co/videos/1460793/mental-illness-recognizing-the-signs-and-symptoms-shorts https://img.videonest.org/gamma/1460793_thumbnail_resized_v2.webp https://gamma.videonest.org/1460793_video_v4.mp4 Mental Illness: Recognizing the Signs and Symptoms #shorts Distorted views of reality mark mental illness. Disturbed thoughts & feelings lead to twisted, unrealistic actions—repeatedly. More than occasional sadness, these become constant issues. #MentalHealth #MentalIllness #Wellbeing #Psychology 2025-11-01T19:09:35.000Z yes A/V Geeks 16mm Films no 89 Mental HealthMental IllnessWellbeingPsychologyDistorted ViewsDisturbed ThoughtsRecognizing SignsRecognizing Symptoms https://avgeeks.videonest.co/videos/1460794/teeth-protection-secret-shorts https://img.videonest.org/gamma/1460794_thumbnail_resized_v2.webp https://gamma.videonest.org/1460794_video_v4.mp4 Teeth Protection Secret! #shorts Why the order we eat food matters: sticky first, then juicy & crisp. More than cleansing, an apple's juicy flavor triggers saliva flow—shielding teeth from decay. #OralHealth #HealthyEating #DentalCare #FoodTips 2025-11-01T19:06:46.000Z yes A/V Geeks 16mm Films no 30 teeth protectionoral healthhealthy eatingdental carefood tipssaliva flowtooth decaysticky foodjuicy foodcrisp food https://avgeeks.videonest.co/videos/1460795/getting-it-together-1972 https://img.videonest.org/gamma/1460795_thumbnail_resized_v2.webp https://gamma.videonest.org/1460795_video_v4.mp4 Getting It Together (1972) Discusses the challenges and expectations of college students, emphasizing the importance of personal initiative, self-discovery, and engagement in the university experience. It highlights the need for students to take responsibility for their education and personal growth rather than waiting for opportunities to come to them. The discussion also touches on the role of education in fostering awareness and social responsibility, as well as the significance of relationships and communication in both academic and personal contexts. #HigherEducation #SelfDiscovery #CollegeLife Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-01T16:01:05.000Z yes A/V Geeks 16mm Films no 1664 Drake Universityhigher educationcampus lifestudent lifecollege experiencepersonal growthextracurricular activitiescollege band1970sgroup discussionstudentsfootball trainingolympic decathlonstudent engagementrelationships https://avgeeks.videonest.co/videos/1460796/av-geeks-16mm-lunch-10-31-2025 https://img.videonest.org/gamma/1460796_thumbnail_resized_v2.webp https://gamma.videonest.org/1460796_video_v5_360.mp4 AV Geeks 16mm Lunch 10-31-2025 And October ends with a bang! Happy 16mm Halloween! #avgeeks #16mmfilms Halloween Safety The Pumpkin Who Couldn't Smile Halloween Home Movies and Clips 2025-11-01T06:14:58.000Z yes A/V Geeks 16mm Films no 4423 16mm filmHalloweenvintageHalloween safetycostumesRaggedy AnnChuck Jonestrick or treatvintage halloweenhalloween costumesfilm projectorvintage filmanimationcartoonpumpkin https://avgeeks.videonest.co/videos/1460797/americas-heritage-a-colony-lives-on-1950s https://img.videonest.org/gamma/1460797_thumbnail_resized_v2.webp https://gamma.videonest.org/1460797_video_v4.mp4 America's Heritage: A Colony Lives On (1950s?) Explores the historical significance of Williamsburg, Virginia, as a preserved symbol of colonial America. It highlights the restoration of colonial buildings, the traditions of early American crafts, and the cultural practices that shaped the nation. The video also discusses the importance of various historical sites, such as the College of William and Mary, the printing office, and the governor's palace, while emphasizing the legacy of American independence and craftsmanship. #ColonialAmerica #HistoricalPreservation #AmericanHeritageEmail Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-01T04:00:31.000Z yes A/V Geeks 16mm Films no 1436 Colonial WilliamsburgColonial AmericaAmerican heritageHistorical RestorationGeorge WashingtonThomas JeffersonWilliam and MaryHistorical LandmarkHistorical ReconstructionSailing ShipsMaritime MuseumBlacksmith ShopQuill PenApothecaryTextile Weaving https://avgeeks.videonest.co/videos/1460798/land-of-the-chinook-1970 https://img.videonest.org/gamma/1460798_thumbnail_resized_v2.webp https://gamma.videonest.org/1460798_video_v4.mp4 Land Of The Chinook (1970) The film "Land Of The Chinook" showcases Alberta's winter activities, highlighting the region's warm Chinook winds and diverse leisure opportunities. It features snowmobiling, ice fishing, curling, ice boating, dog sled racing, and skiing, emphasizing the blend of modern technology with traditional practices. The film also highlights Alberta's picturesque landscapes, welcoming accommodations, and vibrant dining and nightlife, inviting visitors to experience the province's winter charm. keyword #Alberta #WinterSports #Chinook Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-31T16:01:13.000Z yes A/V Geeks 16mm Films no 1624 AlbertaWinter SportsSkiingSnowmobilingIce FishingCanadian RockiesChinookSnowMountainsIce BoatingDog Sled RaceSki ResortWinter ActivitiesSki LiftLake Louise https://avgeeks.videonest.co/videos/1460799/av-geeks-16mm-lunch-10-30-2025 https://img.videonest.org/gamma/1460799_thumbnail_resized_v2.webp https://gamma.videonest.org/1460799_video_v5_360.mp4 AV Geeks 16mm Lunch 10-30-2025 The Sun! We see the sun! Also, 16mm films! We see them too! #avgeeks #16mmfilms How To Make A Type Slide (silent) Preventative Lifeguarding An Industrial Lake Port (USA - Buffalo, NY) Destination Unknown 2025-10-31T06:22:56.000Z yes A/V Geeks 16mm Films no 4550 16mm filmvintage filmlifeguardingBuffalo NYGreat Lakesindustrial portTWADestination UnknownCold Warfilm projectortype slidewater safetySears StudioEast GermanyChristianity https://avgeeks.videonest.co/videos/1460800/these-are-the-people-1944 https://img.videonest.org/gamma/1460800_thumbnail_resized_v2.webp https://gamma.videonest.org/1460800_video_v4.mp4 These Are The People (1944) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the vital role of Kimberly Clark's paper mills and their workers during wartime. It highlights how these small-town individuals contribute to the war effort by producing essential materials like paper for military communications, packaging, and even manufacturing parts for weaponry. The narrative emphasizes the dedication and teamwork of the workers, including women in production and maintenance personnel, who ensure the smooth operation of the mills and the successful delivery of war products. Their efforts have earned recognition, such as the Army Navy E Award, for their significant contributions. #WarProduction #KimberlyClark #PaperMills 2025-10-31T04:01:15.000Z yes A/V Geeks 16mm Films no 1000 Kimberly Clarkpaper millWorld War IIwar effortpaper industrycellulose waddingKleenexKimberly-ClarkWar ProductsOrdnance AssemblyArmy NavyProduction EffortWar MaterialPaper MillsWar Production https://avgeeks.videonest.co/videos/1460801/official-sports-1978-television-commercials https://img.videonest.org/gamma/1460801_thumbnail_resized_v2.webp https://gamma.videonest.org/1460801_video_v4.mp4 Official Sports 1978 television commercials The film emphasizes the importance of interscholastic athletics in high schools, highlighting the growing participation among students and the commitment of schools to expand athletic programs while maintaining budget efficiency. It underscores the vital roles of coaches, officials, and administrators in fostering a supportive sports environment and advocates for community support of these programs. The message also recognizes the significant impact coaches have on students' lives beyond sports. #HighSchoolSports #CoachingImpact #AthleticParticipation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-30T22:01:15.000Z yes A/V Geeks 16mm Films no 339 High School Sportsinterscholastic athleticsathletic competitionscoachingstudent bodyNational Coaches DayOctober 3, 1975CoachCompetitive Athletics https://avgeeks.videonest.co/videos/1460802/av-geeks-16mm-lunch-10-29-2025 https://img.videonest.org/gamma/1460802_thumbnail_resized_v2.webp https://gamma.videonest.org/1460802_video_v4.mp4 AV Geeks 16mm Lunch 10-29-2025 More rain! More 16mm films! #avgeeks #16mmfilms One Rainy Day Adventures of a Junior Raindrop What Makes Rain? Rain for the Earth Let the Rain Settle It 2025-10-30T06:14:58.000Z yes A/V Geeks 16mm Films no 3908 16mm filmRainy Dayvintage filmeducational filmrainwater cycleJunior Raindropwater conservationrural lifefarmingweatherevaporationcondensationcloudsA/V Geeks https://avgeeks.videonest.co/videos/1460803/beyond-the-wall-1969 https://img.videonest.org/gamma/1460803_thumbnail_resized_v2.webp https://gamma.videonest.org/1460803_video_v4.mp4 Beyond The Wall (1969) Discusses the evolution of American hospitals from being exclusive institutions to becoming more community-oriented. It emphasizes the importance of accessible healthcare as a right for all, not just the wealthy. Various hospitals are highlighted for their innovative approaches to reaching underserved populations, including mobile clinics, community health services, and collaborations with local organizations to address specific health needs. The narrative underscores the necessity for hospitals to break down barriers and actively engage with the communities they serve. #HealthcareAccess #CommunityHealth #HospitalInnovationEmail us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-30T04:00:37.000Z yes A/V Geeks 16mm Films no 1725 American Hospitalcommunity healthhealth policymedical carehealthcare servicescommunity servicehospital outreachlow incomemobile clinicsenior citizensprenatal caresocial welfaregeriatric carePennsylvania Hospitalcommunity clinic https://avgeeks.videonest.co/videos/1460804/missouri-a-living-portrait-1974 https://img.videonest.org/gamma/1460804_thumbnail_resized_v2.webp https://gamma.videonest.org/1460804_video_v4.mp4 Missouri: a living portrait. (1974) "Missouri: A Living Portrait" explores the diverse and rich landscape, history, and culture of Missouri. Through the eyes of artist Thomas Hart Benton, it captures the essence of the state, highlighting its natural beauty, historical significance, and vibrant communities. The narrative emphasizes Missouri's evolving identity, from its rolling hills and rivers to its agricultural roots and cultural celebrations, inviting viewers to appreciate its unique charm. #Missouri #Travel #Art Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-29T16:00:09.000Z yes A/V Geeks 16mm Films no 1722 MissouriThomas Hart BentonMissouri RiverOzark hillsHistorical landmarksNatural beautyTourismHarry S. TrumanMark TwainBaseballFishingHuntingOutdoor RecreationMissouri RiversState Parks https://avgeeks.videonest.co/videos/1460805/av-geeks-16mm-lunch-10-28-2025 https://img.videonest.org/gamma/1460805_thumbnail_resized_v2.webp https://gamma.videonest.org/1460805_video_v5_360.mp4 AV Geeks 16mm Lunch 10-28-2025 Cold and rainy outside? Check! Warm and 16mm-y inside? Check! #avgeeks #16mmfilms Taking a Walk (Eastern European?) Howard Emotional Health 2025-10-29T06:17:58.000Z yes A/V Geeks 16mm Films no 4170 16mm filmvintage filmchildhoodfamilyemotional healthmental healththerapychildrenEastern Europefriendshipgenerational differencesanxietypsychiatristNational Film BoardA/V Geeks https://avgeeks.videonest.co/videos/1460806/variations-on-a-theme-1960s https://img.videonest.org/gamma/1460806_thumbnail_resized_v2.webp https://gamma.videonest.org/1460806_video_v4.mp4 Variations on A Theme (1960s) Discusses the planning of a store's 20th anniversary sale, focusing on the importance of promotions and themes to attract customers. The team debates the timing and theme for the event, eventually settling on a "then and now" concept that highlights the store's history. They emphasize the significance of effective advertising and the need for creativity, even in small businesses, to engage customers and drive sales. The planning process involves selecting items for sale, designing advertisements, and ensuring team collaboration for a successful event. #StorePromotion #AnniversarySale #AdvertisingStrategy Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-29T04:00:39.000Z yes A/V Geeks 16mm Films no 818 marketing strategysales promotionsmall businessthen and now themeadvertising designmarketingstore promotionvintage advertisementthen and nowanniversary celebrationretail promotionCalvin-DeFrenes Production https://avgeeks.videonest.co/videos/1460807/there-will-be-a-slight-delay-1971 https://img.videonest.org/gamma/1460807_thumbnail_resized_v2.webp https://gamma.videonest.org/1460807_video_v4.mp4 There Will Be A Slight Delay (1971) This mid-century policy documentary argues that America’s mounting “slight delays” are symptoms of systemic transportation bottlenecks—physical, financial, and political—across highways, airports, rail, and urban transit. Experts praise the Interstate program but warn it’s unfinished and can’t carry most traffic; neglected “ABC” roads need upgrades, and user-tax trust funds shouldn’t be raided. In aviation, access roads, terminal processing, and ground capacity lag even as jumbo jets boost passenger volumes; more and better-designed airports and people-mover links are urged. Rail passenger service has withered, prompting a limited national takeover and calls for modern equipment and high-speed corridors, while cities face spreading rush-hour peaks that only robust mass transit—BART-style metros, exclusive bus lanes, park-and-ride—can relieve. The film champions a “systems approach” that coordinates all modes and their interfaces, doubles effective capacity without doubling concrete, and aligns federal, state, and local planning. Financing should blend carrier tariffs, user charges, and, realistically, subsidies for transit, given wider benefits like jobs and property values. The takeaway: it will cost less to fix the network now than to endure worsening congestion, and personal mobility will improve only when the whole system works for everyone. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-28T22:00:33.000Z yes A/V Geeks 16mm Films no 1734 traffic congestiontransportationhighwayairportrailroadurban planningmass transitdelaysbottleneckshighway trust fundcommutingInterstate Systempublic transportationtransportation policytraffic jams https://avgeeks.videonest.co/videos/1460808/the-meadville-patriots-1943 https://img.videonest.org/gamma/1460808_thumbnail_resized_v2.webp https://gamma.videonest.org/1460808_video_v4.mp4 The Meadville Patriots. (1943) This mid-century educational drama follows Jim Anderson, a young newspaper editor who takes over The Patriot in the small town of Meadville and soon clashes with the local Prohibition League led by the self-righteous Mrs. Cochro. When Anderson refuses to let the paper become a mouthpiece for the League’s crusade against alcohol, tension grows between him and his future wife Ellen, who, haunted by her alcoholic father, initially supports the temperance cause. Through personal tragedy, community pressure, and an investigation exposing corruption and crime bred by “dry laws,” Anderson argues that prohibition destroys freedom, breeds hypocrisy, and fuels bootlegging. In the end, after Ellen’s near-fatal childbirth and the collapse of the League’s moral authority, Mrs. Cochro humbly apologizes, realizing that true reform requires tolerance, compassion, and respect for individual liberty rather than coercion. The film serves as a passionate post-Prohibition defense of moderation and democratic choice. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-28T16:00:21.000Z yes A/V Geeks 16mm Films no 2374 Meadville PatriotprohibitiontemperanceJim AndersonEllen MacDonaldalcoholismbootleggersnewspaper editor1930s Americadry law violationsalcohollocal politicssocial newshospitalTolerance https://avgeeks.videonest.co/videos/1460809/yankee-clipper-television-commercial-1970 https://img.videonest.org/gamma/1460809_thumbnail_resized_v2.webp https://gamma.videonest.org/1460809_video_v4_360.mp4 [Yankee Clipper--television commercial, 1970]. This short 1970s-style television commercial for "Yankee Clipper Seafood" features a jovial spokesman dressed as a ship’s captain inviting viewers into the restaurant’s “seafood galley” for freshly cooked fish and chips, shrimp, clams, and oysters. Speaking directly to the camera, the “Skipper” promises quality, value, and friendly service—whether customers dine in or take their meals home. The spot ends with the catchy jingle, "Yankee Clipper Seafood — for a great catch,” reinforcing the nautical theme and framing the chain as a fun, family-friendly place for affordable seafood. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-28T04:00:43.000Z yes A/V Geeks 16mm Films no 72 Yankee ClipperSeafoodTelevision Commercial1970sFish and ChipsRestaurantJingleVintage Commercial https://avgeeks.videonest.co/videos/1460810/you-and-me-and-the-sst-1969 https://img.videonest.org/gamma/1460810_thumbnail_resized_v2.webp https://gamma.videonest.org/1460810_video_v4_360.mp4 You And Me And The SST (1969) A late-1960s promotional film narrated by journalist Bob Considine that argues passionately for building an American supersonic transport to rival the British-French Concorde and the Soviet TU-144. Mixing patriotic fervor with economic reasoning, the film presents the SST as both a technological triumph and a national investment—one that would create tens of thousands of jobs, strengthen exports, and preserve U.S. leadership in aviation. It highlights the Boeing-led design, General Electric’s powerful engines, and the participation of subcontractors like Avco, Fairchild Hiller, and LTV, framing the project as an all-American industrial effort. With dramatic music, futuristic imagery, and Cold War rhetoric about prestige and progress, the film insists that developing the SST is not only inevitable but essential for maintaining America’s role at the forefront of global air travel. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-27T22:00:53.000Z yes A/V Geeks 16mm Films no 772 supersonic transportSSTBoeingAmerican SSTaviation historyaerospace technologycommercial aviationjet engineeconomic impactaircraft constructionaviation technologyair travelBoeing 747aerospace industrysonic boom https://avgeeks.videonest.co/videos/1460811/av-geeks-16mm-lunch-10-27-2025 https://img.videonest.org/gamma/1460811_thumbnail_resized_v2.webp https://gamma.videonest.org/1460811_video_v5_360.mp4 AV Geeks 16mm Lunch 10-27-2025 A quick visit to Hendersonville, NC and who did we see? #avgeeks #16mmfilms Home Movies Hendersonville Apple Festival Canaries Are Fun Proof Is Everywhere Kimono Daily Double 2025-10-27T17:00:06.000Z yes A/V Geeks 16mm Films no 4060 16mm filmvintage filmhome movieparadekimonovintage advertisementcanarieswineJapanese cultureAC spark plugsfamily gatheringapple festivaltraditional clothingwine and foodeducational film https://avgeeks.videonest.co/videos/1460812/halloween-safety-1977 https://img.videonest.org/gamma/1460812_thumbnail_resized_v2.webp https://gamma.videonest.org/1460812_video_v4_360.mp4 Halloween Safety (1977) The film "Halloween Safety" (1977) emphasizes the importance of safety during Halloween. It highlights the dangers of costumes, such as poor visibility and tripping hazards, and suggests making costumes safer by shortening skirts, using reflective materials, and avoiding masks. The video advises trick-or-treaters to eat a full meal before going out, carry flashlights, stay in groups, and stick to familiar neighborhoods. It also recommends checking treats for safety before consuming them and encourages fun, harmless jokes while avoiding dangerous pranks. keyword #HalloweenSafety #CostumeSafety #TrickOrTreating Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-27T16:26:09.000Z yes A/V Geeks 16mm Films no 665 Halloween safetySafety tipsTrick-or-treatCostume safetyChild safetyReflective tapeCostume DIYTrick Or TreatChildrens SafetyParenting TipsCandy InspectionHalloween CostumeHalloweenTrick-or-treatingcostumes https://avgeeks.videonest.co/videos/1460813/thinking-of-you-1965 https://img.videonest.org/gamma/1460813_thumbnail_resized_v2.webp https://gamma.videonest.org/1460813_video_v4_360.mp4 Thinking Of You (1965) A Hallmark industrial film that promotes the company as both a cultural institution and a model of tasteful modern business. It traces how greeting cards evolved into a popular folk art, showing Hallmark artists designing cards that express emotion through artful typography and illustration, then broadens into a portrait of a corporation grounded in quality, innovation, and refinement. Scenes highlight Hallmark’s pioneering computer-based inventory system, its expansion into gift products, and its international reach, while celebrating its cultural sponsorships like the Hallmark Hall of Fame television series and New York’s Hallmark Gallery. The film doubles as a recruitment piece, extolling employee benefits, creative opportunities, and the elegant Kansas City headquarters, concluding with the familiar slogan—“When you care enough to send the very best”—as both corporate philosophy and expression of mid-century American taste. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-27T16:00:48.000Z yes A/V Geeks 16mm Films no 915 Hallmark Cardsgreeting cardscard designKansas Citycorporate cultureproduct qualityinventory systemdata processinggift wrappingartistic designFortune magazineHall of Famemuseumsgood tastegraphic design https://avgeeks.videonest.co/videos/1460814/promises-to-keep-1966 https://img.videonest.org/gamma/1460814_thumbnail_resized_v2.webp https://gamma.videonest.org/1460814_video_v4.mp4 Promises To Keep (1966) This mid-1960s promotional documentary frames the Mid-America “heartland” as prosperous in agriculture yet lagging in education, then introduces a federally backed solution: the Midcontinent Regional Educational Laboratory (McREL), created under Title IV of the 1965 Elementary and Secondary Education Act. Using the farm extension model as its template, the film outlines a two-way communications network of 16 area service centers (anchored in Kansas City, Missouri) to link rural, urban, public, private, and parochial schools across parts of Kansas, Oklahoma, Nebraska, and Missouri with the latest research and practices. It promises coordinated support for teacher preparation and placement, evaluation, reading and math instruction, neighborhood engagement, and hands-on trials of new instructional technologies via experimental classrooms. Through testimonials and scenes of meetings and classrooms, the film argues that voluntary, cooperative adoption of proven innovations will narrow regional disparities and keep talented youth rooted at home—fulfilling America’s “promises to keep” by making the Midcontinent a national model of educational excellence. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-27T04:00:39.000Z yes A/V Geeks 16mm Films no 843 EducationAgriculturalFarmingRural AmericaMid-continent RegionEducational laboratoryMid-continentKansas City Missouriregional educationeducation innovationEducation laboratoryEducational innovationAgricultural researchSchool officialFarm productivity https://avgeeks.videonest.co/videos/1460815/montana-coal-1976 https://img.videonest.org/gamma/1460815_thumbnail_resized_v2.webp https://gamma.videonest.org/1460815_video_v4.mp4 Montana coal. (1976) This industry-backed, early-energy-crisis documentary argues that America faces looming oil and gas shortages and should bridge the gap by rapidly expanding Montana’s abundant sub-bituminous coal. After dismissing blackout “scare tactics,” it frames coal as the only immediately scalable option while alternatives (solar, geothermal, fusion) mature, citing vast reserves (hundreds of billions of tons), surface-mining efficiency, and a step-by-step portrayal of modern strip-mine methods, preparation plants, and high-capacity draglines. The film touts jobs, tax revenue, and “model” mining towns, spotlights multiple operating mines and their payrolls, and devotes substantial time to reclamation—before/after range shots, university and Forest Service seed-mix trials, wildlife returns—claiming restored lands often outproduce native range. It warns that regulation, high taxes, and permitting delays make Montana coal noncompetitive, locking in decades of lost sales as utilities source elsewhere, and concludes with a call for “sound resource management” and accelerated development: “Mine Montana coal. It makes sense.” Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-26T22:00:14.000Z yes A/V Geeks 16mm Films no 1219 Montana CoalEnergy CrisisCoal ReservesSurface miningLand ReclamationCoal MiningEconomic ImpactEnvironmental ReclamationMining EquipmentMining OperationRangeland ImprovementMontana State UniversityDecker Coal CompanyWestern EnergyPeabody Coal Company https://avgeeks.videonest.co/videos/1460816/missouri-accent-on-action-1968 https://img.videonest.org/gamma/1460816_thumbnail_resized_v2.webp https://gamma.videonest.org/1460816_video_v4.mp4 Missouri: accent on action. (1968) This mid-century travel promotion film invites viewers to “follow that camper” into the warm, friendly vacation playgrounds of Missouri. Combining lush color imagery, energetic narration, and sweeping music, it presents the state as a place where natural beauty and modern leisure meet. Missouri is shown as both down-to-earth and elegant—offering lake resorts, houseboat living, horseback riding, rockhounding for the state gem “mozarkite,” and hiking through unspoiled hills. Water recreation dominates the film, with scenes of swimming, fishing, diving, canoeing, and sailing, all framed as rejuvenating escapes from city life. The film also highlights the state’s culture and hospitality—fine dining, theater, and the pageantry of local traditions—while maintaining a tone of constant motion and variety. It concludes that Missouri offers “vacation action” for everyone, from campers to the jet set, in “the state with the action accent.” Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-26T16:01:18.000Z yes A/V Geeks 16mm Films no 842 Missouritourismcampinghouseboatwater skiingrock huntingOzarksMissouri Tourism Commissionhorseback ridingscuba divingpaddle wheel steamerfishingCanoeingSailingRiver Tourism https://avgeeks.videonest.co/videos/1460817/a-short-walk-to-trumbull-street-1970 https://img.videonest.org/gamma/1460817_thumbnail_resized_v2.webp https://gamma.videonest.org/1460817_video_v4.mp4 A short walk to Trumbull Street. (1970) This early-1970s promotional film celebrates the planned Hartford Civic Center as the key to downtown renewal and urban optimism. It opens with snippets of local radio DJs, music, and call-in contests that capture the city’s daily energy before shifting to a narrated vision of progress. The film describes the Civic Center—bounded by Church, Asylum, Ann, and Trumbull Streets—as a “city within a city,” featuring a 10,000-seat arena, exhibition hall, mall, public commons, and 23-story office tower, all designed for around-the-clock pedestrian life. Blending documentary imagery, upbeat music, and confident narration, it promises economic growth, new jobs, and increased tax revenue while promoting a walkable, people-oriented downtown linked by elevated walkways and transit. The film concludes with the assurance that the project will “attract everybody, involve everybody, and benefit everybody,” embodying the era’s faith in urban redevelopment and civic unity. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-26T04:00:35.000Z yes A/V Geeks 16mm Films no 804 Hartford Civic Centerurban planningcity planningarchitectureurban redevelopmentHartfordpedestrian environmentcity streetsconstructionmusicurbanCivic Centerhockey gamebasketball gameVincent G. Kling https://avgeeks.videonest.co/videos/1460818/periodic-functions-1944 https://img.videonest.org/gamma/1460818_thumbnail_resized_v2.webp https://gamma.videonest.org/1460818_video_v4.mp4 Periodic Functions (1944) Discusses the concept of periodic functions and their application in understanding the behavior of electric generators. It demonstrates how generators produce sine waves, explains the relationship between voltage and frequency, and illustrates how phase differences between generators can affect the resultant voltage. The presenter emphasizes that these phenomena are rooted in scientific principles rather than magic. Keywords periodic functions, sine wave, electric generator, voltage, frequency, phase angle, oscilloscope, scientific principles, mathematics, demonstration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-25T22:01:06.000Z yes A/V Geeks 16mm Films no 1037 periodic functionssine waveelectric generatorvoltagefrequencyphase angleoscilloscopeUS Navytraining filmgenerator voltagesine waveselectrical engineeringunit circlerotating vectoramplitude https://avgeeks.videonest.co/videos/1460819/desert-nomads-french-morocco-1949 https://img.videonest.org/gamma/1460819_thumbnail_resized_v2.webp https://gamma.videonest.org/1460819_video_v4.mp4 Desert Nomads: French Morocco (1949) Describes the life of nomadic families living in the Sahara Desert, particularly in Morocco near the Atlas Mountains. These families raise and sell camels, which are crucial for their survival in the harsh climate. They rely on scarce water sources, graze their animals, and move frequently to find food. Their diet consists mainly of camel and goat milk, barley, and occasionally meat. The community is structured around tribal leadership, and they maintain traditions such as prayer and communal meals. The nomads also engage in trade at a nearby city, Glamin, where they sell camels and buy essential supplies. Keywords Sahara Desert, nomads, Morocco, camels, Berbers, trade, water scarcity, tribal life, grazing, couscous Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-25T16:00:37.000Z yes A/V Geeks 16mm Films no 1277 desert nomadBerber tribecamelsSahara DesertMorocconomadic lifeAtlas Mountainstradecamel milkcouscousGlimincamel marketBerber womentradingnomadic families https://avgeeks.videonest.co/videos/1460820/life-with-baby-1956 https://img.videonest.org/gamma/1460820_thumbnail_resized_v2.webp https://gamma.videonest.org/1460820_video_v4.mp4 Life With Baby (1956) Discusses the significant increase in birth rates in America during wartime and highlights the importance of understanding child development. It emphasizes the need for regular mental and physical checkups for children, as established by Yale University's clinic of child development. Dr. Arnold Gassel's research identifies 34 progressive stages of mental growth in children, providing benchmarks for parents and healthcare professionals to assess child development. The video illustrates various stages of physical and cognitive development from infancy to age five, stressing that each child develops at their own pace and that parents should adopt an informed and understanding approach to their children's behavior. keyword child development, parenting, mental growth, physical growth, child behavior, pediatric care, Yale University, Dr. Arnold Gassel, developmental stages, early childhood education Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-25T04:00:40.000Z yes A/V Geeks 16mm Films no 1124 Life With Babychild developmentArnold GesellGesell Developmental SchedulesParentinginfant behaviorchild psychologyhand-eye coordinationobject manipulationadaptive skillsinfant milestonestoy testblock testparenting skillschild behavior https://avgeeks.videonest.co/videos/1460821/ancient-america-speaks-1972 https://img.videonest.org/gamma/1460821_thumbnail_resized_v2.webp https://gamma.videonest.org/1460821_video_v4.mp4 Ancient America Speaks (1972) Discusses the ancient civilizations of Central and South America, particularly the Maya, Aztec, and Incan cultures, highlighting their impressive achievements in architecture, religion, and society. It explores the mysterious origins and decline of these cultures, the significance of the deity Kettzel Kawat, and the parallels between their beliefs and those in the Old World. The narrative also connects these ancient peoples to the Book of Mormon, suggesting similarities in their histories and teachings. The speaker emphasizes the advanced nature of these civilizations and encourages readers to seek personal understanding of the truths presented in the Book of Mormon. Keywords ancient civilizations, Maya, Aztec, Inca, Kettzel Kawat, Book of Mormon, architecture, religion, history, cultural exchange Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-24T22:00:51.000Z yes A/V Geeks 16mm Films no 1428 ancient civilizationsMayaAztecIncaMesoamericaCentral AmericaSouth Americamayan cultureaztec culturequetzalcoatlMachu PicchuInca EmpireBook of MormonPre-Columbian culturesgold artifacts https://avgeeks.videonest.co/videos/1460822/av-geeks-16mm-lunch-10-24-2025 https://img.videonest.org/gamma/1460822_thumbnail_resized_v2.webp https://gamma.videonest.org/1460822_video_v5_360.mp4 AV Geeks 16mm Lunch 10-24-2025 It's a Friday where you take time out and watch some old 16mm films! #avgeeks #16mmfilms Science News Vol 1 All Aboard For California The Carters Meet The Computer 2025-10-24T17:00:06.000Z yes A/V Geeks 16mm Films no 4054 16mm filmA/V GeeksScience Newsatom bombnuclear testingHollywoodLos AngelesUniversal Studiosemploymentjob searchmodel railroadatomic energynewsreelCaliforniaQueen Mary https://avgeeks.videonest.co/videos/1460823/men-encounter-mars-1965 https://img.videonest.org/gamma/1460823_thumbnail_resized_v2.webp https://gamma.videonest.org/1460823_video_v4_360.mp4 Men Encounter Mars (1965) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The segment showcases the ambitious dream of space exploration and the dedicated team at NASA's Jet Propulsion Laboratory, who are working tirelessly to achieve a historic encounter with Mars. As the Mariner team navigates challenges such as delayed commands and potential data loss, scientists prepare to study the Martian atmosphere, radiation, and surface features. The buildup to the spacecraft's close approach is filled with anticipation, as team members reflect on the mysteries of the planet. As the Mariner 4 spacecraft nears Mars, the mission team on Earth sends critical commands to ensure the camera and experiments operate correctly for this singular opportunity. After a long period of waiting, initial concerns about the spacecraft’s performance subside as the first images from Mars begin to arrive, revealing the planet's surface in unprecedented detail. The historic close-up photographs taken by the Mariner 4 mission are highlighted, emphasizing their scientific significance and the challenges faced in early image processing, marking a monumental achievement in our understanding of Mars. #MarsExploration #NASA #Mariner4 #SpaceScience #HistoricImages 2025-10-24T16:01:43.000Z yes A/V Geeks 16mm Films no 1708 NASAMariner 4Mars MissionSpace ExplorationJet Propulsion LaboratorySpacecraftMarsRobert LeightonBruce MurrayDan SchneidermanWilliam PickeringMariner spacecraftMars imagestelemetryimage processing https://avgeeks.videonest.co/videos/1460824/international-conference-reel-2-1969 https://img.videonest.org/gamma/1460824_thumbnail_resized_v2.webp https://gamma.videonest.org/1460824_video_v4_360.mp4 International Conference (reel 2 1969) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Showcases the diverse lives of African Americans, highlighting their contributions in various fields such as medicine, agriculture, journalism, and social work. It emphasizes the ongoing challenges of segregation and its impact on self-esteem and opportunities. Families are depicted celebrating Thanksgiving, reflecting on traditions and the importance of gratitude. The video also features discussions among young activists addressing the need for change and their willingness to protest against segregation. Keywords African American, segregation, Thanksgiving, activism, community, professions, diversity, family, social justice, history 2025-10-24T16:01:05.000Z yes A/V Geeks 16mm Films no 674 March on WashingtonCivil RightsCivil Rights MovementActivismLincoln MemorialJoan BaezOdettaJobs and FreedomEqual RightsMarian AndersonMahalia JacksonNational MallWashington D.C.PerformingGospel Music https://avgeeks.videonest.co/videos/1460825/av-geeks-16mm-lunch-10-23-2025 https://img.videonest.org/gamma/1460825_thumbnail_resized_v2.webp https://gamma.videonest.org/1460825_video_v5_360.mp4 AV Geeks 16mm Lunch 10-23-2025 Leaves are falling but the stacks of 16mm films are still standing! Watch and find out! #avgeeks #16mmfilms Kundah Dam (silent) How the Eye Functions If The Mail Stopped Ancient America Speaks 2025-10-24T06:12:33.000Z yes A/V Geeks 16mm Films no 4094 16mm filmKundah Damdam constructioneye anatomyUS Postal Serviceancient americamayan ruinsInca civilizationmail systemvintage filmaerial footageretinapost officearchaeologyreligious practices https://avgeeks.videonest.co/videos/1460826/what-is-a-mountain-1967 https://img.videonest.org/gamma/1460826_thumbnail_resized_v2.webp https://gamma.videonest.org/1460826_video_v4_360.mp4 What is a Mountain? (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This segment delves into the multifaceted nature of mountains, particularly focusing on Mount Rainier. It begins with an exploration of the mountain's diverse physical characteristics and the life it supports, including its geological formations, weather phenomena, and vibrant ecosystems. The historical journey of Mount Rainier is traced from its naming by Captain George Vancouver to its earlier indigenous name, shedding light on the geological forces that shaped it. The narrative continues with a detailed account of Mount Rainier's geological history, illustrating its volcanic origins and the sculpted landscape that draws early explorers eager to study its wilderness. The rich plant life on the mountain is highlighted, showcasing towering trees and vibrant wildflowers, alongside an early botanist's expedition that contributed to our understanding of this unique ecosystem. The adventurous spirit of climbers is celebrated through recounting early attempts to summit Mount Rainier, emphasizing both the thrill of exploration and the scientific endeavors aimed at understanding the mountain's features. The history of early explorers and settlers culminates in the establishment of Mount Rainier as a national park, framing the importance of preservation for future generations. The segment transitions into a philosophical discussion about the concept of heat, connecting it to the broader nature of mountains. This thought-provoking exploration ends on a reflective note, inviting viewers to consider the complex relationship between humanity and these majestic natural formations. #Mount Rainier #Geological History #Mountain Ecosystems #Climbing Adventures #Nature Preservation 2025-10-24T04:01:06.000Z yes A/V Geeks 16mm Films no 1384 Mount RainiervolcanoglacierNational ParkMountain climbingGlaciersPacific NorthwestTahomaRock formationsErosionMountain MeadowsPreservationAlpine flowersbotanical explorationGeorge Vancouver https://avgeeks.videonest.co/videos/1460827/gateway-to-health-1953 https://img.videonest.org/gamma/1460827_thumbnail_resized_v2.webp https://gamma.videonest.org/1460827_video_v4_360.mp4 Gateway To Health (1953) Dr. Fred D. Miller, a dentist from Pennsylvania, emphasizes the importance of dental health through proper nutrition and eating habits. He shares success stories of his patients, particularly children, who have achieved excellent dental health by avoiding sugary foods and prioritizing nutritious options. The video highlights that tooth decay is largely preventable and stresses the significance of a balanced diet, the order of food consumption, and regular dental care. Miller encourages viewers to adopt healthier eating practices to maintain strong, cavity-free teeth. Keywords dental health, nutrition, tooth decay, prevention, healthy eating, dentist, children’s health, oral hygiene, fruits and vegetables, dental care Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-23T22:01:00.000Z yes A/V Geeks 16mm Films no 1069 dental healthtooth decayFred D Milleroral hygienepreventive dentistrydental carehealthy teethbalanced dieteating habitstime lapsetooth enamelfruitsvegetablesfood habitspositive health https://avgeeks.videonest.co/videos/1460828/junior-prom-1946 https://img.videonest.org/gamma/1460828_thumbnail_resized_v2.webp https://gamma.videonest.org/1460828_video_v4.mp4 Junior Prom (1946) Discusses the etiquette of dating, focusing on a group of students preparing for the junior prom. It highlights the importance of manners, appropriate dress, and communication in making social interactions enjoyable. The narrative follows Frank, Jerry, Margaret, and Helen as they navigate dating customs, including asking for dates, selecting corsages, and meeting parents. The video emphasizes that good manners enhance social experiences and that learning proper etiquette can lead to more enjoyable interactions. Keywords dating, etiquette, junior prom, manners, corsage, dress code, social interactions, communication, relationships, high school Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-23T22:00:31.000Z yes A/V Geeks 16mm Films no 1233 dating etiquettejunior promhigh school1940ssocial skillsmannersdress codedatingsocial gracesdance etiquettedating advicecommunication skillsvintage filmmeeting parentsgift giving https://avgeeks.videonest.co/videos/1460829/the-shape-of-a-leaf-1967 https://img.videonest.org/gamma/1460829_thumbnail_resized_v2.webp https://gamma.videonest.org/1460829_video_v4.mp4 The Shape of a Leaf (1967) The film discusses children's engagement in art, focusing on their exploration of shapes, colors, and creativity through the example of leaves. It highlights their learning process in identifying different leaves and expressing their unique perceptions through art. The children use various techniques and materials to create their artwork, demonstrating personal growth and creativity. The narrative emphasizes the importance of artistic expression and the joy that comes from creating and sharing their work. Keywords art, children, creativity, leaves, expression, perception, colors, learning, techniques, personal growth Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-23T16:00:25.000Z yes A/V Geeks 16mm Films no 1757 LeavesArt LessonChildrenPotteryWeavingWood Carvingpuppet showpuppet makingpaper macheChristmas CarolChristmas puppetNativityArt processcraftsarts https://avgeeks.videonest.co/videos/1460830/av-geeks-16mm-lunch-10-22-2025 https://img.videonest.org/gamma/1460830_thumbnail_resized_v2.webp https://gamma.videonest.org/1460830_video_v5_360.mp4 AV Geeks 16mm Lunch 10-22-2025 It's about time for you to join us again and watch some classic old 16mm films! #avgeeks #16mmfilms Home Movie Waterfowl (silent) Flow of Electricity Search for Happiness Over-Dependency 2025-10-22T21:23:01.000Z yes A/V Geeks 16mm Films no 4478 16mm filmfilm reelswaterfowlelectricityflow of electronsSearch for Happinessmental healthover-dependencyblack and white filmvintage filmhome movieselectric celleducational filmfamily relationshipstherapy https://avgeeks.videonest.co/videos/1460831/the-very-idea-1954 https://img.videonest.org/gamma/1460831_thumbnail_resized_v2.webp https://gamma.videonest.org/1460831_video_v4.mp4 The Very Idea (1954) About a couple, Jane and George, who live in a house built by George's Uncle Henry. While Jane appreciates the sentimental value of the old house and its furnishings, she becomes frustrated with the outdated kitchen and bathroom. After a series of discussions about renovations, Jane decides to take action and consults a plumber, Ben Crawford, for modern ideas. With Ben's expertise, they successfully remodel their kitchen and bathroom, transforming them into functional and aesthetically pleasing spaces while navigating the sentimental attachments to Uncle Henry's handiwork. Keywords haunted house, home renovation, plumbing, kitchen remodel, bathroom remodel, family legacy, home improvement, DIY, expert advice, sentimental value Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-22T16:01:44.000Z yes A/V Geeks 16mm Films no 1341 Crane Co.Crane plumbingkitchen renovationbathroom remodelhome improvementplumbing ideasvintage homeBen Crawfordplumbingkitchen remodelingbathroom remodelinghome designinterior design1950s https://avgeeks.videonest.co/videos/1460832/av-geeks-16mm-lunch-10-21-2025 https://i.ytimg.com/vi/TXSdp2QFsR0/maxresdefault.jpg https://gamma.videonest.org/1460832_video_v5_360.mp4 AV Geeks 16mm Lunch 10-21-2025 16mm isn't just the width of the film. It's a life choice! #avgeeks #16mmfilms Wing Walkers (silent) Barry Goldwater Speaks Out Driving Tips To Avoid Accidents Farm Work Equipment - No 6 Care of a Tractor 2025-10-22T06:17:31.000Z yes A/V Geeks 16mm Films no 4107 https://avgeeks.videonest.co/videos/1460833/the-magna-carta-part-1-1959 https://img.videonest.org/gamma/1460833_thumbnail_resized_v2.webp https://gamma.videonest.org/1460833_video_v4.mp4 The Magna Carta, Part 1 (1959) Discusses the historical context leading to the creation of the Magna Carta in 1215, detailing the evolution of power dynamics in England from the Norman Conquest in 1066 through the reigns of various kings. It highlights the transition from feudalism to a more centralized royal authority, the introduction of systematic taxation by Henry I, and the conflicts between the monarchy and the barons, culminating in King John's reign, which prompted the drafting of the Magna Carta as a means to address grievances and establish rights. Keywords Magna Carta, feudalism, King John, Henry I, Norman Conquest, taxation, barons, English history, civil war, rights and liberties 2025-10-22T04:01:16.000Z yes A/V Geeks 16mm Films no 970 Magna CartaKing JohnEnglish historyFeudalismNorman ConquestHenry ITaxationBaronsEnglish MonarchyWilliam the ConquerorEnglandCivil WarRights and LibertiesKingdomHistorical Events https://avgeeks.videonest.co/videos/1460834/unknown-spectrography-film https://img.videonest.org/gamma/1460834_thumbnail_resized_v2.webp https://gamma.videonest.org/1460834_video_v4.mp4 [Unknown Spectrography film] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the fascinating world of spectrography, detailing its evolution and function in capturing and analyzing light spectra for scientific applications. It delves into the phenomenon of line spectra, explaining how the behavior of excited electrons in atoms results in characteristic lines within a spectrum. Different types of spectra are covered, including band, continuous, and absorption spectra, each providing unique insights based on their formation processes. The film also highlights various spectroscopic methods, such as flame, arc, spark, and absorption spectroscopy, detailing their applications and how they measure different material properties. Practical demonstrations illustrate the use of spectrographic analysis for rapid composition verification in foundries and for detailed soil analysis in biological research. Additionally, the film showcases the application of spectrography in criminal investigations to identify minute traces of evidence and in astronomy for analyzing celestial bodies, emphasizing its importance across diverse scientific fields. 2025-10-22T04:00:00.000Z yes A/V Geeks 16mm Films no 1278 spectrographline spectrumabsorption spectrumemission spectrumFraunhofer linessoil analysiscriminal investigationsolar spectrumDoppler Effectstars compositionwavelengthultra violetband spectrumcontinuous spectrumalloy analysis https://avgeeks.videonest.co/videos/1460835/the-frustrating-fours-and-fascinating-fives-1953 https://img.videonest.org/gamma/1460835_thumbnail_resized_v2.webp https://gamma.videonest.org/1460835_video_v4.mp4 The Frustrating Fours and Fascinating Fives (1953) Explores the developmental changes and challenges faced by children aged four and five, focusing on a boy named Rody. At four, Rody exhibits frustrating behaviors such as inconsistency, inattention, and difficulty following rules, while also showing bursts of creativity and energy. His interactions with family members highlight the struggles parents face in guiding their children through this stage. As Rody transitions to five, he becomes more independent, capable of entertaining himself, and begins to engage in more structured learning. The video emphasizes the importance of patience, encouragement, and understanding in nurturing a child's growth during these formative years. Keywords child development, four-year-olds, five-year-olds, parenting, independence, creativity, behavior challenges, learning, social skills, imaginative play 2025-10-21T22:00:38.000Z yes A/V Geeks 16mm Films no 1305 child developmentfour-year-oldfive-year-oldsparentingearly educationimaginative playteaching methodsfamily lifechildren growingboypreschool activitiesearly childhood educationnursery schoolchildrenindependence https://avgeeks.videonest.co/videos/1460836/trick-or-treat-1969 https://img.videonest.org/gamma/1460836_thumbnail_resized_v2.webp https://gamma.videonest.org/1460836_video_v4.mp4 Trick or Treat (1969) Depicts a Halloween night where a group of children, including Pete and Sandy, engage in trick-or-treating while navigating the rules set by Pete's father to avoid trouble. As they collect candy, they encounter various reactions from adults, ranging from generosity to hostility. The narrative takes a turn when they discuss a boy named Ronnie Heights, who gets into serious trouble after a prank involving tying a trailer to a car, resulting in property damage and injury. The children grapple with their involvement in the incident, debating the ethics of their actions and the consequences faced by Ronnie, ultimately reflecting on the implications of their choices and the importance of accountability. 2025-10-21T20:43:43.000Z yes A/V Geeks 16mm Films no 884 Trick Or TreatHalloweenHalloween CostumeHalloween prankspractical jokeprank consequencesproperty damagecriminal investigationchildren playingNeighborhood kidsneighborly relationsJelly BeansFudgeModel CarsModel Trucks https://avgeeks.videonest.co/videos/1460837/the-big-a-1970s https://img.videonest.org/gamma/1460837_thumbnail_resized_v2.webp https://gamma.videonest.org/1460837_video_v4.mp4 The Big A (1970s) Discusses the critical role that modern custom application services play in farming, emphasizing the importance of timely and efficient application of fertilizers and chemicals. It highlights the Big A high flotation applicator from Rickle Manufacturing, which has become the preferred choice for custom applicators due to its superior performance, reliability, and minimal soil compaction. Farmers report significant increases in productivity and profitability after adopting the Big A, which allows them to cover more acres in less time and with less fuel. The video also underscores the importance of excellent service and support from manufacturers in ensuring operational success. Keywords custom application, fertilizers, Big A, high flotation applicator, Rickle Manufacturing, farming efficiency, soil compaction, agricultural machinery, productivity, service support Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-21T16:00:04.000Z yes A/V Geeks 16mm Films no 713 Big A applicatorRickel Manufacturingfertilizer applicationchemical applicationfarm equipmentcustom applicatoragricultural machineryhigh flotationBig Afarming equipmentfarm businesscrop sprayingfertilizerpesticideagricultural business https://avgeeks.videonest.co/videos/1460838/av-geeks-16mm-lunch-10-20-2025 https://img.videonest.org/gamma/1460838_thumbnail_resized_v2.webp https://gamma.videonest.org/1460838_video_v5_360.mp4 AV Geeks 16mm Lunch 10-20-2025 Monday! Are you ready for even more 16mm films?!? #avgeeks #16mmfilms Mary's Little Lamb (silent) Spills and.. Sex-Role Development Nation's Mental Health 2025-10-21T08:26:24.000Z yes A/V Geeks 16mm Films no 4217 Mary's Little Lambanimated short filmvintage animationWinter Olympicsfigure skatingsex roleseducational filmgender rolesmental healthpsychiatryfilm projectorvintage footagesurfingHawaiiRichard Button https://avgeeks.videonest.co/videos/1460839/communication-the-non-verbal-agenda-1988 https://img.videonest.org/gamma/1460839_thumbnail_resized_v2.webp https://gamma.videonest.org/1460839_video_v4.mp4 Communication: The Non-verbal Agenda (1988) Discusses the significance of non-verbal communication in conveying messages beyond spoken words. It emphasizes that aspects like appearance, facial expressions, and body language play a crucial role in organizational communication, often overshadowing verbal interactions. The presentation highlights how misalignment between verbal and non-verbal cues can lead to confusion and reduced productivity. It encourages managers to be aware of their non-verbal messages and to foster a better understanding of the silent communication that occurs within the workplace. keywords non-verbal communication, workplace communication, body language, organizational behavior, employee productivity, communication skills, facial expressions, managerial communication, emotional intelligence, interpersonal relationships 2025-10-21T04:00:40.000Z yes A/V Geeks 16mm Films no 1260 Non-verbal communicationBody languageWorkplace DynamicsManagerial skillsOrganizational behaviorCommunication skillsOffice settingBusiness meetingEmployee MotivationPersonal spacePower dynamicsAmerican culturebusiness managementmanagement techniquesCRM Films https://avgeeks.videonest.co/videos/1460840/medieval-village-1940s https://img.videonest.org/gamma/1460840_thumbnail_resized_v2.webp https://gamma.videonest.org/1460840_video_v4.mp4 Medieval Village (1940s) Describes the historical and agricultural significance of Laxton, a village in central England, highlighting its enduring customs and practices that date back centuries. It discusses the village's resistance to economic change, the remnants of Laxton Castle, and the traditional farming methods still in use today, including a unique system of crop rotation and communal land management. The narrative emphasizes the importance of local governance through the manorial court, which oversees farming practices and maintains historical traditions. Keywords Laxton, medieval, England, agriculture, history, customs, manorial court, crop rotation, village life, community 2025-10-20T22:00:40.000Z yes A/V Geeks 16mm Films no 1146 Medieval VillageLaxtonEnglish VillageOpen Field SystemCrop RotationManorial CourtFarmingAgricultureVillage CustomsMedieval LifeRural HistoryFarm lifeLaxton Castletenant farmingSherwood Forest https://avgeeks.videonest.co/videos/1460841/the-unseen-power https://img.videonest.org/gamma/1460841_thumbnail_resized_v2.webp https://gamma.videonest.org/1460841_video_v4.mp4 The Unseen Power Reflects on the transformation of England from a pastoral landscape to an industrialized nation due to the discovery and use of coal and steam power. It discusses the impact of industrialization on society, including the growth of factories, slums, and the loss of natural beauty. The narrative highlights the potential of electricity as a new, cleaner power source that can revitalize the countryside and improve living conditions. It emphasizes the need for thoughtful urban planning and the importance of character in utilizing these advancements positively, with a spiritual component suggesting that true renewal comes from within. Keywords industrialization, electricity, coal, England, urban planning, transformation, spirituality, community, nature, progress Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-20T16:01:29.000Z yes A/V Geeks 16mm Films no 802 EnglandGreat BritainCoalSteam PowerIndustryindustrial agecoal powersteam powerhydroelectric powerurban slumsenvironmental impactelectricityWilliam BlakeJerusalem poemUnited World Films https://avgeeks.videonest.co/videos/1460842/golf-a-special-kind-of-joy-1975 https://img.videonest.org/gamma/1460842_thumbnail_resized_v2.webp https://gamma.videonest.org/1460842_video_v4.mp4 Golf - A Special Kind Of Joy (1975) Discusses the unique joys of golfing, emphasizing the thrill of playing, the beauty of the courses, and the camaraderie among players. It explains the mechanics of golf clubs, the importance of understanding one's swing, and the personal nature of each golfer's game. The video also covers the concept of par and handicaps, highlighting how these elements contribute to the competitive yet enjoyable nature of golf. Ultimately, it encourages golfers to embrace their journey, practice, and enjoy the game with friends. Keywords golf, joy, swing, clubs, par, handicap, competition, practice, courses, camaraderie 2025-10-20T04:00:30.000Z yes A/V Geeks 16mm Films no 976 golfgolfinggolf swinggolf clubsgolf courseparhandicappracticeNational Golf FoundationJim Thackergolf lessonsPinehurst Country Club https://avgeeks.videonest.co/videos/1460843/mainline-usa-1946 https://img.videonest.org/gamma/1460843_thumbnail_resized_v2.webp https://gamma.videonest.org/1460843_video_v4.mp4 Mainline, USA (1946) Discusses the vital role of railroads in America's economic development and prosperity. It highlights how railroads transformed the nation by providing essential transportation for agriculture, industry, and commerce. The narrative emphasizes the interconnectedness of railroads with various sectors and their contributions to American life, including job creation, community support, and ongoing investments in infrastructure and technology. Railroads are portrayed as a cornerstone of national progress, essential for both current and future economic growth. Keywords railroads, transportation, economic development, agriculture, industry, infrastructure, American history, prosperity, community, investment Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-19T22:01:15.000Z yes A/V Geeks 16mm Films no 878 RailroadsAmerican progresstransportationeconomic growthAmerican industryfreight transportationsteam trainslocomotivesAmerican railroadsrailroad industrytrain travelrailroad servicesiron orepassenger transportcoal transportation https://avgeeks.videonest.co/videos/1460844/the-days-work-1944 https://img.videonest.org/gamma/1460844_thumbnail_resized_v2.webp https://gamma.videonest.org/1460844_video_v4.mp4 The Day's Work (1944) Describes a day in the life of a carpenter and his son in Palestine 2,000 years ago. It details their morning routine, the craftsmanship involved in making wooden items, and interactions with customers. The narrative also highlights the daily life of other tradespeople, such as a potter and builders, and concludes with a family dinner and evening rituals, emphasizing the importance of work, family, and cultural traditions. Keywords carpenter, potter, tradespeople, daily life, craftsmanship, family, Palestine, historical, Jewish customs, storytelling Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-19T16:01:17.000Z yes A/V Geeks 16mm Films no 1121 Palestinecarpenterwoodworkingwooden yokedonkeyAncient Historyvillage workmenhouse constructionpotterydaily lifevillagesfamily supperJewish familyJudaismreligious films https://avgeeks.videonest.co/videos/1460845/christmas-bus-1972 https://img.videonest.org/gamma/1460845_thumbnail_resized_v2.webp https://gamma.videonest.org/1460845_video_v4.mp4 Christmas Bus (1972) "The Christmas Bus" is a short film produced by Family Films, Inc. in 1972. It runs for 20 minutes and is presented in color with sound. The film captures the interactions among passengers on a rapid transit bus during the bustling Christmas season. Amidst the commercial chaos typical of the holiday period, the film highlights how people connect with each other in genuine and human ways, showcasing moments of kindness and understanding. Through these interactions, the film emphasizes the spirit of community and compassion that can emerge even in the busiest of times. 2025-10-19T04:00:57.000Z yes A/V Geeks 16mm Films no 1268 christmascity busvintage buspublic transportationbus ridechristmas carolsholiday seasoncity nightChristmas seasonsalvation armyice skatingshoppingFamily FilmsNight busPassenger https://avgeeks.videonest.co/videos/1460846/steel-by-stopwatch-1960s https://img.videonest.org/gamma/1460846_thumbnail_resized_v2.webp https://gamma.videonest.org/1460846_video_v4.mp4 Steel By Stopwatch (1960s) Discusses the basic oxygen steel-making process, highlighting its efficiency and advancements over older methods. It details the operational steps involved in producing high-quality steel, including the materials required, the use of advanced technology for precise control, and the rapid production cycle of 230-ton heats. The video emphasizes the importance of engineering innovations that have made this process faster, safer, and more efficient, paving the way for future advancements in steel production. Keywords steel making, basic oxygen furnace, engineering, production process, efficiency, high-quality steel, technology, innovation, materials handling, refining Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-18T22:00:14.000Z yes A/V Geeks 16mm Films no 1427 steel productionbasic oxygen steelmakingsteelmakingBOF steelmakingbasic oxygen furnaceJones & Laughlinhot metaloxygen processmetallurgyfluxing materialsscrap metalJ&L Steelfurnace chargingsteel tapindustrial film https://avgeeks.videonest.co/videos/1460847/a-mystery-story-1981 https://img.videonest.org/gamma/1460847_thumbnail_resized_v2.webp https://gamma.videonest.org/1460847_video_v4.mp4 A Mystery Story (1981) Explores the life cycle of the anis swallowtail butterfly, detailing its transformation from egg to caterpillar, then to chrysalis, and finally into an adult butterfly. It highlights the caterpillar's growth, feeding habits, and survival mechanisms, including its camouflage and defense strategies. The narrative emphasizes the intricate planning in nature and invites reflection on the potential parallels between the butterfly's journey and human life, suggesting a divine plan for individuals. Keywords butterfly, caterpillar, chrysalis, life cycle, metamorphosis, nature, survival, camouflage, growth, transformation Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-18T16:00:58.000Z yes A/V Geeks 16mm Films no 551 Annis swallowtailButterflyInsectlife cyclecaterpillarchrysalismetamorphosisnaturecamouflagegrowthtransformationMoody InstituteMagnifying glassMoody Bible Institute https://avgeeks.videonest.co/videos/1460848/av-geeks-16mm-lunch-10-17-2025 https://img.videonest.org/gamma/1460848_thumbnail_resized_v2.webp https://gamma.videonest.org/1460848_video_v5_360.mp4 AV Geeks 16mm Lunch 10-17-2025 Such a nice crisp day to watch 16mm films.. outside?!? #avgeeks #16mmfilms Jobs for High School Graduation, no 14-24 (silent) Arthur Murray Cavalcade Isle of Mystery Consumer Reports presents: The Car Show 2025-10-18T06:26:42.000Z yes A/V Geeks 16mm Films no 4038 https://avgeeks.videonest.co/videos/1460849/something-in-common-1971 https://img.videonest.org/gamma/1460849_thumbnail_resized_v2.webp https://gamma.videonest.org/1460849_video_v4.mp4 Something In Common (1971) The film discusses mutual funds and their significance in financial planning, emphasizing the importance of diversification and professional management. It highlights the Investment Company Act of 1940, which established a framework for mutual funds, allowing average Americans to invest in a diversified portfolio of stocks managed by professionals. The film also explores the benefits of investing in mutual funds, including risk reduction and participation in the growth of reputable corporations, ultimately aiming to encourage viewers to invest in their financial futures. Keywords mutual funds, diversification, investment management, financial planning, Investment Company Act, risk reduction, stock market, professional analysis, economic growth, corporate investment Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-18T04:00:22.000Z yes A/V Geeks 16mm Films no 1062 mutual fundsinvestmentFinancial Planninginvestment managementstock marketDiversifying investmentsinvestor advicemarket trendsProfessional managementeconomy investmenteconomic growthInvestingInvestment Company ActChet HuntleyFord Motor Company https://avgeeks.videonest.co/videos/1460850/genetics-improving-plants-and-animals-1963 https://img.videonest.org/gamma/1460850_thumbnail_resized_v2.webp https://gamma.videonest.org/1460850_video_v4.mp4 Genetics : Improving Plants And Animals (1963) Discusses the advancements in genetics that have led to the improvement of plants and animals over time. Through techniques like inbreeding, hybridization, selecting mutations, and increasing chromosome numbers, geneticists have enhanced characteristics such as disease resistance, size, and productivity in both crops and livestock. The video highlights the historical context of these improvements, showcasing examples like the development of superior chicken breeds and larger fruits through genetic manipulation. Keywords genetics, plant improvement, animal breeding, inbreeding, hybridization, mutations, crop yield, disease resistance, selective breeding, agricultural advancements Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-17T22:00:44.000Z yes A/V Geeks 16mm Films no 824 geneticsanimal breedingplant breedinginbreedinghybridizationmutationcrop improvementplant stockanimal stockdwarf cornseedless grapescrossbreedingsugar beetscoronet filmfood crops https://avgeeks.videonest.co/videos/1460851/fouls-and-violations-in-basketball-for-women-1950s https://img.videonest.org/gamma/1460851_thumbnail_resized_v2.webp https://gamma.videonest.org/1460851_video_v4.mp4 Fouls And Violations In Basketball For Women (1950s) Provides an overview of fouls and violations in women's basketball, as explained by a national basketball official. It details the rules governing the game, including common violations during center throws, jump balls, and general play. Key concepts include the importance of adhering to regulations, the consequences of various fouls, and the significance of fair play. The video emphasizes that while contact is inevitable in basketball, understanding and following the rules is essential for the benefit of all players. Keywords basketball, women's sports, fouls, violations, rules, gameplay, officials, center throw, free throw, fair play Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-17T16:00:56.000Z yes A/V Geeks 16mm Films no 970 BasketballWomen's BasketballBasketball for WomenFoulsViolationsBasketball RulesBasketball OfficialJump BallFree ThrowTravelingOut of BoundsBlockingChargingHoldingFair Play https://avgeeks.videonest.co/videos/1460852/av-geeks-16mm-lunch-10-16-2025 https://img.videonest.org/gamma/1460852_thumbnail_resized_v2.webp https://gamma.videonest.org/1460852_video_v4.mp4 AV Geeks 16mm Lunch 10-16-2025 Hello 16mm films! We are happy to see you! #avgeeks #16mmfilms Practice Makes Perfect Drivers Crystal Champions Seeing Them Through Grass on the Roof 2025-10-17T06:12:47.000Z yes A/V Geeks 16mm Films no 3952 A/V Geeks16mm filmvintage footagedriver educationroad safetyunderwater acrobaticsCrystal Championsearth sheltered homealternative architecturesustainable designWorld War IIRed Crossfilm preservationfilm storagemovie reels https://avgeeks.videonest.co/videos/1460853/driving-tips-to-avoid-accidents-1976 https://img.videonest.org/gamma/1460853_thumbnail_resized_v2.webp https://gamma.videonest.org/1460853_video_v4.mp4 Driving Tips To Avoid Accidents (1976) Discusses essential driving tips to avoid accidents by emphasizing the importance of alertness, caution at intersections, and proper driving maneuvers. It highlights the need for drivers to maintain a clear mindset, be aware of their surroundings, and follow safety protocols, especially in high-risk situations like merging onto freeways or navigating rural roads. The key to safe driving is having a proper attitude, staying alert, and mastering everyday driving techniques. Keywords driving safety, accident prevention, alertness, intersections, traffic signals, freeway driving, rural roads, driving maneuvers, road awareness, safe distance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-17T04:01:14.000Z yes A/V Geeks 16mm Films no 1082 safe drivingdriving safetytraffic safetydriver educationdriving tipstraffic lightsmergingfreeway drivingchanging laneshighway hypnosisrural roadsfollowing distanceroad safetyleft turndriving skills https://avgeeks.videonest.co/videos/1460854/deaf-like-me-1981 https://img.videonest.org/gamma/1460854_thumbnail_resized_v2.webp https://gamma.videonest.org/1460854_video_v4.mp4 Deaf Like Me (1981) "Deaf Like Me" is a sensitive and dramatic film from 1981 that explores the emotional and communication challenges faced by deaf individuals in a predominantly hearing world. The story is centered around a ten-year-old girl who is severely hearing impaired due to congenital deafness. Through her experiences, the film highlights the struggles of navigating a world that often overlooks the needs and perspectives of the deaf community, emphasizing themes of isolation, resilience, and the quest for understanding and connection. 2025-10-16T16:01:12.000Z yes A/V Geeks 16mm Films no 1409 Deaf Like Mesign languagedeaf educationmimemimesperformancechild actingactingteachinginterpreterclassroom performanceschool playfriendshipBarr FilmsJim Callner https://avgeeks.videonest.co/videos/1460855/av-geeks-16mm-lunch-10-15-2025 https://img.videonest.org/gamma/1460855_thumbnail_resized_v2.webp https://gamma.videonest.org/1460855_video_v4.mp4 AV Geeks 16mm Lunch 10-15-2025 Wow! We are just burning through my favorite month! Thankfully we still have lots of 16mm film to watch #avgeeks #16mmfilms How To Investigate Vocations Teacher In Reflection Choosing for Happiness Fitness is a Family Affair 2025-10-16T06:04:19.000Z yes A/V Geeks 16mm Films no 3790 16mm FilmAV GeeksCareer GuidanceVocational PlanningFamily RelationshipsDatingFriendship1950s1972ClassroomStudentsTeacher ReflectionElementary SchoolRelationshipsJob Opportunities https://avgeeks.videonest.co/videos/1460856/sex-role-development-1974 https://img.videonest.org/gamma/1460856_thumbnail_resized_v2.webp https://gamma.videonest.org/1460856_video_v4.mp4 Sex Role Development (1974) Discusses gender stereotypes and their impact on boys and girls from childhood through adulthood. It highlights how societal expectations label boys as strong, tough, and competent, while girls are often seen as weak, emotional, and fragile. The narrative emphasizes the influence of parents, peers, and educational institutions in shaping these stereotypes. It also introduces the concept of androgyny, advocating for a blend of traditionally male and female traits to foster flexibility in behavior. The text features a family that promotes non-traditional gender roles, encouraging their child to engage in various activities without the constraints of gender stereotypes. It concludes by acknowledging the ongoing societal experiments in raising children in non-sexist ways and the potential for future generations to either embrace or reject these changes. Keywords: gender stereotypes, boys, girls, societal expectations, androgyny, parental influence, non-traditional roles, emotional development, education, flexibility, child-rearing, stereotypes, masculinity, femininity, social movements. 2025-10-16T04:00:16.000Z yes A/V Geeks 16mm Films no 1372 gender stereotypesgender rolessex rolessocial conditioningandrogynyparentingchild developmentearly childhoodsocial expectationsparenting stylesemotional developmentrole identityfatherhoodPacific Oaksinterplay https://avgeeks.videonest.co/videos/1460857/voice-of-your-business-1958 https://img.videonest.org/gamma/1460857_thumbnail_resized_v2.webp https://gamma.videonest.org/1460857_video_v4.mp4 Voice Of Your Business (1958) The cartoon teaches viewers about the importance of using good telephone manners. It highlights how the voice on the other end of the line can shape a customer's perception of a company, effectively becoming the "voice of your business. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-15T16:00:31.000Z yes A/V Geeks 16mm Films no 619 Telephone mannersBusiness etiquetteVoice of businessTelephone courtesyCall transferTaking messagesBusiness GrowthAnimated GraphBoosting MoraleBell Systemadvertisingbusiness rivalrybusiness operationsofficesalesman https://avgeeks.videonest.co/videos/1460858/av-geeks-16mm-lunch-10-14-2025 https://img.videonest.org/gamma/1460858_thumbnail_resized_v2.webp https://gamma.videonest.org/1460858_video_v5_360.mp4 AV Geeks 16mm Lunch 10-14-2025 And we're back! Live! With 16mm films too!! #avgeeks #16mmfilms G-Men at War Special Report Ticket to Freedom 2025-10-15T06:10:00.000Z yes A/V Geeks 16mm Films no 4074 16mm filmfilm projectorA/V GeeksFBIWorld War IIvotingG-Mencrimefilm reelvintagenews reportTicket to Freedompolitical participationGerman spiesCandy Parabola https://avgeeks.videonest.co/videos/1460859/how-are-you-1970s https://img.videonest.org/gamma/1460859_thumbnail_resized_v2.webp https://gamma.videonest.org/1460859_video_v4.mp4 How Are You? (1970s) Discusses the concept of "normal" behavior and mental health through the metaphor of a "swinger" and "squares." It highlights that individuals can exhibit a range of behaviors influenced by their emotions and societal standards. Mental health is described as the ability to confront and manage problems effectively, akin to physical health. The text also outlines various forms of mental illness, their symptoms, and the importance of understanding individual differences in behavior. It concludes with suggestions for maintaining mental health, such as confronting problems, adapting to change, and respecting others. Keywords: swinger, squares, normal behavior, mental health, emotions, individuality, problem-solving, mental illness, coping strategies, self-acceptance, respect, societal standards, behavior patterns, emotional functioning, psychological factors, irrational fears, personality disorders. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-15T04:00:06.000Z yes A/V Geeks 16mm Films no 861 mental healthmental illnessbehaviornormalswingerssquareself acceptanceself confidencesocial healthpsychological healthsenilityfearmood swingspersonality disorderemotional issues https://avgeeks.videonest.co/videos/1460860/the-hangup-1968 https://img.videonest.org/gamma/1460860_thumbnail_resized_v2.webp https://gamma.videonest.org/1460860_video_v4.mp4 The Hangup (1968) Describes the hazards of dangerous drugs and hallucinogenics. Follows a young airman through various relationships with his intimates and his professional colleagues and shows him in his pivotal role as a control tower operator. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-14T04:01:05.000Z yes A/V Geeks 16mm Films no 2002 drug abusehallucinogenic drugUnited States Air Forcedrug prevention1960s styleAir Forcedrug addictionLSDair traffic controlmental healthpeer pressuresubstance abusedrug usemilitaryaircraft control https://avgeeks.videonest.co/videos/1460861/antibiotics-1952 https://img.videonest.org/gamma/1460861_thumbnail_resized_v2.webp https://gamma.videonest.org/1460861_video_v4.mp4 Antibiotics (1952) Discusses the ongoing battle against disease, highlighting the historical inadequacy of medical defenses. It emphasizes the significance of antibiotics, particularly penicillin, as powerful weapons against bacteria that cause illness. The discovery of antibiotics stemmed from natural processes where microorganisms produce substances that inhibit or kill other microbes. The text details the development of antibiotics through research and cultivation of molds, leading to significant advancements in medicine and agriculture. Despite the successes, it acknowledges that many diseases remain without effective antibiotic treatments, underscoring the need for continued research in this field. Keywords: battlefield, disease, antibiotics, penicillin, bacteria, medical science, Alexander Fleming, antibiosis, microorganisms, research, agriculture, health, illness, treatment, medical advancements, future. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-14T04:00:34.000Z yes A/V Geeks 16mm Films no 851 AntibioticsbacteriadiseasemicrobesAlexander FlemingPenicillinDr. FloreyOxford scientistsStaphylococcusMicroorganismMicroorganismsFungiDrug researchPharmaceuticalsChemical workshops https://avgeeks.videonest.co/videos/1460862/av-geeks-16mm-lunch-10-13-2025 https://img.videonest.org/gamma/1460862_thumbnail_resized_v2.webp https://gamma.videonest.org/1460862_video_v4.mp4 A/V Geeks 16mm Lunch 10-13-2025 Somebody has a cold but still wants to show you some vintage 16mm films.. is that okay? #avgeeks #16mmfilms Mental Health: Keeping Mentally Fit Pretty Good Class for a Monday The Shape of Things to Come 2025-10-13T17:00:06.000Z yes A/V Geeks 16mm Films no 3605 A/V Geeks16mm filmmental healthgovernment filmschool lifehigh schoolstudent lifeindustrial companysteel constructionUnited States Steelengineeringmanufacturingconstructionvintage logoSkip Elsheimer https://avgeeks.videonest.co/videos/1460863/combustion-1958 https://img.videonest.org/gamma/1460863_thumbnail_resized_v2.webp https://gamma.videonest.org/1460863_video_v4.mp4 Combustion (1958) Discusses combustion, which requires fuel, air (specifically oxygen), and a high temperature, forming the fire triangle. It explains that combustion is a chemical change and can occur with different oxidizers like chlorine and sulfur. The text describes experiments demonstrating the necessity of all three fire triangle components for combustion, the effects of kindling temperature, and factors influencing the rate of combustion, such as fuel type, temperature, oxidizer nature, concentration, and mixing extent. It also covers spontaneous ignition, combustion characteristics, complete vs. partial combustion, and the results of combustion, including the formation of new substances, light, and heat energy. The importance of combustion in industrial applications and the need for further research in combustion science, especially for advancements in space travel, are emphasized. Keywords: combustion, fire triangle, fuel, oxygen, chemical change, oxidizer, kindling temperature, rate of combustion, spontaneous ignition, complete combustion, partial combustion, heat energy, industrial applications, space travel, scientific research. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-13T16:00:41.000Z yes A/V Geeks 16mm Films no 890 combustionfire triangleoxidizeroxidationfuelheat energychemical reactionspontaneous ignitionburningcomplete combustionpartial combustionoxygensteel millcoke ovenssteam https://avgeeks.videonest.co/videos/1460864/microorganisms-harmful-activities-1958 https://img.videonest.org/gamma/1460864_thumbnail_resized_v2.webp https://gamma.videonest.org/1460864_video_v4_360.mp4 Microorganisms: Harmful Activities (1958) Discusses the historical and modern methods humans have developed to combat diseases caused by microorganisms. It highlights practices such as isolating the sick, vaccination, and food preservation techniques like refrigeration and canning. The text explains Koch's postulates, which are steps to identify the specific microorganisms responsible for diseases. It also describes the immune response, including the roles of white blood cells and antibodies, and differentiates between active and passive immunity. Additionally, it covers the importance of community safeguards against disease spread, methods for food preservation, and the economic impact of spoilage caused by microorganisms. Continuous research is emphasized as essential for controlling harmful microorganisms. Keywords: disease, microorganisms, isolation, vaccination, food preservation, Koch's postulates, immune response, antibodies, active immunity, passive immunity, community safeguards, spoilage, economic impact, research, control. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-13T16:00:09.000Z yes A/V Geeks 16mm Films no 895 diseasemicroorganismsvaccinationfood preservationKoch's Postulatesinfectionsbacterial diseasesanimal diseasesimmunizationsvaccinesactive immunitypassive immunitywhite blood cellsantidoteschemical antiseptic https://avgeeks.videonest.co/videos/1460865/fable-of-the-peacock-1950 https://img.videonest.org/gamma/1460865_thumbnail_resized_v2.webp https://gamma.videonest.org/1460865_video_v4_360.mp4 Fable Of The Peacock (1950) A young girl from the village of Katia walks to the marketplace to sell flowers balanced on her head. The narrative transitions to "The World Dances," showcasing how different cultures use dance for ceremonies, entertainment, or fun. The girl demonstrates East Indian dance through hand gestures called mudra, which tell a story. The dancer, Lakshmi Wana Singh, has trained for 15 years under her father's guidance. The story she tells is about a vain peacock, admired for its beauty but ultimately ridiculed for its lack of singing ability. The lion, king of the animals, emphasizes that every creature has its own beauty and that vanity should not be tolerated. Keywords: girl, Katia, marketplace, flowers, East Indian dance, mudra, Lakshmi Wana Singh, training, peacock, vanity, lion, beauty, story. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-13T04:00:48.000Z yes A/V Geeks 16mm Films no 876 The Fable of the PeacockLakshmi Wana SinghWasantha Wana SinghIndian danceIndian musicflower girlPeacockdance performanceIndian folk dancepeacockstring instrumentRegency ProductionsAnimal KingdomLord VishnuBrandon Films https://avgeeks.videonest.co/videos/1460866/lighter-than-air-1980 https://img.videonest.org/gamma/1460866_thumbnail_resized_v2.webp https://gamma.videonest.org/1460866_video_v4_360.mp4 Lighter Than Air (1980) Discusses the history and evolution of lighter-than-air flight, focusing on hot air balloons and dirigibles (airships). It highlights key milestones, such as the Montgolfier brothers' first flight in 1783, the use of balloons for reconnaissance during the Civil War, and the development of dirigibles like the Hindenburg. The narrative covers the golden age of airships, their luxurious features, and their eventual decline after the Hindenburg disaster in 1937. It also touches on the military use of blimps during World War II and their potential resurgence due to advancements in technology and fuel efficiency. The text concludes with a look at modern hot air ballooning, emphasizing the adventure and unpredictability of balloon flights. Keywords: dirigibles, hot air balloons, lighter-than-air flight, Montgolfier brothers, Hindenburg, golden age, military use, blimps, advancements, adventure, history, helium, hydrogen, fuel efficiency. 2025-10-12T16:01:02.000Z yes A/V Geeks 16mm Films no 828 airshiphot air balloondirigibleHindenburgWorld War IWorld War IIBlimpsFerdinand von ZeppelinRoald Amundsenarcticantarcticdirigible NorgeHugo Eckeneraerial sentriestranspolar flight https://avgeeks.videonest.co/videos/1460867/interstate-brands-corporation-1970s https://img.videonest.org/gamma/1460867_thumbnail_resized_v2.webp https://gamma.videonest.org/1460867_video_v4_360.mp4 [Interstate Brands Corporation, 1970s] Interstate Brands Corporation (IBC), headquartered in Kansas City, Missouri, has successfully leveraged the popularity of Peanuts characters to boost its sales from $167 million to $277 million over six years. As one of the top four wholesale baking companies in the U.S., IBC distributes its products to over 100,000 food outlets nationwide. The company produces a variety of bread and cake products under several labels, including Dolly Madison and Butternut. IBC has consistently achieved record sales and net earnings, with a strong commitment to growth and efficiency. The company has invested in modernizing its facilities and expanding its product lines, including new snack cakes. IBC's marketing strategy, including a long-term contract for Peanuts branding, has helped maintain its competitive edge in the baking industry. Keywords: Interstate Brands Corporation, IBC, Peanuts characters, sales growth, wholesale baking, Kansas City, food distribution, bread products, cake products, Dolly Madison, Butternut, record earnings, marketing strategy, snack cakes, product expansion, efficiency, corporate Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-12T04:00:35.000Z yes A/V Geeks 16mm Films no 800 Interstate Brands CorporationPeanuts gangDolly Madison CakesButternut breadcommercial advertisementPeanutsDolly Madisonsnack cakescommercialsbaking companyfood productsadvertisingsnack foodcreme-filledZingers https://avgeeks.videonest.co/videos/1460868/sulfur-dioxide-and-sulfurous-acid-1959 https://img.videonest.org/gamma/1460868_thumbnail_resized_v2.webp https://gamma.videonest.org/1460868_video_v4_360.mp4 Sulfur Dioxide And Sulfurous Acid (1959) Discusses the chemistry of sulfur compounds, particularly focusing on sulfur dioxide (SO₂) and sulfurous acid (H₂SO₃). It explains the oxidation states of sulfur, the methods of preparing sulfur dioxide, its properties, and reactions, including its role as a reducing agent and its solubility in water. The text also describes experiments demonstrating the formation of sulfurous acid, the reaction of sulfur dioxide with water, and its use as a bleaching agent. Additionally, it covers the oxidation of sulfite ions and the reactions of sulfur dioxide with hydrogen sulfide, leading to the formation of elemental sulfur. Keywords: sulfur, sulfur dioxide, sulfurous acid, oxidation states, reducing agent, solubility, chemical reactions, bleaching agent, sulfite ions, hydrogen sulfide, preparation methods, experiments, acid-base reactions, sulfate ions. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-11T16:00:35.000Z yes A/V Geeks 16mm Films no 1645 sulfur dioxidesulfurous acidchemical reactionchemical reactionsoxidationoxidation-reductionsulfite ionsulfate ionchemical propertieschemical experimentacid base reactionpotassium permanganatebarium chloridehydrogen sulfideelemental sulfur https://avgeeks.videonest.co/videos/1460869/careers-in-physical-education-1960 https://img.videonest.org/gamma/1460869_thumbnail_resized_v2.webp https://gamma.videonest.org/1460869_video_v4_360.mp4 Careers In Physical Education (1960) Discusses the evolution and importance of physical education in the United States, highlighting its historical roots in the early days of the country and its current significance in modern society. It emphasizes the necessity of physical fitness, emotional stability, and mental alertness for success in various fields, including education and the armed services. The demand for qualified physical education teachers is increasing, with many colleges preparing students for careers in this field. The curriculum focuses on a well-rounded education, including humanities and sciences, and aims to develop students' physical abilities and character. The text also features personal accounts from physical educators, illustrating their roles and the impact they have on students' lives. Overall, a career in physical education is portrayed as rewarding, offering job security, community respect, and the opportunity to shape the future of youth. Keywords: physical education, fitness, emotional stability, mental alertness, teamwork, teaching, curriculum, career, youth development, job security, community respect, coaching, personal accounts, educational impact. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-11T04:01:00.000Z yes A/V Geeks 16mm Films no 1290 Physical Educationteacher trainingphysical fitnessteamworksportsyouth developmentteaching careercareer optionscollege studentsanatomyphysiologyteam sportsgymnasticswrestlinghealth education https://avgeeks.videonest.co/videos/1460870/av-geeks-16mm-lunch-10-10-2025 https://img.videonest.org/gamma/1460870_thumbnail_resized_v2.webp https://gamma.videonest.org/1460870_video_v5_360.mp4 AV Geeks 16mm Lunch 10-10-2025 Even more 16mm films? Are you kidding me? #avgeeks #16mmfilms Mental Health: Keeping Mentally Fit Pretty Good Class for a Monday The Shape of Things to Come 2025-10-10T17:00:06.000Z yes A/V Geeks 16mm Films no 4491 A/V geeks16mmsteelmakingbasic oxygen furnaceBOF processsteel industryhome improvementvintage home1950shuman aggressiongang violencesocial behaviorpsychological theoryadvertisementCrane plumbing https://avgeeks.videonest.co/videos/1460871/report-on-donald-1948 https://img.videonest.org/gamma/1460871_thumbnail_resized_v2.webp https://gamma.videonest.org/1460871_video_v4_360.mp4 Report On Donald (1948) Donald Carter attended the University of Minnesota Speech Clinic from September to December to address his severe stuttering, which had affected his social interactions and academic performance. Initially, he avoided speaking situations due to fear of ridicule, leading to isolation. At the clinic, he learned to identify and manage his stuttering through various techniques, including mirror sessions and speaking exercises. Over time, he gained confidence, improved his fluency, and developed a healthier attitude towards his speech. By the end of his treatment, Donald had made significant progress, allowing him to engage more fully in social and academic life. Keywords: Donald Carter, University of Minnesota, Speech Clinic, stuttering, social isolation, speech examination, fluency, speech therapy, self-awareness, confidence, communication skills, personal adjustment, academic performance, treatment progress. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-10T16:00:50.000Z yes A/V Geeks 16mm Films no 1179 Donald CarterUniversity of Minnesotaspeech clinicstutteringspeech therapyspeech examinationfluencyspeech disordersspeech impedimentpersonal adjustmentspeech correctionfacial contortionsstuttering therapyspeech mechanismspeech blocks https://avgeeks.videonest.co/videos/1460872/hinduism-1962 https://img.videonest.org/gamma/1460872_thumbnail_resized_v2.webp https://gamma.videonest.org/1460872_video_v4.mp4 Hinduism (1962) Explores the rich history and beliefs of Hinduism, centered around the ancient city of Banaris on the Ganges River. It discusses the origins of Hinduism, its sacred texts (the Vedas), and the concept of Brahman as the universal spirit. The caste system is explained, along with the emergence of reforming religions like Jainism and Buddhism. Hinduism is characterized by its tolerance and acceptance of various beliefs and practices, including the worship of multiple deities such as Brahma, Vishnu, and Shiva. The text also highlights the paths to salvation in Hinduism: the way of works, the way of worship, and the way of wisdom. Modern Hinduism is described as evolving with social reforms and a focus on nonviolence and respect for all living beings. The text concludes with the idea that true devotion transcends distinctions and leads to the realization of God’s omnipresence. Keywords: Hinduism, Banaris, Ganges, Brahman, Vedas, caste system, Jainism, Buddhism, deities, salvation, tolerance, nonviolence, modern Hinduism, social reform, spirituality, rituals. 2025-10-10T04:00:06.000Z yes A/V Geeks 16mm Films no 1139 HinduismBenaresThe GangesIndian ReligionsThe VedasHindu CastesBrahmaVishnuShivaKrishnaRamaHindu traditionsHindu culturesocial reformnon-violence https://avgeeks.videonest.co/videos/1460873/av-geeks-16mm-lunch-10-9-2025 https://img.videonest.org/gamma/1460873_thumbnail_resized_v2.webp https://gamma.videonest.org/1460873_video_v4.mp4 AV Geeks 16mm Lunch 10 9 2025 Can we actually show you old 16mm films while we are driving? Kinda.. #avgeeks #16mmfilms Mainline USA A Shape of a Leaf Gateway to Health 2025-10-09T17:00:06.000Z yes A/V Geeks 16mm Films no 3820 Skip ElsheimerA/V Geeks16mm filmMainline USAGateway to HealthRailroadsAmerican industryleavesart classDental HygieneOral HealthDental Healthtooth decayJohn OttJanet Blair https://avgeeks.videonest.co/videos/1460874/toward-a-generation-of-safer-drivers-1953 https://img.videonest.org/gamma/1460874_thumbnail_resized_v2.webp https://gamma.videonest.org/1460874_video_v4.mp4 Toward A Generation Of Safer Drivers (1953) A high school in Brooklyn, New York, has initiated an innovative driver education program that could significantly improve the training of high school students across the country. The program aims to address the alarming statistics surrounding automobile accidents, which have claimed over a million lives in the past 50 years, primarily due to human error. Currently, only a small fraction of licensed drivers have received formal driving instruction in high school. The initiative includes the use of a "driver trainer," a classroom device that allows one instructor to supervise multiple students during behind-the-wheel training. This program, supported by the Etna Casualty Insurance Company, aims to create safer drivers by providing comprehensive training that includes both classroom instruction and practical driving experience. Early indications suggest that this method could reduce training costs and make driver education more accessible to high schools nationwide. **Keywords:** high school, Brooklyn, driver education, automobile accidents, human error, driver trainer, training program, safety, Etna Casualty Insurance, classroom instruction, practical experience, accessible education. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-09T16:00:10.000Z yes A/V Geeks 16mm Films no 823 driver educationdriver safetycar accidentsAetna Casualtytraffic safetydriving skillshigh schoolautomobilesafetyfilmAetnadrivotrainercardriver trainingdriver trainer https://avgeeks.videonest.co/videos/1460875/for-the-record-1965 https://img.videonest.org/gamma/1460875_thumbnail_resized_v2.webp https://gamma.videonest.org/1460875_video_v4.mp4 For The Record (1965) Discusses the importance of preserving American art history through the Archives of American Art. It highlights the efforts to collect and organize materials related to American artists, including letters, sketches, and interviews. The narrative includes insights from artists like Julius Schmidt and Benjamin West, emphasizing their contributions and the evolution of American art. The archives aim to fill gaps in knowledge and stimulate research and writing about American artists, while also seeking funds to support their mission. Keywords: American art, Archives of American Art, preservation, Julius Schmidt, Benjamin West, interviews, artists, history, research, funding, sketches, documents, cultural heritage, art history, self-taught artists, technology, microfilm, Charles Wilson Peale, Thomas Cole, George Caleb Bingham, spiritual heritage. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-09T04:01:00.000Z yes A/V Geeks 16mm Films no 1169 American artArchives of American ArtJulius SchmidtBenjamin WestAmerican Art Historyart preservationcultural heritageCharles PealeThomas ColeGeorge Caleb BinghamMicrofilmAmerican RevolutionGeorge WashingtonCharles SheelerE.P. Richardson https://avgeeks.videonest.co/videos/1460876/making-meetings-work-a-five-step-plan-1985 https://img.videonest.org/gamma/1460876_thumbnail_resized_v2.webp https://gamma.videonest.org/1460876_video_v4.mp4 Making Meetings Work: A Five-Step Plan (1985) Discusses the importance of conducting productive meetings and outlines five key steps to improve their effectiveness. Larry Hall, a management consultant, emphasizes that many meetings are unproductive and costly, wasting time and resources. The five steps include: 1) Only meet when necessary and with the right people, 2) Distribute background information in advance, 3) Write agendas focused on outcomes with time allocations, 4) Foster trust in meetings rather than competition, and 5) Record and follow up on decisions and commitments. The text also features a case study of Janet Keel, an area vice president, who implements these steps to enhance her team's meeting productivity. Keywords: meetings, productivity, management, Larry Hall, agenda, outcomes, trust, commitments, case study, Janet Keel, background information, time management, decision-making, team collaboration, organizational efficiency. 2025-10-08T16:00:06.000Z yes A/V Geeks 16mm Films no 1089 meeting efficiencybusiness meetingsmeeting agendameeting outcomesmeeting techniquescollaborationagendatrustcommitmentmeetingmeeting managementbusinessLarry Hallmanagement consultantmeeting plan https://avgeeks.videonest.co/videos/1460877/av-geeks-16mm-lunch-10-7-2025 https://img.videonest.org/gamma/1460877_thumbnail_resized_v2.webp https://gamma.videonest.org/1460877_video_v5_360.mp4 AV Geeks 16mm Lunch 10-7-2025 Oh Internet Goddess, smile on us today as we watch some humble 16mm films. #avgeeks #16mmfilms The Dark Blossum The Day's Work Junior Prom 2025-10-08T06:11:04.000Z yes A/V Geeks 16mm Films no 4037 https://avgeeks.videonest.co/videos/1460878/pictures-of-health-genetic-platforms-1979 https://img.videonest.org/gamma/1460878_thumbnail_resized_v2.webp https://gamma.videonest.org/1460878_video_v4.mp4 Pictures Of Health Genetic Platforms (1979) The Franklin family is reminiscing over old family photos, reflecting on their ancestry and the genetic traits passed down through generations. George Franklin shares images of their great-great-grandparents, highlighting how genetics influence physical characteristics, intellectual capacities, and susceptibility to diseases. While David and Sally inherit a genetic blueprint from their family, their health and well-being are also shaped by their environment and personal choices. The text emphasizes that although certain diseases may run in families, lifestyle choices can significantly impact health outcomes. Understanding one's genetic background can help individuals prepare for potential health issues and make informed decisions to enhance their well-being. **Keywords:** Franklin family, ancestry, genetics, health, well-being, family photos, genetic blueprint, diseases, lifestyle choices, susceptibility, environment, personal responsibility, health outcomes. 2025-10-08T04:00:49.000Z yes A/V Geeks 16mm Films no 792 Franklin familygeneticshereditydiseasehealthinherited traitsgenetic predispositionsfamily healthgenetic diseasepublic healthchild healthfamily historygenetic predispositionlifestyle choicesdisease prevention https://avgeeks.videonest.co/videos/1460879/magnets-the-dragons-secret-1981 https://img.videonest.org/gamma/1460879_thumbnail_resized_v2.webp https://gamma.videonest.org/1460879_video_v4.mp4 Magnets: the Dragon's Secret (1981) Discusses the various uses of magnets in everyday life, such as in telephones, tools, and automobile engines. It explains what a magnet is, how to make one, and the materials required, including aluminum, nickel, and cobalt. The process involves heating metal, shaping it, and magnetizing it through electricity. The text also covers magnetic attraction, the concept of magnetic fields, and the behavior of magnets, including attraction and repulsion between poles. Additionally, it highlights the role of magnets in compasses and their applications in research and technology. Keywords: magnets, uses, materials, aluminum, nickel, cobalt, magnetic attraction, magnetic field, poles, attraction, repulsion, compass, research, technology, energy. 2025-10-07T16:01:01.000Z yes A/V Geeks 16mm Films no 865 MagnetsMagnetismPhysicsEncyclopaedia BritannicaMaterialsMagnet factorymagnetmagnetic forcemagnetizingsteelironmagnetic materialsmagnetic attractionmagnetic fieldcompass https://avgeeks.videonest.co/videos/1460880/regulating-body-temperature-1972 https://img.videonest.org/gamma/1460880_thumbnail_resized_v2.webp https://gamma.videonest.org/1460880_video_v4.mp4 Regulating Body Temperature (1972) Discusses the importance of maintaining a constant body temperature in animals, despite varying environmental conditions. It explains how body temperature regulation occurs through metabolism, behavior, and physiological adjustments. Ectotherms rely on external heat sources, while endotherms generate heat internally. The hypothalamus plays a crucial role in regulating body temperature by responding to changes and triggering appropriate responses, such as shivering or sweating. The ability to maintain a stable internal temperature is vital for optimal functioning and survival in diverse environments. Keywords: body temperature, regulation, ectotherms, endotherms, hypothalamus, metabolism, physiological adjustments, behavior, heat exchange, environmental conditions, shivering, sweating, survival, internal temperature, temperature constancy. 2025-10-07T04:00:14.000Z yes A/V Geeks 16mm Films no 1264 body temperatureregulating body temperatureendothermsectothermshypothalamusheat regulationanimal behaviorheat lossheat gainheat exchangeshiveringblood flowmetabolismcold environmentanimal evolution https://avgeeks.videonest.co/videos/1460881/the-chance-to-lose-1937 https://img.videonest.org/gamma/1460881_thumbnail_resized_v2.webp https://gamma.videonest.org/1460881_video_v4.mp4 The chance to lose. (1937) Discusses the dangers of night driving and the increase in accidents due to motorists' lack of awareness about safe practices. It highlights that accidents are more likely to occur during ideal driving conditions when drivers feel overconfident. The narrative emphasizes the importance of never exceeding the visibility range of headlights, driving at safe speeds, and being cautious, especially during late-night hours when fatigue can impair judgment. It also warns against the dangers of driving under the influence of alcohol and criticizes aggressive driving behaviors. The text concludes by stressing that while modern cars are designed for safety, the ultimate responsibility for safe driving lies with the driver. Keywords: night driving, accidents, safety, visibility, headlights, speed, fatigue, alcohol, aggressive driving, modern cars, responsibility, safe driving. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-06T16:01:26.000Z yes A/V Geeks 16mm Films no 509 night drivingdriving safetyheadlightsdriving awarenessmotorist awarenessRoad SafetyVehicle MaintenancePedestrian SafetyAccident Preventionsafetyvisibilityspeedfatiguealcoholaggressive driving https://avgeeks.videonest.co/videos/1460882/the-money-tree-1971 https://img.videonest.org/gamma/1460882_thumbnail_resized_v2.webp https://gamma.videonest.org/1460882_video_v4.mp4 The Money Tree (1971) Features Anson Williams in a very unlikeable role. The film starts with a conversation between a couple, Jerry and Anne, reflecting on their relationship and the challenges they face. It begins with Anne expressing her feelings and the fleeting nature of their love. As the dialogue progresses, they discuss their marriage, financial struggles, and the impact of an unexpected pregnancy on their relationship. The couple reminisces about their early days, the excitement of starting a life together, and the burdens of debt and responsibilities that have led to their emotional distance. Ultimately, they confront the reality of their situation, acknowledging the strain on their marriage and the uncertainty of their future together. Keywords: love, relationship, marriage, financial struggles, pregnancy, emotional distance, memories, debt, responsibilities, conflict, uncertainty. 2025-10-06T04:01:16.000Z yes A/V Geeks 16mm Films no 1131 The Money TreeYoung CoupleRelationship troublesdebt collectiondivorcerepossessionconsumerismcredit cardcar loanpregnancyargumenthospital billlosing jobcredit reportmarriage trouble https://avgeeks.videonest.co/videos/1460883/if-it-doesnt-work-complain-1975 https://img.videonest.org/gamma/1460883_thumbnail_resized_v2.webp https://gamma.videonest.org/1460883_video_v4.mp4 If It Doesn't Work Complain (1975) The film's conversation revolves around a group of friends discussing their experiences with faulty products and the challenges of getting satisfaction from stores. Walt expresses frustration over a broken stereo he purchased for $250, while others share their own stories of dissatisfaction with various products, including pantyhose and a toaster. They discuss the importance of complaining to the right people, such as store managers, and the potential effectiveness of escalating complaints to higher authorities, like company presidents. Ultimately, they emphasize the need to advocate for oneself when faced with poor service or defective items. Keywords: Walt, stereo, complaint, satisfaction, friends, experiences, faulty products, frustration, store manager, escalation, consumer rights, advocacy, pantyhose, toaster, communication. 2025-10-05T16:01:37.000Z yes A/V Geeks 16mm Films no 900 ConsumerismComplaintCustomer ServiceConsumer ComplaintsConsumer AdviceProblem ResolutionBusiness PracticesRetail AdviceStereo setBad circuitRepairmanLunchOfficeToastSmall Claims Court https://avgeeks.videonest.co/videos/1460884/others-1972 https://img.videonest.org/gamma/1460884_thumbnail_resized_v2.webp https://gamma.videonest.org/1460884_video_v4.mp4 Others (1972) Greg is confronted by a teacher about his disruptive behavior in class, which frustrates both his classmates and the teacher. After being labeled a troublemaker, Greg expresses his desire to leave school and even considers getting revenge on the teacher. However, he later visits Mrs. Dorin, the teacher, and learns about her personal struggles, including caring for her ill mother. This experience leads him to realize that she is not as bad as he thought, and he reflects on the misunderstandings people have about her. Keywords: Greg, teacher, disruptive behavior, troublemaker, revenge, Mrs. Dorin, personal struggles, illness, misunderstanding, school, classmates. 2025-10-05T04:00:20.000Z yes A/V Geeks 16mm Films no 784 Gregschooldisruptive behaviortroublemakerrevengeMrs. Dorinpersonal strugglesillnessmisunderstandingclassmatesA Wombat Productionrunning awayfamilybeing honestgrowing up https://avgeeks.videonest.co/videos/1460885/whats-in-a-shadow-1979 https://img.videonest.org/gamma/1460885_thumbnail_resized_v2.webp https://gamma.videonest.org/1460885_video_v4.mp4 What's In A Shadow? (1979) Film discusses how to use shadows and the sun's position to find directions. It explains that your shadow is always with you and can help you determine north, south, east, and west, especially when you don't have a compass. By observing the sun's movement throughout the day, you can create a "shadow gram" to track its position. The sun rises in the east, reaches its highest point at noon (casting the shortest shadow), and sets in the west. The text emphasizes the importance of understanding the relationship between the sun's position and the Earth's rotation to navigate effectively. Keywords: shadow, directions, compass, sun, north, south, east, west, shadow gram, noon, Earth's rotation, navigation, sunrise, sunset. 2025-10-04T16:01:24.000Z yes A/V Geeks 16mm Films no 756 shadowdirectionscompasssunnorthsoutheastwestshadow gramnoonEarth's rotationnavigationsun positionfinding directionssolar science https://avgeeks.videonest.co/videos/1460886/av-geeks-16mm-lunch-10-3-2025 https://img.videonest.org/gamma/1460886_thumbnail_resized_v2.webp https://gamma.videonest.org/1460886_video_v4.mp4 AV Geeks 16mm Lunch 10-3-2025 16mm films, you say? We got'em! #16mmfilms #avgeeks The Dime The Unseen Power Antibiotics Golf: A Special Kind of Joy 2025-10-04T06:11:05.000Z yes A/V Geeks 16mm Films no 3948 16mm FilmA/V Geeksdimecoin collectingThe Unseen Powerindustrial revolutionantibioticsAlexander Fleminggolfgolfinggolf coursevintageeducational filmfilm projectormedical research https://avgeeks.videonest.co/videos/1460887/history-of-photography-1940s https://img.videonest.org/gamma/1460887_thumbnail_resized_v2.webp https://gamma.videonest.org/1460887_video_v4.mp4 History Of Photography (1940s) The Eastman House in Rochester, New York, showcases the evolution of photography over more than a century through unique exhibitions. Visitors can explore the history of this revolutionary art form, from early techniques like the camera obscura and daguerreotype to modern innovations such as secret cameras. The museum highlights significant developments in photography, including the negative-positive process by William Henry Fox Talbot and the introduction of the dry plate process, which made photography accessible to the masses. The collection also features historical photographs, including Civil War images captured by Matthew Brady, illustrating the impact of photography on documenting history. Keywords: Eastman House, photography, exhibitions, history, camera obscura, daguerreotype, William Henry Fox Talbot, negative-positive process, dry plate process, secret cameras, Civil War, Matthew Brady, documentation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-04T04:00:58.000Z yes A/V Geeks 16mm Films no 469 photographyEastman Housecamera obscuradaguerreotype3D photographyColodian processNiepceTalbot's processfilmphotographic studiosdry plate processsecret cameraAmerican Civil WarMatthew Brady https://avgeeks.videonest.co/videos/1460888/tale-of-rumpelstiltskin-1974 https://img.videonest.org/gamma/1460888_thumbnail_resized_v2.webp https://gamma.videonest.org/1460888_video_v4.mp4 Tale Of Rumpelstiltskin (1974) Live action! Narrates a story about a miller who boasts that his daughter can spin straw into gold, leading to her being summoned by the king. The king imprisons her, demanding she fulfill the impossible task. A mysterious figure offers to help her in exchange for her firstborn child. As the story unfolds, the miller's daughter becomes a queen, but the figure returns to claim the child, leading to a series of events where the queen must guess the figure's name to save her baby. Ultimately, the name is revealed, and the story reflects on the consequences of greed and the fate of the miller. Keywords: miller, daughter, straw, gold, king, dungeon, impossible task, mysterious figure, firstborn, queen, name, consequences, greed, fate. 2025-10-04T04:00:36.000Z yes A/V Geeks 16mm Films no 1250 The Tale of Rumplestiltskinfairy talespin strawRumpelstiltskinstraw to goldspinning wheelpeasant girlfolktalesRoyaltySpinning goldDwarfFirst bornMiller's daughterqueenname guessing https://avgeeks.videonest.co/videos/1460889/volunteer-story-1970s https://img.videonest.org/gamma/1460889_thumbnail_resized_v2.webp https://gamma.videonest.org/1460889_video_v4.mp4 Volunteer Story (1970s) This film discusses the challenges faced by a struggling family, particularly focusing on a mother and her children who are trapped in a cycle of poverty and despair. A social worker and volunteers work together to provide assistance, including food, medical aid, and emotional support. The narrative highlights the importance of community involvement and the role of volunteers in helping families overcome feelings of hopelessness. It emphasizes the need for education, transportation, and childcare, as well as the significance of building a sense of pride and achievement within the family. The text concludes by stressing that with the right support, individuals can break free from poverty and despair. **Keywords:** poverty, family, social worker, volunteers, assistance, education, community, support, hopelessness, healthcare, transportation, childcare, emotional support, independence, despair. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-03T16:00:39.000Z yes A/V Geeks 16mm Films no 1234 PovertyVolunteer StorySocial ServicesVolunteerSocial WorkerFamily SupportCommunity SupportVolunteeringChild CareSingle MotherAssistanceEducationHomeless ChildrenMentoringCharity https://avgeeks.videonest.co/videos/1460890/the-dime-1976 https://img.videonest.org/gamma/1460890_thumbnail_resized_v2.webp https://gamma.videonest.org/1460890_video_v4_360.mp4 The Dime (1976) The Dime (1976, Little Red Filmhouse) This short film traces the journey of a single dime as it leaves the U.S. Mint and passes through many different owners and situations. Each exchange highlights the coin’s constant movement and shifting value in everyday life. Eventually, after countless changes of hands, the dime meets an ignoble end—lost down a sewer. The film serves as a simple but effective allegory about circulation, value, and impermanence. 2025-10-03T12:55:48.000Z yes A/V Geeks 16mm Films no 766 dimecoinLittle Red Filmhousecoin collectingretailvending machinecoin sortingcoin rollingice creamchildhoodlosing moneyplayingyoung boyparking metermanufacturing https://avgeeks.videonest.co/videos/1460891/av-geeks-16mm-lunch-10-2-2025 https://img.videonest.org/gamma/1460891_thumbnail_resized_v2.webp https://gamma.videonest.org/1460891_video_v4_360.mp4 AV Geeks 16mm Lunch 10-2-2025 Fall weather charges our batteries! Join a newly energized AV Geeks! #16mmfilms #avgeeks A Mystery Story Voice of your Business How Are You? Fouls and Violations in Basketball for Women 2025-10-03T06:07:57.000Z yes A/V Geeks 16mm Films no 3814 16mm filmA/V GeeksSkip Elsheimertelephone mannersbusiness strategybutterflycaterpillarwomen's basketballbasketball foulsbasketball ruleshealth educationmental healthscience filmsanimalfilm reel https://avgeeks.videonest.co/videos/1460892/visit-to-a-county-fair-1979 https://img.videonest.org/gamma/1460892_thumbnail_resized_v2.webp https://gamma.videonest.org/1460892_video_v4_360.mp4 Visit To A County Fair (1979) This film describes the vibrant and exciting atmosphere of a county fair, where visitors can enjoy various activities and displays. County fairs originated as gatherings for farmers to showcase their crops, livestock, and homemade goods, competing for prizes. Today, competitions still feature vegetables, livestock, and homemade products. The narrative follows three children—Derek, Lisa, and Tom—as they explore displays of canned goods, livestock preparation for judging, and the excitement of various animal competitions. The fair also includes rides and games, culminating in a fun-filled day that leaves the children eager to return next year. Keywords: county fair, colorful, exciting, livestock, competitions, crops, homemade goods, judging, ribbons, children, rides, games, fun, community, agriculture, 4-H projects, animals, prizes. 2025-10-03T04:00:29.000Z yes A/V Geeks 16mm Films no 677 county fairlivestock showinganimal judginghomemade goodsfarming4-H clubhorse showpony ridesdraft horsescarouselcotton candyFerris wheelCarnival gamesIngham county fairraising animals https://avgeeks.videonest.co/videos/1460893/nobodys-victim-1972 https://img.videonest.org/gamma/1460893_thumbnail_resized_v2.webp https://gamma.videonest.org/1460893_video_v4_360.mp4 Nobody's Victim (1972) This film discusses the importance of self-defense for women, emphasizing that they should not feel helpless in the face of potential danger. It shares personal experiences of assault and theft, highlighting the prevalence of violent crimes against women. The text provides practical tips for self-protection, including being aware of surroundings, securing personal belongings, and using everyday items as defensive weapons. It also advises on home security measures, how to respond to unwanted attention, and the importance of self-defense training. The overall message is to empower women to take proactive steps to ensure their safety. **Keywords:** self-defense, women, assault, crime, safety, awareness, personal security, home security, self-protection, empowerment, practical tips, defense skills, prevention, training. 2025-10-02T16:00:29.000Z yes A/V Geeks 16mm Films no 1170 self-defensewomen self-defensepersonal safetysafety tipscrime preventionattack preventiondefense techniquesviolence against womenrapeassault defensehome securitypurse snatchingweaponsattackdriving safety https://avgeeks.videonest.co/videos/1460894/av-geeks-16mm-lunch-10-1-2025 https://img.videonest.org/gamma/1460894_thumbnail_resized_v2.webp https://gamma.videonest.org/1460894_video_v4.mp4 AV Geeks 16mm Lunch 10-1-2025 Woo! October is better with old 16mm films. #16mmfilms #avgeeks Calvin Promotional film You and Me and SST Genetics: Improving Plants and Animals Life with Baby So Long soundie 2025-10-02T06:10:07.000Z yes A/V Geeks 16mm Films no 3939 AV Geeks16mm filmCalvin ProductionsSupersonic transportSST Programgeneticsplant breedinganimal breedingLife With Babyinfant developmentchild developmentvintage filminstructional videosound filmSkip Elsheimer https://avgeeks.videonest.co/videos/1460895/the-lewis-and-clark-journey-1968 https://img.videonest.org/gamma/1460895_thumbnail_resized_v2.webp https://gamma.videonest.org/1460895_video_v4.mp4 The Lewis And Clark Journey (1968) In 1803, the United States acquired a vast territory through the Louisiana Purchase, under President Thomas Jefferson. He commissioned an expedition led by Meriwether Lewis and William Clark to explore this new land, aiming to find a water route to the Pacific Ocean and strengthen U.S. claims to the Oregon country. The expedition began on May 14, 1804, from St. Louis, traveling up the Missouri River. They documented their journey, noting wildlife, landscapes, and interactions with Native American tribes. After enduring harsh conditions and navigating challenging terrains, they reached the Pacific Ocean on November 7, 1805. The expedition returned to St. Louis in September 1806, completing a journey of nearly two and a half years, significantly contributing to the understanding of the American West. **Keywords:** Louisiana Purchase, Thomas Jefferson, Lewis and Clark, expedition, Missouri River, Pacific Ocean, Native American tribes, wildlife, exploration, St. Louis, journey, American West. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-02T04:00:37.000Z yes A/V Geeks 16mm Films no 975 Lewis and ClarkLouisiana PurchaseMissouri RiverexpeditionexplorationThomas Jeffersonexploringtraveling1803Rocky MountainsPacific OceanSacagaweaFort MandanCoronet FilmsGreat Falls https://avgeeks.videonest.co/videos/1460896/mission-to-earth-part-2-life-forms-and-resources-1977 https://img.videonest.org/gamma/1460896_thumbnail_resized_v2.webp https://gamma.videonest.org/1460896_video_v4.mp4 Mission To Earth, Part 2, Life Forms And Resources (1977) This film discusses the exploration on a planet (Earth) with diverse life forms and abundant resources. The initial phase focused on the planet's physical characteristics, revealing a rich atmosphere and a significant water presence. The second phase aims to study the life forms and their resource utilization. The probe's findings indicate a complex ecosystem where various plant communities adapt to specific environmental conditions. Evidence of intelligent life forms manipulating the environment for agriculture and resource extraction has been observed, including the use of machines for cultivation and energy production. The mission will continue to investigate the societal structures and resource dependencies of these beings. Keywords: probe, exploration, life forms, resources, planet, water cycle, agriculture, intelligent life, ecosystem, energy production, environmental adaptation, societal structures, resource utilization, phase two, findings. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-10-01T16:00:43.000Z yes A/V Geeks 16mm Films no 1029 Mission to Earthplant lifewater cyclesolar energyplant communitiesagriculturenatural resourcesenergywater resourcesresource gatheringsoil analysiswater scarcityharvestingfuelBarr Films https://avgeeks.videonest.co/videos/1460897/av-geeks-16mm-lunch-9-30-2025 https://img.videonest.org/gamma/1460897_thumbnail_resized_v2.webp https://gamma.videonest.org/1460897_video_v5_360.mp4 AV Geeks 16mm Lunch 9-30-2025 Farewell September. October is our favorite month, so we aren't sad to see you leave. Plus we watch 16mm films! #16mmfilms #avgeeks Missouri Traffic Safety PSAs Fable of the Peacock Microorganisms: Harmful Activities Careers In Physical Education 2025-10-01T06:11:11.000Z yes A/V Geeks 16mm Films no 4032 https://avgeeks.videonest.co/videos/1460898/louise-nevelson-1970-1971 https://img.videonest.org/gamma/1460898_thumbnail_resized_v2.webp https://gamma.videonest.org/1460898_video_v4.mp4 Louise Nevelson 1970 (1971) Discusses the artistic philosophy and career of Louise Nevelson, emphasizing the interplay between form and fantasy in her work. Nevelson reflects on her journey as an artist, from her early influences and experiences in Mexico to her development of a unique style that incorporates cubism and found objects. She describes her transition from traditional sculpture to constructing pieces that emphasize light and shadow, particularly through the use of black and later plexiglass. Nevelson's work is characterized by a rigorous design and a deep connection to her inner self, culminating in her public installations, such as "Atmosphere and Environment." Keywords: Louise Nevelson, art, form, fantasy, cubism, sculpture, black, plexiglass, light, shadow, found objects, creativity, artistic journey, public installation, Atmosphere and Environment. 2025-10-01T04:00:50.000Z yes A/V Geeks 16mm Films no 1596 Louise NevelsonSculptorModern ArtCubismAssemblage SculptureFound Object ArtSculptureArtistic InspirationBlack ArtGeometric ArtPlexiglassWhitney Museum1970sArt AnalysisDawn's Wedding Feast https://avgeeks.videonest.co/videos/1460899/the-deaf-child-speaks-1972 https://img.videonest.org/gamma/1460899_thumbnail_resized_v2.webp https://gamma.videonest.org/1460899_video_v4.mp4 The Deaf Child Speaks (1972) Film discusses the challenges and successes of teaching severely deaf children at the Oral Education Center of Southern California. Many of these children cannot hear everyday sounds, making education difficult. The center employs innovative visual and tactile methods to help these children develop language, speech, and academic skills. Activities like dancing, drawing, and hands-on learning are used to enhance their understanding of time, space, and language structure. The center has shown significant improvements in the children's academic performance, with many advancing from the lower 30% to the upper 25% in standardized tests. The overall goal is to equip these children with the language skills necessary to thrive in a hearing world. Keywords: deaf children, education, Oral Education Center, language development, speech skills, visual methods, tactile methods, academic improvement, standardized tests, communication, learning challenges, innovative teaching. 2025-09-30T16:01:37.000Z yes A/V Geeks 16mm Films no 969 deaf childrenoral educationlanguage learningspecial educationspeech therapytactile learninglanguage skillslearningclassroomchildreneducationhearing impairmenthard of hearingUCLAacademic improvement https://avgeeks.videonest.co/videos/1460900/av-geeks-16mm-lunch-9-29-2025 https://img.videonest.org/gamma/1460900_thumbnail_resized_v2.webp https://gamma.videonest.org/1460900_video_v4.mp4 AV Geeks 16mm Lunch 9-29-2025 Today we've uploaded 11,000 16mm films and streaming shows! Thanks so much for your kind support and for watching! #16mmfilms #avgeeks Official Sports PSAs Interstate Brands Corporation (featuring Jodie Foster) Toward a Generation of Better Drivers Report on Donald 2025-09-30T06:07:31.000Z yes A/V Geeks 16mm Films no 3828 16mm filmAV GeeksSports OfficiatingInterstate Brands CorporationPeanuts Gangcommercial videodriving educationdriver safetyReport On Donaldspeech impedimentstutteringfilm scanningDolly MadisonCharlie BrownDriver Education https://avgeeks.videonest.co/videos/1460901/many-roads-1970 https://img.videonest.org/gamma/1460901_thumbnail_resized_v2.webp https://gamma.videonest.org/1460901_video_v4.mp4 Many Roads (1970) Discusses the importance of individualized learning paths for children, emphasizing that each child learns differently and should be encouraged to choose their own methods of learning. It highlights the variety of resources available in a learning center, such as audiovisual materials, books, and hands-on activities, which cater to different learning styles. The Hegel School in Madison, Wisconsin, is presented as an example where children are supported in exploring various learning avenues, allowing them to meet their educational objectives at their own pace. The text also touches on the role of teachers in guiding students while allowing them the freedom to choose their learning paths. Keywords: individualized learning, learning paths, Hegel School, Madison, Wisconsin, resources, audiovisual materials, hands-on activities, student choice, teacher guidance, learning objectives, exploration, education. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-30T04:00:27.000Z yes A/V Geeks 16mm Films no 1035 individualized learninglearning pathsHegel SchoolMadison, Wisconsinstudent choicelearning objectiveseducationchildren learningschoollearning centerclassroomstudentteaching methodshands-on learningeducational equipment https://avgeeks.videonest.co/videos/1460902/locus-1963 https://img.videonest.org/gamma/1460902_thumbnail_resized_v2.webp https://gamma.videonest.org/1460902_video_v4.mp4 Locus (1963) Discusses the concept of "locus" in geometry, which refers to the set of all positions a point may occupy under certain conditions. It outlines five basic locus theorems, illustrated through various examples, including the location of an illegal radio transmitter, the arrangement of cards in a cheering section, and geometric shapes like circles and lines. The theorems include: 1) points at a distance from a point form a circle, 2) points at a distance from a line form parallel lines, 3) points equidistant from two points form a perpendicular bisector, 4) points equidistant from two parallel lines form a line midway between them, and 5) points equidistant from two intersecting lines form angle bisectors. The text emphasizes the application of these concepts in solving geometric problems. Keywords: locus, geometry, theorems, distance, points, circle, parallel lines, perpendicular bisector, equidistant, intersecting lines, radio transmitter, cheering section, geometric shapes, conditions, intersection. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-29T16:01:11.000Z yes A/V Geeks 16mm Films no 881 locusgeometrytheoremspointscircleparallel linesequidistantintersecting linesModern Geometrystraight lineradius Rpoint Pfilm scratchesstatic https://avgeeks.videonest.co/videos/1460903/little-mariner-the-a-true-fairy-tale-1966 https://img.videonest.org/gamma/1460903_thumbnail_resized_v2.webp https://gamma.videonest.org/1460903_video_v4.mp4 Little Mariner, The - A True Fairy Tale (1966) Describes the port of Long Beach, California, from the point of view of a small boy who sails into the port an enchanted sailboat. Formerly titled 'LE PETIT MARINER.'. 2025-09-29T04:00:30.000Z yes A/V Geeks 16mm Films no 1186 Little MarinerLong Beachsailboatsailingvintage filmharborshipssea lionsseaboybeach townamusement parktoy boatsmall boataircraft carrier https://avgeeks.videonest.co/videos/1460904/learning-about-metric-measures-1970 https://img.videonest.org/gamma/1460904_thumbnail_resized_v2.webp https://gamma.videonest.org/1460904_video_v4.mp4 Learning About Metric Measures (1970) Jim is working on a school project to create a scale model of the Earth and the Sun, using a scale where 1/8 inch represents 1,000 miles. He struggles with converting large distances, like 93 million miles, into this scale. His father suggests using a meter stick, which is part of the metric system. Jim learns about the metric units: meter, decimeter, centimeter, and millimeter, and how they relate to each other. He decides to use a new scale where 1 mm represents 1,000 miles. Consequently, the model Earth will be 8 mm in diameter, the model Sun 864 mm, and the distance between them 93 m. Jim successfully constructs his model using metric units, finding it easier to represent large distances this way. **Keywords:** Jim, school project, scale model, Earth, Sun, metric system, meter stick, units, decimeter, centimeter, millimeter, scale, distances, model construction. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-28T16:01:01.000Z yes A/V Geeks 16mm Films no 972 Metric SystemScale ModelEarthSunMeasurementMeter StickDecimeterCentimeterMillimeterLength MeasurementUnitsDistanceScience ModelJimModels https://avgeeks.videonest.co/videos/1460905/life-times-nine-1973 https://img.videonest.org/gamma/1460905_thumbnail_resized_v2.webp https://gamma.videonest.org/1460905_video_v4.mp4 Life Times Nine (1973) Presents nine short "commercials for life", a series of short films made by children ages 11 to 16. 2025-09-28T04:01:08.000Z yes A/V Geeks 16mm Films no 882 Life Times Nineshort filmschildhoodgrowing upchildren playingwaradvertisementlive your lifefilm schoolpropagandaarmytankscemeterychess piecesboard game https://avgeeks.videonest.co/videos/1460906/digging-for-profit-1969 https://img.videonest.org/gamma/1460906_thumbnail_resized_v2.webp https://gamma.videonest.org/1460906_video_v4.mp4 Digging for Profit (1969) Discusses the advantages of John Deere machinery, particularly their backhoe loaders, in terms of operational efficiency, cost-effectiveness, and performance. Users highlight the machines' economical operation, superior hydraulic power, compactness, and low maintenance costs. The testimonials emphasize the machines' ability to handle tough excavation tasks, their safety features, and the excellent service provided by John Deere dealers. Overall, the feedback indicates high satisfaction among operators, with many noting that John Deere equipment leads to increased productivity and profitability. Keywords: John Deere, machinery, economical, operation, performance, hydraulic power, compactness, low maintenance, excavation, safety features, productivity, profitability, customer satisfaction, service, backhoe loaders. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-27T16:00:07.000Z yes A/V Geeks 16mm Films no 1143 John DeereBackhoe Loadersdiggingconstruction equipmentexcavatinghydraulic powerDigging for Profittrenchingseptic systemsewer line repairWater line repairSewer InstallationWater LinesCanal Cleaningbackfilling https://avgeeks.videonest.co/videos/1460907/av-geeks-16mm-lunch-9-26-2025 https://img.videonest.org/gamma/1460907_thumbnail_resized_v2.webp https://gamma.videonest.org/1460907_video_v5_360.mp4 AV Geeks 16mm Lunch 9-26-2025 Ultimately, it's 16mm films that bring us together on this streaming show. The kind community that has sprouted from this daily hangout is quite amazing. #16mmfilms #avgeeks Something For Nothing These Are The People Nature's Strangest Creatures Regulating Body Temperature 2025-09-27T06:17:06.000Z yes A/V Geeks 16mm Films no 4524 https://avgeeks.videonest.co/videos/1460908/death-and-taxes-1969 https://img.videonest.org/gamma/1460908_thumbnail_resized_v2.webp https://gamma.videonest.org/1460908_video_v4.mp4 Death And Taxes (1969) Discusses the history and complexities of the American tax system, emphasizing that taxes are a certainty in life, akin to death. It highlights the evolution of taxes from the pre-Revolutionary War era to modern times, including the introduction of income tax during the Civil War and its fluctuations over the years. The narrative also touches on taxpayer confusion due to complex tax laws and the importance of accurate reporting. The speaker humorously claims credit for the saying about death and taxes, while also addressing the disparities in tax burdens among individuals based on their circumstances. Keywords: constitution, taxes, complexity, taxpayer confusion, income tax, history, Revolutionary War, excise taxes, whiskey rebellion, Lincoln, World War I, withholding tax, IRS, tax forms, deductions, tax brackets, compliance, tax experts, humor. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-27T04:00:11.000Z yes A/V Geeks 16mm Films no 1077 tax historyincome taxInternal Revenue ServiceH&R BlockBenjamin Franklintax returnsWorld War IWorld War IIAmerican historytax deductionstax expertstax compliancevintage computersincome tax returnsdata processing https://avgeeks.videonest.co/videos/1460909/the-name-is-hesston-1969 https://img.videonest.org/gamma/1460909_thumbnail_resized_v2.webp https://gamma.videonest.org/1460909_video_v4.mp4 The Name is Hesston (1969) Discusses the diverse range of hay windrowers produced by H, a company that tailors its equipment to meet the unique needs of farmers across different regions. Each model, such as the Hydrostatic 620, PT12, H 500, H 300, H 320, and PT10, is designed for specific farming conditions, offering features like powerful engines, improved maneuverability, and enhanced durability. The machines are built to handle various crops efficiently, ensuring high-quality hay production while minimizing maintenance and operational costs. H emphasizes its commitment to providing specialized solutions for farmers, highlighting the importance of understanding the unique challenges faced in different agricultural environments. Keywords: H, windrowers, Hydrostatic 620, PT12, H 500, H 300, H 320, PT10, agriculture, hay production, farmers, specialized equipment, durability, maneuverability, engine power, maintenance, operational costs, crop handling. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-26T16:01:20.000Z yes A/V Geeks 16mm Films no 1196 Hesstonhay windrowerwindrowerfarmingfarm equipmenthay harvestingHesston 620Hesston PT-12Hesston 500Hesston 300Hesston 320Heston Corporationcrop harvestinghaymakingfarming equipment https://avgeeks.videonest.co/videos/1460910/av-geeks-16mm-lunch-9-25-2025 https://img.videonest.org/gamma/1460910_thumbnail_resized_v2.webp https://gamma.videonest.org/1460910_video_v5_360.mp4 AV Geeks 16mm Lunch 9-25-2025 We've watch over 6700 16mm films on this streaming show! But we have so many more to go! #16mmfilms #avgeeks [Untitled Wilding Driver Safety film] Pictures of Health: Genetic Platforms A Short Walk to Trumbull Street The Money Tree 2025-09-26T06:11:13.000Z yes A/V Geeks 16mm Films no 4011 https://avgeeks.videonest.co/videos/1460911/of-natural-concern-1969 https://img.videonest.org/gamma/1460911_thumbnail_resized_v2.webp https://gamma.videonest.org/1460911_video_v4.mp4 Of Natural Concern (1969) Discusses the significant gap between environmental rhetoric and action, highlighting a recent Senate hearing in Pennsylvania where no conservation organizations or student groups attended. It emphasizes the need for local involvement in environmental issues, particularly through watershed associations, which work to address pollution and promote conservation. The Brandywine Valley Association and Slippery Rock Creek Watershed Association are cited as successful examples of local efforts to clean up streams and manage agricultural practices to reduce siltation. The text also mentions the impact of industrial waste and the importance of community organization in addressing environmental challenges. Overall, it advocates for local action and education as essential tools for environmental preservation and restoration. Keywords: environment, pollution, watershed associations, Brandywine Valley, Slippery Rock Creek, conservation, local action, community organization, siltation, industrial waste, education, environmental restoration. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-26T04:00:40.000Z yes A/V Geeks 16mm Films no 1190 Pennsylvaniawater pollutionclean waterwatershed associationBrandywine Valleymine reclamationindustrial wasteacid mine drainageStream RestorationCommunity ActivismEnvironmental ConservationLand AbuseWater QualityEnvironmental ProtectionEnvironmental Education https://avgeeks.videonest.co/videos/1460912/refinish-sales-1970 https://img.videonest.org/gamma/1460912_thumbnail_resized_v2.webp https://gamma.videonest.org/1460912_video_v4.mp4 Refinish Sales (1970) Puncuated by go-go dancers this film revolves around an automobile dealer who is approached by representatives discussing the potential profitability of his paint and body shop. They emphasize that many dealerships overlook the significant business opportunities in paint and body work, particularly from customers who pay out-of-pocket for repairs not covered by insurance. The representatives suggest implementing a commission system for service salesmen to incentivize them to sell paint and body jobs, as well as improving the shop's visibility and efficiency. They highlight the importance of customer attitude towards body work and the need for skilled craftsmen. Ultimately, they argue that enhancing the paint and body shop can lead to increased overall dealership profits and customer satisfaction. Keywords: automobile dealer, paint and body shop, profitability, insurance claims, customer service, commission system, sales incentive, skilled craftsmen, customer attitude, dealership profits, business opportunities, repair work, efficiency, customer satisfaction. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-25T16:01:07.000Z yes A/V Geeks 16mm Films no 1214 Refinish SalesE. I. du PontAutomobile DealerPaint and BodyBusiness Advertisementcar refinishingcommission systemcustomer serviceservice salesmanbody shopautomotive repairsales techniquesprofitabilityauto refinishingemployee training https://avgeeks.videonest.co/videos/1460913/av-geeks-16mm-lunch-9-24-2025 https://img.videonest.org/gamma/1460913_thumbnail_resized_v2.webp https://gamma.videonest.org/1460913_video_v5_360.mp4 AV Geeks 16mm Lunch 9-24-2025 Since it's Wednesday, you should take a break and watch some old 16mm films with us! #16mmfilms #avgeeks Others Magnets: The Dragon's Secret If Doesn't Work, Complain.. Tale of Rumpelstilskin 2025-09-25T06:18:58.000Z yes A/V Geeks 16mm Films no 4270 https://avgeeks.videonest.co/videos/1460914/fair-warning-1976 https://img.videonest.org/gamma/1460914_thumbnail_resized_v2.webp https://gamma.videonest.org/1460914_video_v4.mp4 Fair Warning (1976) Describes a workplace incident where an employee, Tom, expresses concern about safety due to stacked materials. Despite his warnings, his supervisor, Ed, dismisses his complaints, leading to an accident. Tom's frustration culminates in his decision to quit, highlighting the importance of addressing employee complaints seriously. The narrative emphasizes the need for managers to recognize warning signs, actively listen to complaints, and take appropriate action to resolve issues. It outlines a four-step process for managers: stop, look, listen, and act, to ensure employee concerns are addressed effectively. Keywords: employee complaints, safety, supervisor, accident, frustration, quit, warning signs, listening, action, management, workplace, communication, resolution, respect, attention. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-25T04:00:04.000Z yes A/V Geeks 16mm Films no 946 Employee complaintsworkplace complaintsworker safetysupervisormanagermanager trainingleadership skillsactive listeningproblem solvingmanagement trainingemployee relationsworkplace communicationwarehousehard hatssafety discussion https://avgeeks.videonest.co/videos/1460915/how-to-enjoy-trout-fishing-1969 https://img.videonest.org/gamma/1460915_thumbnail_resized_v2.webp https://gamma.videonest.org/1460915_video_v4.mp4 How To Enjoy Trout Fishing (1969) The Keel Fly Co. shows us an idyllic fishing trip. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-24T16:00:43.000Z yes A/V Geeks 16mm Films no 1275 Trout fishingKeel Fly CoJackson H. Bensleyfishing lurenature scenerytrout fishfishing rodfly fishingrivercanoenaturewildlifescenicbarbecueautumn https://avgeeks.videonest.co/videos/1460916/av-geeks-16mm-lunch-9-23-2025 https://img.videonest.org/gamma/1460916_thumbnail_resized_v2.webp https://gamma.videonest.org/1460916_video_v5_360.mp4 AV Geeks 16mm Lunch 9-23-2025 Back in Raleigh, with so many things to watch and share! #16mmfilms #avgeeks The Rapture Visit to a County Fair I Like Bikes, But.. Voluntary Story 2025-09-24T06:13:00.000Z yes A/V Geeks 16mm Films no 4088 https://avgeeks.videonest.co/videos/1460917/success-1969 https://img.videonest.org/gamma/1460917_thumbnail_resized_v2.webp https://gamma.videonest.org/1460917_video_v4.mp4 Success (1969) Outlines a program developed by Western Auto to enhance the success of its automotive service department. It introduces a commission structure that allows service personnel to earn up to 40% of the income generated beyond their base pay. The program includes competitive pricing on services, advertising strategies, and training resources to improve sales and customer service. Key points emphasize the importance of customer interaction, efficient service, and the use of safety checks to identify additional service opportunities. The overall goal is to increase both store sales and personal earnings for employees. Keywords: Western Auto, automotive service, commission plan, customer service, sales program, training, advertising, safety check, efficiency, income increase, service department, success story. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-24T04:00:42.000Z yes A/V Geeks 16mm Films no 1188 Western AutoAutomotive Serviceservice technicianshock replacementautomotive departmentsales programservice departmentcustomer servicesafety checkshock absorberscar maintenancetire wearoriginal equipmentVehicle safetyBrake inspection https://avgeeks.videonest.co/videos/1460918/high-approaches-1968 https://img.videonest.org/gamma/1460918_thumbnail_resized_v2.webp https://gamma.videonest.org/1460918_video_v4.mp4 High Approaches (1968) Reflects on the experiences and memories associated with Sweet Brier, a college that symbolizes growth, adventure, and personal development. It emphasizes the beauty of change, the importance of friendship, and the nurturing environment that fosters intellectual and emotional growth. The narrative highlights the college's rich traditions, artistic endeavors, and the supportive relationships between faculty and students. Sweet Brier is portrayed as a holistic place that combines academic rigor with spiritual and personal enrichment, creating a vibrant community for its students. Keywords: Sweet Brier, growth, adventure, change, friendship, personal development, nurturing environment, traditions, arts, faculty-student relationships, holistic education, community, enrichment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-23T16:00:28.000Z yes A/V Geeks 16mm Films no 838 Sweet Briar Collegecampus lifecollege campusdorm lifestudent activitiescollege friendstennisfield hockeyhorseback ridingfine artsgirls schoolhigher educationcollege lifeVirginiaintellectual growth https://avgeeks.videonest.co/videos/1460919/the-makeup-of-matter-1963 https://img.videonest.org/gamma/1460919_thumbnail_resized_v2.webp https://gamma.videonest.org/1460919_video_v4.mp4 The Makeup of Matter (1963) The film explains the concept of matter, defining three types: solids, liquids, and gases. It introduces molecules, atoms, and elements, and distinguishes between mixtures and compounds. Through examples, it illustrates how matter changes form, such as a flash bulb's wire turning into powder, and how different materials can combine to form new substances or remain as mixtures. The film emphasizes that everything around us is made of matter, which takes up space and has weight. Keywords: matter, solids, liquids, gases, molecules, atoms, elements, mixtures, compounds, flash bulb, powder, sugar, sand, baking soda, vinegar, carbon dioxide, rust. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-23T04:00:13.000Z yes A/V Geeks 16mm Films no 799 mattersolidsliquidsgasesmoleculesatomselementsmixturescompoundschemical compoundchemical reactionbaking sodavinegarcarbon dioxideeducational film https://avgeeks.videonest.co/videos/1460920/av-geeks-16mm-lunch-9-22-2025 https://img.videonest.org/gamma/1460920_thumbnail_resized_v2.webp https://gamma.videonest.org/1460920_video_v5_360.mp4 AV Geeks 16mm Lunch 9-22-2025 Strangers! Should we avoid them? Join us and find out! #avgeeks #16mmfilms Cautious Twins Meeting Strangers: Red Light, Green Light Dangerous Stranger (2nd ed) Development of the Smile and the Fear of Strangers Staying Away from Strangers 2025-09-22T17:00:06.000Z yes A/V Geeks 16mm Films no 4268 https://avgeeks.videonest.co/videos/1460921/the-part-you-play-1966 https://img.videonest.org/gamma/1460921_thumbnail_resized_v2.webp https://gamma.videonest.org/1460921_video_v4.mp4 The Part You Play (1966) EG Marshall, an actor, discusses his new role as a volunteer worker for the United Campaign, emphasizing the importance of community support. He highlights how contributions help various individuals, including children and those facing hardships, to become self-sufficient and productive members of society. Marshall explains that the funds raised go towards essential services and rehabilitation efforts, benefiting both youth and adults in need. He encourages everyone to pledge their fair share to support these initiatives, stressing that collective contributions can make a significant impact. Keywords: EG Marshall, actor, volunteer, United Campaign, community support, contributions, self-sufficiency, rehabilitation, youth, adults, pledge, fair share, essential services, collective impact. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-22T16:00:57.000Z yes A/V Geeks 16mm Films no 687 E.G. MarshallUnited CampaignCommunity supportDonationsRehabilitation servicesVolunteer workFair share pledgesSalvation ArmyRed CrossFamily CounselingNatural disasterUSOWater safetyFirst aidSupporting role https://avgeeks.videonest.co/videos/1460922/old-recipes-new-ideas-1959 https://img.videonest.org/gamma/1460922_thumbnail_resized_v2.webp https://gamma.videonest.org/1460922_video_v4.mp4 Old Recipes New Ideas (1959) Discusses the nostalgia associated with old cookbooks and the challenges modern women face in cooking compared to their grandmothers. It highlights the differences in measurement and cooking methods, emphasizing the need for precision and convenience in contemporary cooking. The speaker reflects on how modern techniques, such as using bottled lemon juice, allow for more consistent results than the guesswork involved in traditional recipes. Ultimately, it suggests that while today's homemakers may appreciate old recipes, they will adapt them in ways that previous generations could not have imagined. Keywords: old cookbook, nostalgia, cooking, grandma, measurements, precision, convenience, modern techniques, bottled lemon juice, consistency, homemaker, adaptation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-22T04:00:06.000Z yes A/V Geeks 16mm Films no 270 old cookbooknostalgiacookinggrandmameasurementsprecisionconveniencemodern techniquesbottled lemon juiceconsistencyhomemakeradaptationvintage recipes https://avgeeks.videonest.co/videos/1460923/a-kitchen-is-a-feminine-thing-1959 https://img.videonest.org/gamma/1460923_thumbnail_resized_v2.webp https://gamma.videonest.org/1460923_video_v4.mp4 A Kitchen Is A Feminine Thing (1959) George, a research engineer, initially believed that women couldn't excel in practical roles, but he is learning otherwise. The text discusses modern kitchen innovations that enhance homemaking, such as frostproof refrigerators and convenient layouts that allow for efficient multitasking. It highlights the benefits of food freezers for meal preparation and storage, enabling families to enjoy a variety of dishes without the hassle of leftovers. The kitchen is portrayed as a feminine space that serves as the heart of family life, filled with creative ideas and conveniences that make it enjoyable for everyone. Keywords: George, research engineer, homemaking, feminine ideas, kitchen innovations, frostproof refrigerator, food freezer, meal preparation, family life, convenience, modern equipment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-21T16:00:46.000Z yes A/V Geeks 16mm Films no 297 Frigidaire1950shome applianceskitchenhomemakingfood freezerfrostproof refrigeratormeal preparationfamily liferetrovintagefeminine ideasGeorgeresearch engineer https://avgeeks.videonest.co/videos/1460924/you-bet-your-life-1967 https://img.videonest.org/gamma/1460924_thumbnail_resized_v2.webp https://gamma.videonest.org/1460924_video_v4.mp4 You bet your life! (1967) Emphasizes the importance of safe driving and the critical role of high-quality tires in preventing accidents. It highlights the dangers of driving, including the high number of fatalities and injuries each year due to carelessness, speed, and inadequate tire maintenance. The General Dual 90 tire is presented as a superior option, designed to enhance safety through advanced materials and construction, including puncture sealing and improved tread depth. The message encourages drivers to prioritize safety by investing in quality tires to protect themselves and their loved ones while enjoying the freedom of driving. Keywords: driving, safety, accidents, tires, General Dual 90, puncture sealing, carelessness, speed, fatalities, injuries, quality, performance, family, adventure, maintenance. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-21T04:01:03.000Z yes A/V Geeks 16mm Films no 523 safe drivingtire safetyGeneral TireDual 90tire maintenancevehicle safetyautomobile safetyroad safetydriving hazardtire performancepuncture sealingDuragen rubbertwin treadsradial tirecar accident https://avgeeks.videonest.co/videos/1460925/drugs-the-children-are-choosing-1970 https://img.videonest.org/gamma/1460925_thumbnail_resized_v2.webp https://gamma.videonest.org/1460925_video_v4.mp4 Drugs: The Children Are Choosing (1970) James Fatiman introduces a program that explores the complex issues surrounding drug use, particularly among children in elementary and junior high schools. He highlights the rising concern of drug use among youth, noting that many children are aware of peers using drugs. The program will feature various perspectives on drug use, including the misuse of amphetamines and the psychological factors driving individuals to drugs. Experts will discuss the societal pressures, advertising influences, and the normalization of drug use in American culture. The series aims to educate young people about drugs, enabling them to make informed decisions. Keywords: James Fatiman, drug use, children, elementary schools, junior high schools, amphetamines, drug abuse, psychological dependence, societal pressures, advertising, drug culture, education, informed decisions, youth experimentation, communication breakdown, peer pressure, identity, drug influences. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-21T04:01:02.000Z yes A/V Geeks 16mm Films no 1773 James FadimanDrug AbuseDrug useDrug EducationElementary SchoolTeenagersMarijuanaDrug ExperimentationPeer PressureYouthYouth CultureAmphetamineAddictionDrug CultureCommunication Breakdown https://avgeeks.videonest.co/videos/1460926/subject-narcotics-1951 https://img.videonest.org/gamma/1460926_thumbnail_resized_v2.webp https://gamma.videonest.org/1460926_video_v4.mp4 Subject: Narcotics (1951) Discusses the pervasive issue of narcotic addiction in society, highlighting the devastating effects of drugs like heroin, opiates, and marijuana. It describes the cycle of addiction, withdrawal symptoms, and the desperate measures addicts take to obtain drugs. The text emphasizes the need for prevention, education, and stronger laws to combat drug trafficking and addiction. It also notes the challenges faced by law enforcement in addressing the narcotics problem and the psychological struggles of recovering addicts. Keywords: narcotic addiction, withdrawal symptoms, heroin, opiates, marijuana, prevention, education, drug trafficking, law enforcement, psychological struggles, addiction cycle, social problem. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-20T16:01:25.000Z yes A/V Geeks 16mm Films no 1289 narcoticsheroinmarijuanadrug addictiondrug abuselaw enforcementdrug traffickingopioidsdrug peddlingnarcotic addictiondrug controldrug addictAddictionSocial problemOpium https://avgeeks.videonest.co/videos/1460927/david-hall-story-1963 https://img.videonest.org/gamma/1460927_thumbnail_resized_v2.webp https://gamma.videonest.org/1460927_video_v4.mp4 David Hall Story (1963) **The David Hall Story (1963)** – Safety film in which David Hall, *America’s Handicapped Man of the Year*, recounts the car accident that left him paralyzed. Through his personal testimony and medical footage, he delivers a cautionary message to young drivers about the lifelong consequences of reckless driving. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-20T04:01:00.000Z yes A/V Geeks 16mm Films no 1293 David Hallcar accidenttraffic accidentsdriving safetyaccident preventioninjuryspinal cordrehabilitationsafe drivingseatbelt safetymotor vehicle accidentEmployers' Mutuals of Wausaumedicaldefensive drivingAmerica's Handicapped https://avgeeks.videonest.co/videos/1460928/av-geeks-16mm-lunch-9192025 https://img.videonest.org/gamma/1460928_thumbnail_resized_v2.webp https://gamma.videonest.org/1460928_video_v4.mp4 A/V Geeks 16mm Lunch 9/19/2025 We're in Austin but still gotta show you some 16mm goodies! #avgeeks #16mmfilms What's In a Shadow? Clay in Action History of Photography Deaf Child Speaks Responsibility 2025-09-19T17:00:06.000Z yes A/V Geeks 16mm Films no 3832 Skip ElsheimerAV Geeks16mmfilmsShadow diagramclay sculpturephotography historydeaf educationsundialsclaysculpturecamera obscuraphotographyEastman Houseoral educationspecial education https://avgeeks.videonest.co/videos/1460929/memo-to-mars-1954 https://img.videonest.org/gamma/1460929_thumbnail_resized_v2.webp https://gamma.videonest.org/1460929_video_v4.mp4 Memo To Mars (1954) Film starts at the offices of Martian Planetary Products Incorporated, where employees discuss the challenges of marketing a new car model on Earth. The protagonist, Mac, shares insights from his recent trip to Earth, highlighting the issues faced by people due to traffic congestion and inadequate road conditions. He observes that while there is a demand for their car model, the existing infrastructure is failing to support the needs of the population. The narrative emphasizes the interconnectedness of individuals in the economy and the urgent need for community action to address road and traffic issues. Keywords: Martian Planetary Products, Earth, traffic congestion, road conditions, marketing, car model, infrastructure, economy, community action, sales, observations, challenges, employees, conversation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-19T16:00:14.000Z yes A/V Geeks 16mm Films no 1347 memo to marstraffic congestionroad conditionscar trafficretro videotransportation infrastructurecity planningeconomic interdependencecommunity involvementroad constructionhighwaysgood roadsUnited States Rubber Companymotor vehiclesparking scarcity https://avgeeks.videonest.co/videos/1460930/back-door-to-japan-1944 https://img.videonest.org/gamma/1460930_thumbnail_resized_v2.webp https://gamma.videonest.org/1460930_video_v4.mp4 Back Door To Japan (1944) Discusses the strategic efforts during World War II to establish a second front against Japan through the construction of supply routes in Asia. It highlights the challenges faced by Allied forces, particularly General Stillwell and his troops, as they fought to secure the Mitchino airfield in Burma. The narrative emphasizes the importance of building a reliable supply line from Kolkata, India, through the Leo road to support military operations in the Pacific. Despite facing harsh conditions, including monsoons and enemy resistance, the Allied forces ultimately succeeded in capturing Mitchino, paving the way for a more robust supply chain to support the war effort against Japan. Keywords: World War II, second front, Japan, supply routes, Allied forces, General Stillwell, Mitchino airfield, Kolkata, Leo road, military operations, monsoons, resistance, victory. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-19T04:00:12.000Z yes A/V Geeks 16mm Films no 899 World War IIMyitkyina AirfieldLedo RoadJoseph StilwellBurma CampaignMilitary campaignAllied ForcesMerrill's Maraudersair transportjungle warfareAmerican soldiersMonsoonwar film https://avgeeks.videonest.co/videos/1460931/av-geeks-16mm-lunch-9-18-2025 https://img.videonest.org/gamma/1460931_thumbnail_resized_v2.webp https://gamma.videonest.org/1460931_video_v4.mp4 AV Geeks 16mm Lunch 9 18 2025 Tiki Thursday. Let's watch films about Hawaii and Bali from our rum-soaked chairs at a Tiki Bar! #avgeeks #16mmfilms Hawaiian Dances Hawaii's Spectacular Volcano Eruptions Beautiful Bali Holiday in Hawaii Hawaii Serenade 2025-09-18T17:00:06.000Z yes A/V Geeks 16mm Films no 3686 HawaiiBalivolcanic eruptionBalinese dancehula dancelava flowstiki barHawaiian cultureisland lifevolcanoBalinese cultureAlohaDiamond HeadTravel https://avgeeks.videonest.co/videos/1460932/bridging-san-francisco-bay-1937 https://img.videonest.org/gamma/1460932_thumbnail_resized_v2.webp https://gamma.videonest.org/1460932_video_v4.mp4 Bridging San Francisco Bay (1937) Bridging San Francisco Bay (c. 1937) is a black-and-white sponsored film produced by the Handy (Jam) Organization for U.S. Steel Co. It documents the monumental construction of the San Francisco–Oakland Bay Bridge, completed in 1936, and showcases the engineering achievement as well as the role of American industry. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-18T16:01:35.000Z yes A/V Geeks 16mm Films no 1041 San Francisco Bay BridgeSan FranciscoOaklandbridge constructionsuspension bridgeAmerican ingenuityUnited States Steelengineering featssteel cablesYerba Buena Islandbridge towercable spinningbridgemenstructural engineeringtransportation https://avgeeks.videonest.co/videos/1460933/the-things-people-want-1948 https://img.videonest.org/gamma/1460933_thumbnail_resized_v2.webp https://gamma.videonest.org/1460933_video_v4.mp4 The Things People Want (1948) Produced in 1948 by the Handy (Jam) Organization for the Chevrolet Division of General Motors, The Things People Want is a sales training film designed to teach the fundamentals of effective selling. Shot in black and white and starring John Forsythe, the film blends dramatization with instructional guidance. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-18T04:00:15.000Z yes A/V Geeks 16mm Films no 1207 John Forsythesales trainingsellingsalesmanshipcustomer needsproduct knowledgehandling peoplesales techniquecustomer serviceask questionsprospect talkrepeat objectioncomforteconomydurability https://avgeeks.videonest.co/videos/1460934/av-geeks-16mm-lunch-9-17-2025 https://img.videonest.org/gamma/1460934_thumbnail_resized_v2.webp https://gamma.videonest.org/1460934_video_v4.mp4 AV Geeks 16mm Lunch 9-17-2025 Someimes it's murder to show films to folks every weekday, especially when you are traveling. But here we are.. #avgeeks #16mmfilms Murderous Midget Fish It's Murder Six Murderous Beliefs It's Wanton Murder Murder on the Screen It's Murder She Says 2025-09-17T17:00:06.000Z yes A/V Geeks 16mm Films no 3735 16mm filmA/V GeeksMurderous Midget FishWorld War IIAmphibious TroopsAviation SafetyWoodworking safetyDriving safetyFilm PreservationFilm cleaningMosquitoCartoonAnimationSafety FilmsNational Safety Council https://avgeeks.videonest.co/videos/1460935/a-really-spectacular-true-story-1960s https://img.videonest.org/gamma/1460935_thumbnail_resized_v2.webp https://gamma.videonest.org/1460935_video_v4.mp4 A really spectacular true story. (1960s) A discussion between an automobile dealer and a group of individuals trying to convince him to improve his paint and body shop operations. They discuss the potential profitability of paint and body work, emphasizing that many customers are unaware of the need for such services. The conversation highlights the importance of selling ding and dent repairs, improving customer awareness, and incentivizing service staff to promote these services. The dealer learns that there is significant untapped business in his area and that enhancing his body shop could lead to increased profits and customer satisfaction. Keywords: automobile dealer, paint and body shop, profitability, service department, customer awareness, ding and dent repairs, sales incentives, business potential, customer satisfaction, service profits. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-17T16:02:01.000Z yes A/V Geeks 16mm Films no 1214 automobiledealershippaint and body shopprofitabilitycustomer serviceding and dent repairsales techniquesauto repaircar repairbody workinsurance claimscar salesauto refinishingrefinishingpaint job https://avgeeks.videonest.co/videos/1460936/av-geeks-16mm-lunch-9-16-2025 https://img.videonest.org/gamma/1460936_thumbnail_resized_v2.webp https://gamma.videonest.org/1460936_video_v4.mp4 AV Geeks 16mm Lunch 9-16-2025 Do we watch vintage 16mm films every Tuesday? Tune in and find out! #16mmfilms #avgeeks The Makeup of Matter Mission to Earth, Part 2, Life-forms and Resources Loads on Structures [Short Subjects, home movies] 2025-09-17T06:12:17.000Z yes A/V Geeks 16mm Films no 3969 16mm filmEducational FilmMakeup of MatterMission to EarthLoads on StructuresMatterLife FormsEcologyResource UtilizationStructural EngineeringStatic LoadDynamic LoadAV GeeksFilm ArchiveNatural Disasters https://avgeeks.videonest.co/videos/1460937/anger-at-work-1956 https://img.videonest.org/gamma/1460937_thumbnail_resized_v2.webp https://gamma.videonest.org/1460937_video_v4.mp4 Anger At Work (1956) Anger at Work: The Story of the Headache Switch is a 1956 educational film produced by the University of Oklahoma for the Oklahoma State Department of Health’s Mental Hygiene Division. Distributed by the International Film Bureau, it belongs to a series on emotional problems in the workplace. The film uses dramatized office and factory scenarios to illustrate how suppressed anger can manifest in indirect ways—particularly through physical symptoms like headaches or ulcers—and how this displacement can cause harm at work, at home, and in broader social interactions. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-17T04:00:56.000Z yes A/V Geeks 16mm Films no 1247 Anger at Workanger managementworkplace conflictworkplaceEmotional healthEmployee wellnessTension managementOffice workStress managementDealing with stressMental healthEmployee relationsUniversity of OklahomaInternational Film Bureau1950s https://avgeeks.videonest.co/videos/1460938/man-and-the-moon-1955 https://img.videonest.org/gamma/1460938_thumbnail_resized_v2.webp https://gamma.videonest.org/1460938_video_v4.mp4 Man And The Moon (1955) Walt Disney hosts this film that describes the challenges and plans for a future trip to the moon, emphasizing the moon's inhospitable environment and the need for advanced technology to facilitate space travel. Dr. Wernher von Braun outlines a two-phase journey: first, launching a rocket from Earth to orbit, and then refueling in space to continue to the moon. An advanced space station will serve as a base for operations, featuring living quarters and various sections for communication, weather observation, and emergency medical care. The narrative details the construction of the space station, the design of the moon rocket, and the crew's preparations for the voyage. The first mission aims to scout the moon without landing, testing equipment for future deep space exploration. The text concludes with the successful completion of the mission and hints at future expeditions to Mars. Keywords: moon trip, space exploration, Dr. Wernher von Braun, rocket launch, space station, refueling, crew, moon scouting, deep space, technology, construction, mission success, Mars exploration. 2025-09-16T16:01:00.000Z yes A/V Geeks 16mm Films no 1238 space explorationmoon travelWernher von Braunspace stationlunar voyagerocket launchspaceshipatomic reactorpressurized space suitfuture moonmoon missionspacecraftrocket shipmoon surfaceMars https://avgeeks.videonest.co/videos/1460939/av-geeks-16mm-lunch-9-15-2025 https://img.videonest.org/gamma/1460939_thumbnail_resized_v2.webp https://gamma.videonest.org/1460939_video_v5_360.mp4 AV Geeks 16mm Lunch 9-15-2025 The start of the work week doesn't mean that you can't take a break and watch some old 16mm films. #16mmfilms #avgeeks Lighter Than Air The High Approaches Life Times Nine London Fire Raids 2025-09-16T06:28:27.000Z yes A/V Geeks 16mm Films no 4461 16mm filmvintage filmarchival footageairshipsWorld War IILondon Fire RaidsSweet Briar Collegelighter than airfirefightersLondon Blitzhistorical footageeducationcollege lifedirigibleaviation https://avgeeks.videonest.co/videos/1460940/unc-high-school-institute-1971-silent https://img.videonest.org/gamma/1460940_thumbnail_resized_v2.webp https://gamma.videonest.org/1460940_video_v4.mp4 UNC High School Institute 1971 (silent) From a summer filmmaking workshop for high school students. The footage opens with an individual lying on the ground, hinting at a moment of vulnerability or reflection. This scene transitions to a person gazing through a window of an ivy-covered building, suggesting a connection to nature and history. The next segment shifts from a black screen to an intimate outdoor conversation between two individuals, creating a sense of closeness and personal connection. Following this, a man walks along a stone wall in a black and white setting, evoking a nostalgic or timeless atmosphere. The narrative continues with a lively park setting, showcasing various interactions and activities, from people enjoying leisurely meals to experiencing more tense encounters, highlighting the spectrum of human emotions and interactions. Lastly, a person is seen approaching a brick building—likely a school or office—accompanied by a bicycle and a vintage car, further emphasizing the mid-20th-century vibe and grounding the scenes in a specific time and place. Overall, the footage captures a tapestry of moments that reflect both personal connections and the broader social environment. #vulnerability #nature connection #intimate conversations #nostalgic atmosphere #human interactions Timeline 00:00:00 - 00:05:29 Unidentified Person on Ground and Peering Through Window 00:01:05 An individual is shown lying on a paved surface with arms outstretched, appearing unconscious or resting. 00:04:19 A person is then seen peering through a window of an old, ivy-covered building, suggesting curiosity or investigation. 00:05:29 - 00:08:00 Outdoor Conversation and Walk 00:05:29 The segment begins with a black screen, indicating a lack of visual content or a scene transition. 00:05:42 Two individuals are shown in a dimly lit outdoor setting, engaged in a serious or intimate conversation. 00:06:20 A man in casual attire walks along a path next to an ivy-covered stone wall, captured in a black and white, vintage-like scene. 00:08:00 - 00:12:00 Park Interactions 00:08:51 A man enjoys a meal of a sandwich and a drink while sitting on a park bench amidst trees and green space. 00:09:17 A person walks through a park with trees and a lawn in the background, carrying a bag in a grayscale or low-light setting. 00:10:05 An individual sits on a bench in a park, observing another person walking along a path, with an obelisk monument in the background. 00:10:18 Two individuals are involved in a tense interaction in the park, with a man attempting to take a handbag from a woman, as another person stands nearby. 00:12:00 - 00:13:08 Arrival at a Brick Building 00:12:33 A person walks towards the entrance of a brick building, which could be a school or an office. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-16T04:00:01.000Z yes A/V Geeks 16mm Films no 789 staged violencefilm makingcollege studentsparkblack and whitecrimeassaultsmokingcigarettelow budgetrunning https://avgeeks.videonest.co/videos/1460941/for-parents-only-what-kids-think-about-marijuana https://img.videonest.org/gamma/1460941_thumbnail_resized_v2.webp https://gamma.videonest.org/1460941_video_v4.mp4 For Parents Only: What Kids Think About Marijuana Discusses the experiences and perspectives of young people regarding marijuana use, starting from their early encounters with it and the social dynamics surrounding its consumption. It highlights the influence of peer pressure, the perceived benefits of being high, and the normalization of marijuana in their culture. The narrative also touches on the negative impacts of marijuana on academic performance, family relationships, and overall well-being. Parents are encouraged to engage with their children, form support groups, and take a proactive stance against drug use, emphasizing the importance of communication and understanding. Keywords: marijuana, youth, peer pressure, high school, drug use, family dynamics, academic performance, support groups, communication, normalization, culture, addiction, health risks, social influence, boredom, creativity, parenting. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-15T16:01:39.000Z yes A/V Geeks 16mm Films no 1744 marijuanayouthpeer pressuredrug useteenagersparentinghigh schoolcannabisteen culturestudent lifedrug preventionsubstance abusefamily supportdrug abusechild development https://avgeeks.videonest.co/videos/1460942/human-use-of-space-technology-1986 https://img.videonest.org/gamma/1460942_thumbnail_resized_v2.webp https://gamma.videonest.org/1460942_video_v4.mp4 Human Use Of Space Technology (1986) Discusses the profound impact of space exploration technology on life on Earth. It highlights how advancements in satellite technology have revolutionized communication, education, and medicine. For instance, satellite imagery can provide early warnings of famine, and remote communities like Shisharf have gained access to education and healthcare through satellite TV and telemedicine. The text also emphasizes the technological revolution spurred by the space race, leading to innovations in computerization and miniaturization, which have transformed various industries, including healthcare. Overall, the narrative illustrates how the quest to explore space has inadvertently improved life on Earth in numerous ways. Keywords: space exploration, technology, satellite imagery, communication, education, medicine, Shisharf, telemedicine, technological revolution, computerization, miniaturization, healthcare, famine warning, remote communities. 2025-09-15T04:01:00.000Z yes A/V Geeks 16mm Films no 1359 Space TechnologySatellite CommunicationTechnological RevolutionComputerizationMiniaturization TechnologySatellite TVMedical DevicesSpace ProgramSpace RaceEcho SatelliteShishmarefMedical Device IndustryOuter SpaceTelevisionIBM https://avgeeks.videonest.co/videos/1460943/hands-1969 https://img.videonest.org/gamma/1460943_thumbnail_resized_v2.webp https://gamma.videonest.org/1460943_video_v4.mp4 Hands (1969) Hands is a visually experimental short film that uses close-ups and expressive movements of human hands to explore themes of biology, sociology, and aesthetics. Through striking imagery, it highlights how hands serve as tools of survival, communication, labor, creation, and even danger. The film juxtaposes tender gestures with more unsettling or surreal images, creating moments of intensity that feel almost shocking. As the narrative unfolds, the sequences become less structured—shifting from bold, provocative scenes to looser, more meandering imagery. While the first half is arresting in its visual power and metaphorical depth, the momentum fades toward the end, leaving the conclusion less impactful than the earlier sequences. 2025-09-14T16:00:11.000Z yes A/V Geeks 16mm Films no 656 human handhand featuresskin texturefingerprintmusical instrumentssculpturehandsarcheologyskeletal remainsartifactpotteryorchestral musicunityprotestraising arms https://avgeeks.videonest.co/videos/1460944/home-sweet-home-1970s https://img.videonest.org/gamma/1460944_thumbnail_resized_v2.webp https://gamma.videonest.org/1460944_video_v4.mp4 Home Sweet Home (1970s) Film describes the life of a rat in a once-proud neighborhood that has fallen into disrepair. The rat finds ample food and shelter due to the carelessness of the residents, who leave garbage and debris around. It highlights the rapid reproduction of rats and the significant damage they cause, including food destruction and potential fire hazards. The narrative emphasizes the importance of cleanliness and proper waste disposal to control the rat population. It provides practical tips for homeowners to eliminate rat habitats and prevent infestations, stressing that ongoing maintenance is crucial to keep rats away. Keywords: rat, neighborhood, garbage, food, shelter, reproduction, damage, cleanliness, waste disposal, control, homeowners, maintenance, infestation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-14T04:00:45.000Z yes A/V Geeks 16mm Films no 788 rat controlpest controlrodentsgarbagesanitationrat preventiontrash disposalhome repairseal openingshome improvementrat teethNorway ratsfilm libraryMilwaukee WisconsinKluge Production https://avgeeks.videonest.co/videos/1460945/healthwise-fitness-fun-1981 https://img.videonest.org/gamma/1460945_thumbnail_resized_v2.webp https://gamma.videonest.org/1460945_video_v4.mp4 Healthwise: Fitness Fun (1981) Features puppeting talking and singing about the importance of exercise and maintaining a healthy lifestyle. It features characters who express their feelings about different sports and activities, emphasizing that exercise is fun and essential for health. The narrative includes a visit to Dr. Jonas, who explains how the heart and lungs work together during exercise, highlighting the significance of physical activity for overall well-being. The characters encourage each other to stay active, enjoy various forms of exercise, and also stress the importance of relaxation and sleep for recovery. Keywords: exercise, health, fun, heart, lungs, activity, Dr. Jonas, muscles, relaxation, sleep, well-being, sports, fitness, growth. 2025-09-13T16:00:09.000Z yes A/V Geeks 16mm Films no 909 ExerciseHealthy livingHeartLungsHealth educationPhysical fitnessChildren PlayingRelaxationHealthy lifestyleStaying active1982Coronet Films & VideoHealth Care EducationTake III Video EducationArchival footage https://avgeeks.videonest.co/videos/1460946/av-geeks-16mm-lunch-9-12-2025 https://img.videonest.org/gamma/1460946_thumbnail_resized_v2.webp https://gamma.videonest.org/1460946_video_v4.mp4 AV Geeks 16mm Lunch 9-12-2025 Holy cow, it's Friday already! I guess this happens when you watch 16mm films all the time and don't look at a calendar. #16mmfilms #avgeeks Let's Talk The Little Mariner LDS Priesthood Restoration Assorted TV Commercials 2025-09-13T06:12:56.000Z yes A/V Geeks 16mm Films no 3931 16mm filmEncyclopaedia BritannicaThe Little MarinerLDS Priesthood RestorationcommercialJoseph SmithBook of Mormonsailboatbeachchildren playingold filmmovie trailersailingCaliforniafilm projector https://avgeeks.videonest.co/videos/1460947/happy-little-hamsters-1979 https://img.videonest.org/gamma/1460947_thumbnail_resized_v2.webp https://gamma.videonest.org/1460947_video_v4.mp4 Happy Little Hamsters (1979) Naami, a beautiful hamster, felt lonely until another hamster named Abdullah joined her. Despite their initial attraction, they struggled to live together harmoniously, leading to Abdullah leaving. Naami soon discovered she was pregnant and gave birth to eight healthy babies. As the babies grew, they became more active and playful, creating chaos for Naami. Eventually, the little hamsters became independent and were adopted by children as pets, leaving Naami feeling both proud and sad. Keywords: hamster, Naami, Abdullah, loneliness, pregnancy, babies, chaos, independence, pets, adoption, Aleppo, Syria, quarrels, motherhood, nurturing, growth, playfulness, children. 2025-09-13T04:00:32.000Z yes A/V Geeks 16mm Films no 844 Happy Little Hamstershamsterbaby hamsterspet hamstersgolden hamsteranimal behaviorhamster growthbaby hamster developmentnesthamster litterrodentpetchildrenyoung hamstershoarding food https://avgeeks.videonest.co/videos/1460948/av-geeks-16mm-lunch-9-10-2025 https://img.videonest.org/gamma/1460948_thumbnail_resized_v2.webp https://gamma.videonest.org/1460948_video_v5_360.mp4 AV Geeks 16mm Lunch 9-10-2025 Is it all about the 16mm films.. really, Skip? Get a life! #16mmfilms #avgeeks Old Recipes, New Ideas Let's Count, 2nd Ed John Hooper's Way with Wood. Refinish Sales 2025-09-12T22:51:37.000Z yes A/V Geeks 16mm Films no 4065 https://avgeeks.videonest.co/videos/1460949/experience-with-an-electric-eel-1955 https://img.videonest.org/gamma/1460949_thumbnail_resized_v2.webp https://gamma.videonest.org/1460949_video_v4.mp4 Experience With An Electric Eel (1955) Dr Irwin Moon discusses the nature of questions in life, particularly those related to existence and faith. It highlights how people often focus on trivial questions while neglecting deeper, existential inquiries such as the purpose of life and the existence of God. The speaker addresses a specific question about the existence of "ugly" creatures in nature, suggesting that perspective plays a crucial role in understanding beauty and creation. The discussion transitions to the electric eel, illustrating its unique biological features and capabilities, which serve as a metaphor for the complexity of creation. The speaker emphasizes that understanding the world and its wonders often leads back to the idea of God as the creator. The text concludes with a call to explore faith scientifically, encouraging an open-minded approach to understanding God and personal experiences of faith. Keywords: questions, existence, faith, God, beauty, electric eel, perspective, creation, science, personal experience, open-mindedness. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-12T16:00:36.000Z yes A/V Geeks 16mm Films no 1406 electric eelchristian faithsciencescientific methodpersonal experienceGodAmazon riverLinnaeus electricusMoody Bible Institutecreationopen mindelectroplaxOrgan of Hunterugly creaturesDr. Moon https://avgeeks.videonest.co/videos/1460950/av-geeks-16mm-lunch-9-9-2025 https://img.videonest.org/gamma/1460950_thumbnail_resized_v2.webp https://gamma.videonest.org/1460950_video_v4.mp4 AV Geeks 16mm Lunch 9-9-2025 16mm for you, 16mm for me, 16mm for all of us! #16mmfilms #avgeeks Little Red Riding Hood (LCA) Inside/Out: Lost is the Feeling Let's Face It, Part 2 Lessons Learned from Aircraft Accidents - Emotions 2025-09-12T10:17:44.000Z yes A/V Geeks 16mm Films no 4079 https://avgeeks.videonest.co/videos/1460951/av-geeks-16mm-lunch-9-11-2025 https://img.videonest.org/gamma/1460951_thumbnail_resized_v2.webp https://gamma.videonest.org/1460951_video_v4.mp4 AV Geeks 16mm Lunch 9-11-2025 Let's ignore all the headlines today! Just bathe in the warm glow of old 16mm films! #16mmfilms #avgeeks The Part You Play Library World The Law, The Environment and You You Bet Your Life 2025-09-12T06:09:46.000Z yes A/V Geeks 16mm Films no 3760 16mm filmold filmvintageeducational filmUnited Wayenvironmental actionair pollutioncar crashestire safetyGeneral TirePennsylvaniaAllegheny National Forestlibraryschool childrenA/V Geeks https://avgeeks.videonest.co/videos/1460952/whats-the-big-hurry-1975 https://img.videonest.org/gamma/1460952_thumbnail_resized_v2.webp https://gamma.videonest.org/1460952_video_v4.mp4 What's The Big Hurry? (1975) This film illustrates that patience can lead to better outcomes and shows young people how to harness it effectively. It employs a comedic narrative featuring two brothers with contrasting personalities, presented in the style of early silent films, to highlight the value of patience in contrast to impatience. 2025-09-12T04:00:40.000Z yes A/V Geeks 16mm Films no 662 picnicchecklistpreparingDavid BatesLarry Conroyoutdoor activitieskite flyingfishingvintagecreditsfilm creditscomedySydney HoldenSheila LombardiPeter J. Ketchum https://avgeeks.videonest.co/videos/1460953/the-partys-over-1984 https://img.videonest.org/gamma/1460953_thumbnail_resized_v2.webp https://gamma.videonest.org/1460953_video_v4.mp4 The Party's Over (1984) Narrates the tragic story of Jim Kellogg, who, after a day of work and drinking, makes poor decisions that lead to a fatal accident. It highlights the dangers of drunk driving, emphasizing how alcohol impairs judgment and decision-making. The narrative illustrates the consequences of drinking and driving, including the potential for severe injury or death, not only to the driver but also to innocent victims, such as Jim's own son. The text stresses the importance of making responsible choices regarding alcohol consumption and driving. Keywords: drunk driving, Jim Kellogg, alcohol, impaired judgment, decision-making, consequences, fatal accident, responsibility, safety, Halloween, tragedy, injury, prevention, awareness. 2025-09-11T16:01:22.000Z yes A/V Geeks 16mm Films no 1199 drunk drivingJim Kelloggalcohol awarenessdriving while intoxicatedDUIpublic service announcementhighway safetydriver safetytraffic safetydrinking and drivingcar accidentssobrietyalcohol factsdriving disasterParker Productions https://avgeeks.videonest.co/videos/1460954/roman-wall-1956 https://img.videonest.org/gamma/1460954_thumbnail_resized_v2.webp https://gamma.videonest.org/1460954_video_v4.mp4 Roman Wall (1956) Emperor Hadrian ruled the Roman Empire at its peak in AD 117, advocating for consolidation rather than further expansion. He constructed Hadrian's Wall in Britain, marking the northern boundary of Roman rule. The wall, built of stone and approximately 80 Roman miles long, featured forts, mile castles, and turrets for defense and communication. Roman soldiers, skilled in various tasks, constructed the wall and its associated structures, which included barracks, granaries, and roads for troop movement and supply transport. Today, remnants of the wall and its features still exist, symbolizing the enduring legacy of the Roman Empire. Keywords: Hadrian, Roman Empire, consolidation, expansion, Hadrian's Wall, Britain, forts, mile castles, turrets, defense, communication, Roman soldiers, construction, legacy, remnants. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-11T04:00:35.000Z yes A/V Geeks 16mm Films no 628 Hadrian's WallRoman EmpireRoman armyHadrianRoman BritainRoman soldiersfortsdefensemilitary historyarchitectureRoman historyancient historywall constructionMilecastleTurret https://avgeeks.videonest.co/videos/1460955/john-hoopers-way-with-wood-1977 https://img.videonest.org/gamma/1460955_thumbnail_resized_v2.webp https://gamma.videonest.org/1460955_video_v4.mp4 John Hooper's Way With Wood (1977) Discusses the deep appreciation and respect for wood and trees, emphasizing their significance beyond mere resources. The speaker reflects on the experience of being in nature, the process of working with wood, and the importance of understanding its properties for effective use in furniture making. It highlights the challenges of the modern lumber industry, including the impact of machine-based processes on wood selection and quality. The speaker also shares insights on drying wood, the intricacies of woodworking techniques, and the mutual relationship between the craftsman and the material. Ultimately, it conveys a sense of connection to nature and the transformative journey of wood from tree to finished product. Keywords: wood, trees, nature, lumber industry, woodworking, furniture making, drying wood, craftsmanship, respect, transformation, appreciation, species, moisture, techniques. 2025-09-10T16:01:36.000Z yes A/V Geeks 16mm Films no 1126 John HooperWay with Woodwoodworkingfurniture makinglumber industrywoodtreescabinet makingdrying woodwoodcarvingoakbirchmaplewood sculptingtree carving https://avgeeks.videonest.co/videos/1460956/wages-and-production-1977 https://img.videonest.org/gamma/1460956_thumbnail_resized_v2.webp https://gamma.videonest.org/1460956_video_v4.mp4 Wages And Production (1977) Describes the experiences of Eleanor, who runs a furniture company, and her assistant Julian as they navigate the challenges of hiring and managing wages. Eleanor emphasizes the importance of paying competitive wages to attract workers while also managing costs effectively. Julian learns through trial and error that offering too high or too low wages can impact the business negatively. The narrative illustrates key economic concepts such as supply and demand for labor, the relationship between wages and hiring, and the effects of pricing on customer behavior. Keywords: Market Street, economics, Eleanor, furniture company, Julian, hiring, wages, competitive wage, labor supply, demand for labor, pricing, customer behavior, business management, economic concepts. 2025-09-10T04:00:49.000Z yes A/V Geeks 16mm Films no 1077 wagesproductionEleanorfurniturehiringcraftingemployeebusinesslabor economicswagelabor costsmarket wagesupply and demandMarket StreetJulian https://avgeeks.videonest.co/videos/1460957/walk-safely-1983 https://img.videonest.org/gamma/1460957_thumbnail_resized_v2.webp https://gamma.videonest.org/1460957_video_v4.mp4 Walk Safely (1983) Discusses pedestrian safety for children, emphasizing the importance of following specific rules to prevent accidents when crossing streets. It highlights that pedestrian accidents are more common among kids and outlines three key safety rules: always stop at the curb, look in all directions before crossing, and wait until it's safe to cross quickly while watching for traffic. The text also addresses dangers posed by parked cars, ice cream trucks, and the importance of being visible at night. The overall message is to be cautious and aware of surroundings to avoid accidents. Keywords: Cinderella, pedestrian safety, accidents, children, rules, curb, traffic, visibility, ice cream truck, parked cars, crosswalk, hospital, awareness, safety. 2025-09-09T16:00:14.000Z yes A/V Geeks 16mm Films no 787 pedestrian safetychild safetytraffic safetystreet crossingpedestrian accidentcar accidentice cream truckchild safety rulestrafficFiesta Filmsaccident preventioncurb safetyvisibilitychildrensafety https://avgeeks.videonest.co/videos/1460958/av-geeks-16mm-lunch-9-8-2025 https://img.videonest.org/gamma/1460958_thumbnail_resized_v2.webp https://gamma.videonest.org/1460958_video_v5_360.mp4 AV Geeks 16mm Lunch 9-8-2025 New week, more 16mm films to watch! #16mmfilms #avgeeks Lonely Scarecrow Human Use of Space Technology For Parents Only: What Kids Think About Marijuana 2025-09-09T15:35:08.000Z yes A/V Geeks 16mm Films no 4128 16mm filmA/V Geeksscarecrowspace technologymarijuana useteenagersparent educationdrug abusefarmsatellite communicationrural lifedrug culturepeer pressureNorth Carolinacannabis https://avgeeks.videonest.co/videos/1460959/urban-alternatives-1973 https://img.videonest.org/gamma/1460959_thumbnail_resized_v2.webp https://gamma.videonest.org/1460959_video_v4.mp4 Urban Alternatives (1973) Discusses the various problems faced by urban environments, such as crowding, decay, and inefficiency, and emphasizes the need for change to create more livable cities. It highlights the emergence of urban environmentalists—architects, planners, and designers—who collaborate to improve urban spaces by focusing on community needs. The text critiques the over-reliance on automobiles for transportation and advocates for diverse transportation options, including public transit systems like BART. It also addresses the importance of preserving historical buildings through recycling rather than restoration, and the necessity of incorporating green spaces into urban design. The text concludes by stressing the need for public involvement in urban planning to foster continuous improvement in city environments. Keywords: urban problems, crowding, decay, urban renewal, urban environmentalists, community needs, transportation, public transit, BART, historical preservation, recycling buildings, green spaces, public involvement, city improvement. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-09T04:00:08.000Z yes A/V Geeks 16mm Films no 1083 urban renewalcity planningurban designrapid transitcity transportationBay Area Rapid Transithistoric preservationurban sprawlcity designGhirardelli Squareland useReston Virginiahousing developmentUrban AlternativesPublic Commitment https://avgeeks.videonest.co/videos/1460960/the-promise-1982 https://img.videonest.org/gamma/1460960_thumbnail_resized_v2.webp https://gamma.videonest.org/1460960_video_v4.mp4 The Promise (1982) A young girl named Amy has always wanted a puppy. When she turns 10, her parents agree to let her have one if she saves half the money. She takes various jobs to earn the money but learns that caring for a pet is a significant responsibility. Amy is given the opportunity to take care of Mr. Flynn's guide dog, Princess, while he is in the hospital. Although she initially enjoys the responsibility, she eventually neglects Princess, leading to her disappearance. After a difficult search, Amy learns the importance of keeping promises and the responsibilities that come with pet ownership. In the end, she finds Princess and realizes the true meaning of love and responsibility towards animals. Keywords: puppy, responsibility, promise, Mr. Flynn, Princess, guide dog, care, neglect, search, love, pet ownership, lessons, childhood, earning money, summer job. 2025-09-08T16:01:51.000Z yes A/V Geeks 16mm Films no 1043 pet ownershipguide dogresponsibilityMr. Flynnlost dogdog careanimal caredog reunitedmaking amendsbroken promisepet careCatie EyerJohn ZiglerGerman ShepherdBarr Films https://avgeeks.videonest.co/videos/1460961/probing-for-the-sale-1981 https://img.videonest.org/gamma/1460961_thumbnail_resized_v2.webp https://gamma.videonest.org/1460961_video_v4.mp4 Probing For The Sale (1981) Revolves around a writer, Claire, and a salesperson discussing the art of selling. Claire expresses interest in understanding how sales work, particularly how to identify customer needs. The salesperson explains the importance of establishing rapport, asking various types of questions (general, specific, probing, and leading), and understanding the customer's objectives before pitching a product. They discuss the systematic approach to sales, emphasizing the need to explore the customer's real problems and how to guide them to articulate their needs. The dialogue concludes with Claire realizing she has inadvertently become a potential customer for the salesperson's product. **Keywords:** wedding, writing, selling, customer needs, rapport, questioning, sales process, probing questions, leading questions, objectives, product pitch, conversation, sales techniques, customer problems, decision-making, business expansion, service contracts, sales strategy. 2025-09-08T04:01:09.000Z yes A/V Geeks 16mm Films no 1178 Probing for the Salesales strategiesSales TrainingPsychologyQuestioning MethodsCustomer Carebusiness questionsquestioning skillscustomer needsselling techniquessales techniquessalesperson skillsSales AdviceSellingBusiness https://avgeeks.videonest.co/videos/1460962/labor-comes-of-age-1966 https://img.videonest.org/gamma/1460962_thumbnail_resized_v2.webp https://gamma.videonest.org/1460962_video_v4.mp4 Labor Comes Of Age (1966) In January 1911, Franklin D. Roosevelt (FDR) begins his political career as a state senator, advocating for labor rights following the tragic Triangle Shirtwaist Factory fire that killed 148 workers. He supports legislation for workers' compensation and limits on women's working hours. By the 1920s, labor rights are still largely unrecognized, with only 6% of American workers organized. FDR's commitment to labor rights strengthens over the years, leading to his appointment of Francis Perkins as the first female cabinet member when he becomes president in 1933. He emphasizes the importance of maintaining wage earners' purchasing power to support economic recovery. FDR sponsors the National Industrial Recovery Act, which includes Section 7A, granting workers the right to collective bargaining. However, labor disputes escalate, leading to widespread strikes in 1934. The National Labor Relations Act of 1935 is passed to ensure workers' rights and improve labor-management relations. FDR navigates the divide between labor factions, particularly the AFL and CIO, while also introducing the Social Security Act to provide unemployment and old-age benefits. The labor movement evolves with the introduction of sitdown strikes, which become controversial. Despite challenges, labor gains recognition, particularly in the automotive industry. The Wages and Hours Act of 1938 establishes minimum wages, abolishes child labor, and marks significant progress in labor rights. FDR's efforts contribute to the labor movement's political power and the advancement of human progress through industrial relations. **Keywords:** Franklin D. Roosevelt, labor rights, Triangle Shirtwaist Factory, workers' compensation, National Industrial Recovery Act, collective bargaining, National Labor Relations Act, Social Security Act, sitdown strikes, Wages and Hours Act, child labor, economic recovery, labor movement, AFL, CIO. 2025-09-07T16:01:05.000Z yes A/V Geeks 16mm Films no 1143 FDRLabor RightsNew DealLabor MovementCollective BargainingLabor UnionsNational Labor Relations ActSocial Security ActTriangle Shirtwaist FactoryWorkers RightsStrikesFrances PerkinsChild LaborMinimum WageEconomic History https://avgeeks.videonest.co/videos/1460963/your-movie-camera-and-how-to-use-it-1948 https://img.videonest.org/gamma/1460963_thumbnail_resized_v2.webp https://gamma.videonest.org/1460963_video_v4.mp4 Your Movie Camera And How To Use It (1948) Charlie Wright introduces his new movie camera and observes his neighbor Joe Title Hawker as he attempts to film with it. The video provides tips on using a camera effectively, including focusing the lens, adjusting exposure, composing scenes, using a tripod, and ensuring smooth panning. It emphasizes the importance of following instructions and practicing to achieve good results in filmmaking. Keywords: camera, filming, instructions, focus, exposure, tripod, panning, composition, Joe Title Hawker, Charlie Wright, suburban home, movie tips, lens, diaphragm, sunlight, perspective, continuity, speed indicator. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-07T04:00:57.000Z yes A/V Geeks 16mm Films no 631 Movie cameracamera instructionfilm techniquescamera settingsfilm compositiontripod usepanningcamera lenscamera anglesdiaphragm aperturespeed indicatorvintage cameraCharlie WrightJoe Titlehockercamera https://avgeeks.videonest.co/videos/1460964/world-cultures-and-youth-ming-oi-the-magician-1979 https://img.videonest.org/gamma/1460964_thumbnail_resized_v2.webp https://gamma.videonest.org/1460964_video_v4.mp4 World Cultures And Youth: Ming Oi The Magician (1979) The film follows a 16-year-old girl from Hong Kong who is an apprentice to a magician. It highlights her dedication and the rigorous practice needed to master the illusions and juggling tricks of Chinese magic. The story culminates in her debut professional performance, showcasing her growth and the culmination of her hard work. 2025-09-06T16:00:16.000Z yes A/V Geeks 16mm Films no 1503 Ming-OiHong KongmagicmagicianChinese magicillusionsjugglingperformerYouthperformingstage performanceMagic ShowMagic TrickLevitationCups and balls https://avgeeks.videonest.co/videos/1460965/av-geeks-16mm-lunch-9-5-2025 https://img.videonest.org/gamma/1460965_thumbnail_resized_v2.webp https://gamma.videonest.org/1460965_video_v5_360.mp4 AV Geeks 16mm Lunch 9-5-2025 It's about time you join us for some ole 16mm films! #16mmfilms #avgeeks UNC High School Institute 1971 (silent) Home Sweet Home Happy Little Hamsters Healthwise: Fitness Fun Snack TV Commercials - Planters, Wise 2025-09-06T06:47:55.000Z yes A/V Geeks 16mm Films no 4315 16mm filmvintage filmUNC High School Institute1971ratshamstersexercisehealthPlanters snacksWise potato chipsvintage commercialpest controlstudent filmanimal behaviorA/V Geeks https://avgeeks.videonest.co/videos/1460966/what-happened-to-honesty-1970 https://img.videonest.org/gamma/1460966_thumbnail_resized_v2.webp https://gamma.videonest.org/1460966_video_v4.mp4 What Happened To Honesty? (1970) Film revolves around the increasing prevalence of theft and dishonesty in society, likening the world to a prison due to the need for security measures. The speakers express frustration over the impact of theft on daily life, including the necessity for locks and surveillance, which leads to a lack of trust among people. They question the reasons behind stealing and consider the broader implications for community resources and social interactions. 2025-09-06T04:00:38.000Z yes A/V Geeks 16mm Films no 757 thefthonestysecurity measurescrimestealingburglarylocksecurity systemshopliftingbicycle theftwindow barslaw enforcementcriminal activitysurveillance statefraud https://avgeeks.videonest.co/videos/1460967/the-world-of-plant-and-animal-communities-1981 https://img.videonest.org/gamma/1460967_thumbnail_resized_v2.webp https://gamma.videonest.org/1460967_video_v4.mp4 The World Of Plant And Animal Communities (1981) A community is formed wherever living things depend on each other for food or shelter, including humans, plants, and animals. Trees, for example, provide shelter and food for various animals, while forests consist of many plants that support each other and provide habitats. Food chains illustrate the relationships between different organisms, showing how energy and nutrients flow through communities. Different environments, such as deserts, oceans, and grasslands, host unique communities with their own food chains. Humans are also part of these food chains, relying on plants and animals for sustenance. Ultimately, all living things are interconnected within the larger community of Earth. Keywords: community, food, shelter, trees, forests, plants, animals, food chains, ecosystems, deserts, oceans, grasslands, humans, interdependence, Earth. 2025-09-05T16:01:59.000Z yes A/V Geeks 16mm Films no 781 plant communityanimal communityfood chainecosystemplant-animal interactiondesertoceangrassland communityfood chainsAmerican Bisonplant eatersprairie dogsplanet earthEncyclopedia Britannicascavengers https://avgeeks.videonest.co/videos/1460968/av-geeks-16mm-lunch-9-4-2025 https://img.videonest.org/gamma/1460968_thumbnail_resized_v2.webp https://gamma.videonest.org/1460968_video_v5_360.mp4 AV Geeks 16mm Lunch 9-4-2025 This a place to eat lunch and watch old 16mm films! #16mmfilms #avgeeks Squeak the Squirrel The Hideout Experience An Electric Eel Enlarged to Show Detail 2025-09-05T06:11:19.000Z yes A/V Geeks 16mm Films no 4015 https://avgeeks.videonest.co/videos/1460969/arcs-and-sparks-testing-1980 https://img.videonest.org/gamma/1460969_thumbnail_resized_v2.webp https://gamma.videonest.org/1460969_video_v4.mp4 Arcs And Sparks - Testing (1980) Discusses the concepts of electricity and magnetism, highlighting their relationship and safe ways to explore them. It begins by mentioning lightning as a natural form of electricity and warns against dangerous experiments. The text introduces static electricity, explaining how it can be generated using simple materials and demonstrating its effects on various objects. It also compares static electricity to magnetism, explaining the attraction and repulsion of magnets based on their poles. The text concludes by encouraging safe experiments with electricity and magnetism, emphasizing that learning can be fun without the risk of sparks. Keywords: electricity, magnetism, static electricity, lightning, safe experiments, attraction, repulsion, poles, positive charge, negative charge, materials, compass, learning, fun. 2025-09-05T04:00:45.000Z yes A/V Geeks 16mm Films no 771 electricitymagnetismstatic electricityarcssparksexperimentingmagnetic fieldmagnetic forceiron filingsnorth polesouth poleattractionrepulsionlightningdry cell https://avgeeks.videonest.co/videos/1460970/huffless-puffless-dragon-1964 https://img.videonest.org/gamma/1460970_thumbnail_resized_v2.webp https://gamma.videonest.org/1460970_video_v4.mp4 Huffless, Puffless Dragon (1964) Animated film features a character named Dragoon, a boastful dragon who claims to be the hottest and most fearsome of all dragons. He encourages others to join in smoking, mocking a character named Drag Knight who refuses to smoke. As the scene progresses, Drag Knight faces ridicule and pressure to conform, but ultimately, the narrative shifts to highlight the negative consequences of smoking. Drag Knight reflects on the misery caused by smoking, emphasizing its harmful effects on health and encouraging others to resist the temptation to smoke. Features Howard Morris and Charlotte Rae. Keywords: Dragoon, dragon, smoking, Drag Knight, peer pressure, health, consequences, lungs, heart, misery, resistance. 2025-09-04T16:00:48.000Z yes A/V Geeks 16mm Films no 481 dragonsmokinganimationcigarettescartoonDragoonDrag KnightPSAPublic Service AnnouncementAmerican Cancer Societypeer pressurehealthconsequences https://avgeeks.videonest.co/videos/1460971/av-geeks-16mm-lunch-9-3-2025 https://img.videonest.org/gamma/1460971_thumbnail_resized_v2.webp https://gamma.videonest.org/1460971_video_v5_360.mp4 AV Geeks 16mm Lunch 9-3-2025 Wednesday? sure, I'll take your word for it. 16mm films? Definitely! #16mmfilms #avgeeks What's the Big Hurry? Stand Up For Yourself Urban Alternatives Probing the Sale 2025-09-04T06:13:03.000Z yes A/V Geeks 16mm Films no 4147 16mm filmshort filmcomedypeer pressuredrugsurban planningurban alternativessales techniquesprobing questionscustomer needsvintage filmteenagersyouthcity designselling https://avgeeks.videonest.co/videos/1460972/stand-up-for-yourself-peer-pressure-and-drugs-1987 https://img.videonest.org/gamma/1460972_thumbnail_resized_v2.webp https://gamma.videonest.org/1460972_video_v4.mp4 Stand Up For Yourself: Peer Pressure And Drugs (1987) A group of teenagers discuss peer pressure, particularly regarding smoking and substance use. Characters express their concerns about fitting in and the pressure to conform to their friends' behaviors. They explore various strategies for saying no to drugs and alcohol, emphasizing the importance of self-respect and standing up for oneself. The conversation includes role-playing scenarios to practice responses to peer pressure, highlighting that many kids feel the same way and that it's okay to refuse. Keywords: peer pressure, smoking, substance use, self-respect, teenagers, role-playing, strategies, saying no, fitting in, friendship, dialogue, movie scene, coping mechanisms. 2025-09-04T04:00:35.000Z yes A/V Geeks 16mm Films no 956 Peer pressureDrug abuseTeen issuesMarijuanaSmokingYouth workshopFriendship issuesTeenage dramaSubstance useSaying noTeenagersStand upHigh schoolSocial situationsPersonal boundaries https://avgeeks.videonest.co/videos/1460973/growing-up-body-feelings-behavior-1986 https://img.videonest.org/gamma/1460973_thumbnail_resized_v2.webp https://gamma.videonest.org/1460973_video_v4.mp4 Growing Up: Body, Feelings, Behavior (1986) Discusses the process of growing up, highlighting the physical, emotional, and social changes that occur as children transition into adulthood. It explains the differences between boys and girls, the onset of puberty, and the development of reproductive systems. The text also addresses the emotional aspects of growing up, including feelings of love, responsibility, and the importance of social interactions. It emphasizes that while physical growth is a part of maturation, emotional growth and learning to navigate relationships and responsibilities are equally important. Keywords: growing up, puberty, physical changes, emotional changes, reproductive systems, boys, girls, adolescence, responsibility, social interactions, feelings, love, development, adulthood, menstruation, sperm, egg, fertilization, parenting, cooperation, decision-making. 2025-09-03T16:00:03.000Z yes A/V Geeks 16mm Films no 1083 Growing upPubertyReproductive SystemSex EducationAdolescenceSexual IntercourseSpermFertilizationHuman ReproductionSexual DevelopmentHuman DevelopmentChildhoodChildrenFriendshipSocial Skills https://avgeeks.videonest.co/videos/1460974/av-geeks-16mm-lunch-9-2-2025 https://img.videonest.org/gamma/1460974_thumbnail_resized_v2.webp https://gamma.videonest.org/1460974_video_v5_360.mp4 AV Geeks 16mm Lunch 9-2-2025 Back to work everybody! For us, it's back to showing you 16mm films from our archive. #16mmfilms #avgeeks Roman Wall Walk Safely The Promise The Party's Over Pampers Commercial 2025-09-03T06:13:07.000Z yes A/V Geeks 16mm Films no 4118 https://avgeeks.videonest.co/videos/1460975/tomorrows-quake-1977 https://img.videonest.org/gamma/1460975_thumbnail_resized_v2.webp https://gamma.videonest.org/1460975_video_v4.mp4 Tomorrow's Quake (1977) Discusses the nature of earthquakes, their causes, and the potential for predicting them. Earthquakes are described as destructive natural forces that can lead to significant damage due to collapsing structures and other hazards. The scientific understanding of earthquakes has evolved from mythological explanations to a geological perspective, recognizing the movement of tectonic plates. The San Andreas fault is highlighted as a significant fault line in California. Various methods for predicting earthquakes are explored, including the use of seismographs, tilt meters, and observations of groundwater levels and animal behavior. Despite advancements in understanding and technology, predicting earthquakes remains challenging, but accurate predictions could save lives by allowing for timely evacuations and safety measures. **Keywords:** earthquakes, prediction, tectonic plates, San Andreas fault, seismographs, tilt meters, geological, natural disasters, safety measures, animal behavior, groundwater levels, disaster preparedness. 2025-09-03T04:00:08.000Z yes A/V Geeks 16mm Films no 921 earthquake predictiontectonic platesSan Andreas Faultearthquakeseismographseismic wavesP-waveS-wavesurface wavetiltmetercrustal platesearth scienceplate tectonicscontinental driftAlfred Wegener https://avgeeks.videonest.co/videos/1460976/the-face-of-lincoln-1954 https://img.videonest.org/gamma/1460976_thumbnail_resized_v2.webp https://gamma.videonest.org/1460976_video_v4.mp4 The Face Of Lincoln (1954) "Face of Lincoln" is a 1954 short film featuring Professor Merrell Gage from the University of Southern California's Department of Fine Arts. In the film, Gage sculpts a bust of Abraham Lincoln from a large mass of clay while narrating anecdotes about Lincoln's life, from his youth to his presidency and eventual assassination. As Gage shares these stories, the clay bust gradually transforms into a lifelike representation of Lincoln, reflecting the changes and events in his life. The film highlights Gage's expertise in sculpture and his deep knowledge of Lincolniana, offering viewers an engaging and educational experience that combines art with history. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-02T16:00:56.000Z yes A/V Geeks 16mm Films no 1357 Abraham LincolnMerrell GageSculpturesculptingCivil WarAmerican historyThe Face of LincolnUniversity of Southern CaliforniaLincoln Douglas DebatesUlysses S GrantRobert E LeepresidencyFord's TheaterIllinoisState Legislature https://avgeeks.videonest.co/videos/1460977/the-pacific-coast-states-1983 https://img.videonest.org/gamma/1460977_thumbnail_resized_v2.webp https://gamma.videonest.org/1460977_video_v4.mp4 The Pacific Coast States (1983) Discusses the historical and cultural significance of California and the Pacific Northwest, focusing on the impact of the 1848 gold discovery at Sutter's Mill, which led to a wave of pioneers seeking fortune. It highlights the development of cities like San Francisco, Los Angeles, and Portland, and the challenges faced by settlers, including natural disasters like earthquakes and volcanic eruptions. The narrative also touches on California's agricultural prowess, technological advancements, and the coexistence of natural beauty with urban development. The text concludes by reflecting on the dreams and aspirations of those who shaped the region, alongside the enduring power of nature. Keywords: California, Pacific Northwest, gold discovery, pioneers, Sutter's Mill, San Francisco, Los Angeles, Portland, agriculture, earthquakes, Mount St. Helens, technology, natural beauty, urban development, dreams, nature. 2025-09-02T16:00:22.000Z yes A/V Geeks 16mm Films no 1550 Pacific Coast StatesGold RushCaliforniaPacific NorthwestSan FranciscoLos AngelesPortland OregonAgricultureHigh TechnologyMount St. HelensOregon CoastLoggingFishingSeattleNational Geographic https://avgeeks.videonest.co/videos/1460978/av-geeks-16mm-lunch-9-1-2025 https://img.videonest.org/gamma/1460978_thumbnail_resized_v2.webp https://gamma.videonest.org/1460978_video_v5_360.mp4 AV Geeks 16mm Lunch 9-1-2025 Let's celebrate the Workers with some 16mm films! #16mmfilms #avgeeks Labor Day Parade - San Francisco, Oakland Wages and Productions Labor Comes Of Age Foreman Discovers Motion Study 2025-09-02T06:13:13.000Z yes A/V Geeks 16mm Films no 4400 Labor Day paradeSan Franciscohistorical footagelabor movementstrikeslabor unionsFDRmotion studyindustrial efficiencyfactory workvintage filmwagesproductioncollective bargaining1930s https://avgeeks.videonest.co/videos/1460979/reporting-and-explaining-1970 https://img.videonest.org/gamma/1460979_thumbnail_resized_v2.webp https://gamma.videonest.org/1460979_video_v4.mp4 Reporting And Explaining (1970) Discusses the importance of effective communication, particularly in the context of making formal speeches that involve reporting or explaining. It emphasizes the need for clarity and interest in presentations, suggesting guidelines such as being specific, using simple terms, incorporating visual aids, and organizing material effectively. The speaker illustrates these points through examples and comparisons of different speaking styles, highlighting how specific examples can enhance clarity and engagement. The overall message is that mastering these communication techniques can significantly improve the effectiveness of speeches. Keywords: effective communication, formal speech, reporting, explaining, clarity, interest, guidelines, specific examples, visual aids, organization, audience engagement. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-09-01T16:00:47.000Z yes A/V Geeks 16mm Films no 782 reportingexplainingeffective communicationpublic speakingspeakingpresentationsvisual aidsOrganizationPresentation skillsCentronspeakerUnited Fundcommunity agenciesspeech therapyreporting and explaining https://avgeeks.videonest.co/videos/1460980/jack-and-the-robbers-1974 https://img.videonest.org/gamma/1460980_thumbnail_resized_v2.webp https://gamma.videonest.org/1460980_video_v4.mp4 Jack And The Robbers (1974) Narrates a folk tale from the Appalachian Mountain Range, where a boy named Jack, nicknamed Lazy Jack and Lucky Jack, embarks on an adventure after running away from home. He encounters various animals—a donkey, a dog, a cat, and a rooster—who are also in distress and decide to join him. They find a house belonging to a gang of robbers, where they feast on stolen food. When the robbers return, the animals cleverly defend themselves, causing the robbers to flee. Jack discovers the robbers' hidden treasure and returns home with the animals, ensuring they all live happily thereafter. Keywords: Appalachian Mountains, folk tales, Jack, Lazy Jack, Lucky Jack, adventure, animals, donkey, dog, cat, rooster, robbers, treasure, home, storytelling. 2025-09-01T04:00:40.000Z yes A/V Geeks 16mm Films no 859 Richard ChasefolktaleAppalachian MountainsJack and Robberschildren's storyroostercatdogdonkeyfarm animalsHighway RobbersJackrobbery attemptstory telling https://avgeeks.videonest.co/videos/1460981/youre-under-arrest-1982 https://img.videonest.org/gamma/1460981_thumbnail_resized_v2.webp https://gamma.videonest.org/1460981_video_v4.mp4 You're Under Arrest (1982) A 60 Minutes segment distributed to schools on 16mm film. Discusses the ongoing issue of drunk driving in the United States, highlighting the tragic story of sisters Michelle and Sherry Owen, who were killed in a drunk driving accident. Their mother, Pat Owen, recounts the harrowing moment she learned of their deaths. The driver responsible, Marty Ascarat, had a history of drunk driving and was convicted of felony manslaughter. The text also explores the statistics surrounding drunk driving, the challenges in prosecuting offenders, and the ineffectiveness of current laws and penalties. It emphasizes the need for stricter measures, including the revocation of licenses for repeat offenders and the importance of treatment programs for problem drinkers. Organizations like Mothers Against Drunk Driving (MADD) are mentioned for their efforts to combat drunk driving and advocate for tougher laws. **Keywords:** drunk driving, Michelle Owen, Sherry Owen, highway accident, felony manslaughter, Pat Owen, statistics, alcohol-related crashes, repeat offenders, legal limits, breathalyzer, Mothers Against Drunk Driving, treatment programs, public safety, law enforcement, plea bargaining, advocacy, impaired driving, fatalities. 2025-08-31T16:00:14.000Z yes A/V Geeks 16mm Films no 951 drunk drivingMichelle OwenSherry Owenfelony manslaughterMADDDWIDriving While Intoxicatedalcohol abusehighway accidentrepeat offenders60 Minutestraffic lawschild deathchild lossgrief https://avgeeks.videonest.co/videos/1460982/careers-in-the-office-applying-for-a-job-1971 https://img.videonest.org/gamma/1460982_thumbnail_resized_v2.webp https://gamma.videonest.org/1460982_video_v4.mp4 Careers In The Office: Applying For A Job (1971) Revolves around a young woman, Ruth, who is navigating her job search after summer work as a counselor. She discusses her uncertainty about her career path with a friend, expressing interest in office work but lacking the necessary skills. Ruth explores options like taking night courses and visiting employment agencies. After several setbacks, including a failed interview due to lack of preparation, she finally secures a receptionist job after demonstrating her aptitude and improving her typing skills. The narrative highlights the importance of preparation, first impressions, and perseverance in the job search process. Keywords: job search, Ruth, summer work, office work, skills, typing, night courses, employment agency, interview, receptionist, first impressions, perseverance, career path. 2025-08-31T04:00:39.000Z yes A/V Geeks 16mm Films no 800 job searchoffice workjob applicationjob interviewreceptionistcareer counselingemployment agencytypistvocational guidanceoffice positioncareerjob huntingjob offerstate employment officeEncyclopaedia Britannica https://avgeeks.videonest.co/videos/1460983/world-cultures-and-youth-amy-the-photographer-1978 https://img.videonest.org/gamma/1460983_thumbnail_resized_v2.webp https://gamma.videonest.org/1460983_video_v4.mp4 World Cultures & Youth: Amy The Photographer (1978) Amy Hobby, a 13-year-old from Winter Park, Florida, has been exploring hard edge photography for nearly three years. She focuses on capturing shapes, shadows, and patterns in her surroundings, often accompanied by her younger brother. Influenced by her father, an accomplished photographer, Amy participates in art festivals, including an important one in St. Augustine. She enjoys the process of developing her photographs and is excited about showcasing her work. Despite facing challenges, including a past car accident that affected her gymnastics, she remains passionate about photography. At the festival, she receives an award of distinction for her work, highlighting her talent and dedication. **Keywords:** Amy Hobby, hard edge photography, Winter Park, Florida, art festivals, St. Augustine, shapes, shadows, patterns, photography development, family, awards, influence, creativity, challenges, gymnastics, recognition. 2025-08-30T16:00:43.000Z yes A/V Geeks 16mm Films no 1489 Amy Hobbyhard edge photographyWinter ParkFloridaart festivalsSt. Augustinephotographyfilm developingdarkroom processart showart printscraft faircamera equipmentphotographeraward ceremony https://avgeeks.videonest.co/videos/1460984/av-geeks-16mm-lunch-8-29-2025 https://img.videonest.org/gamma/1460984_thumbnail_resized_v2.webp https://gamma.videonest.org/1460984_video_v5_360.mp4 AV Geeks 16mm Lunch 8-29-2025 Watch some 16mm films before you take off for your break! #16mmfilms #avgeeks Huffless, Puffless Dragon Arcs and Sparks (Testing) What Happened to Honesty? Man and the Moon 2025-08-30T06:13:41.000Z yes A/V Geeks 16mm Films no 4008 https://avgeeks.videonest.co/videos/1460985/hurricane-1970s https://img.videonest.org/gamma/1460985_thumbnail_resized_v2.webp https://gamma.videonest.org/1460985_video_v4_360.mp4 Hurricane (1970s) We start with perfect weather for Labor Day weekend, but with warnings of an impending storm named Chris, which has developed off the coast of Africa. Dr. Neil Frank from the National Hurricane Center highlights the storm's rapid development and the importance of monitoring it. The text emphasizes the dangers of hurricanes, including storm surges and high winds, and the need for effective communication and evacuation plans. It recounts historical hurricane tragedies and stresses the importance of preparedness, especially for those living in coastal areas. As the storm approaches, authorities begin issuing warnings and advice to ensure public safety. **Keywords:** Labor Day, weather, storm, Chris, National Hurricane Center, hurricane, evacuation, preparedness, storm surge, high winds, communication, coastal areas, historical tragedies, public safety. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-30T04:00:31.000Z yes A/V Geeks 16mm Films no 818 hurricanehurricane chrishurricane warningstorm surgehigh windsNational Hurricane CenterNeil Frankcoastal areastorm protectionhurricane safetyweather radioweather forecastNOAAforecastingEloise https://avgeeks.videonest.co/videos/1460986/how-living-things-change-1957 https://img.videonest.org/gamma/1460986_thumbnail_resized_v2.webp https://gamma.videonest.org/1460986_video_v4_360.mp4 How Living Things Change (1957) Discusses the evolution of animals over millions of years, focusing on how species like horses and elephants developed from their prehistoric ancestors. It highlights the role of selective breeding in producing desirable traits in livestock, such as cows and chickens, and contrasts this with the natural processes of evolution. The text explains early theories of evolution, particularly those of Jean Pierre Lamarck, who proposed that acquired characteristics could be inherited, and Charles Darwin, who introduced the concept of natural selection. It also mentions mutations as a factor in evolution, providing examples of how they can lead to significant changes in species. The text concludes by emphasizing the contributions of various scientists to our understanding of evolution and the mechanisms behind changes in living organisms. **Keywords:** evolution, animals, horses, elephants, selective breeding, natural selection, Lamarck, Darwin, mutations, species, characteristics, prehistoric, breeding stock, fossils, adaptation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-29T16:01:26.000Z yes A/V Geeks 16mm Films no 640 animal evolutionhorse evolutioncattle breedingselective breedingnatural selectionCharles DarwinJean Pierre Lamarckanimal mutationsanimal adaptationsspecies survivalCoronet Filmliving thingsplant varietiesmaizehybrid corn https://avgeeks.videonest.co/videos/1460987/av-geeks-16mm-lunch-8-28-2025 https://img.videonest.org/gamma/1460987_thumbnail_resized_v2.webp https://gamma.videonest.org/1460987_video_v5_360.mp4 AV Geeks 16mm Lunch 8-28-2025 Our YouTube show is like rummaging through your grandparents’ attic, if their attic had synchronized sound, questionable fashion, and a film about how to dial a rotary phone. #16mmfilms #avgeeks Your Movie Camera and How To Use It World of Plant and Animal Communities Uncle Smiley Goes To The Beach Pacific Coast States 2025-08-29T06:23:17.000Z yes A/V Geeks 16mm Films no 4342 16mm filmmovie camerainstructional filmvintage filma/v geekscamera operationfilm making techniquesplant communitiesanimal communitiesecosystemPacific CoastPacific Coast statesCaliforniaOregonWashington https://avgeeks.videonest.co/videos/1460988/air-pollution-a-first-film-1971 https://img.videonest.org/gamma/1460988_thumbnail_resized_v2.webp https://gamma.videonest.org/1460988_video_v4_360.mp4 Air Pollution: A First Film (1971) Polluted air is a significant issue in many cities, often forming a layer of dirty air beneath cleaner air. This pollution can damage rubber products, paint, and insulation, and negatively affect plant life. The sources of air pollution include burning fuels for electricity, transportation, heating, and industrial processes. Scientists are actively studying air pollution to identify its causes and track its levels, with the goal of finding solutions. The text encourages readers to consider how air quality can be improved and what actions they can take. **Keywords:** air pollution, cities, dirty air, clean air, damage, rubber, paint, insulation, plants, sources, burning, electricity, transportation, heating, industry, scientists, solutions, improvement, actions. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-29T04:00:47.000Z yes A/V Geeks 16mm Films no 526 air pollutionenvironmental effectspublic healthplant healthenvironmental protectionfactory smokevehicle emissionburning trashLos Angelesemission monitoringpollution controldirty airclean airburningtransportation https://avgeeks.videonest.co/videos/1460989/all-bottled-up-1975 https://img.videonest.org/gamma/1460989_thumbnail_resized_v2.webp https://gamma.videonest.org/1460989_video_v4_360.mp4 All Bottled Up (1975) Animated. The narrator reflects on their childhood experiences growing up in a family affected by alcoholism. They describe feelings of neglect and confusion regarding their parents' drinking habits, particularly their mother's alcoholism. The narrator shares their struggles with seeking attention from their father, who was often absent due to his drinking. They discuss the emotional turmoil within the family, including arguments and feelings of isolation. The narrator emphasizes the importance of finding support, detaching from the situation, and focusing on self-care. They also highlight the cycle of addiction and the need for individuals to seek help when ready. Ultimately, the narrator stresses the importance of self-acceptance and living one's own life despite the challenges posed by their parents' alcoholism. **Keywords:** alcoholism, childhood, neglect, emotional turmoil, family dynamics, support, self-care, addiction cycle, self-acceptance, detachment. 2025-08-28T16:01:11.000Z yes A/V Geeks 16mm Films no 696 AlcoholismParental alcoholismChildhood traumaFamilyCopingParentingAnimatedSelf loveSelf helpParental drinkingAl-AnonNational Council on AlcoholismNeglectEmotional turmoilFamily dynamics https://avgeeks.videonest.co/videos/1460990/av-geeks-16mm-lunch-8-27-2025 https://img.videonest.org/gamma/1460990_thumbnail_resized_v2.webp https://gamma.videonest.org/1460990_video_v5_360.mp4 AV Geeks 16mm Lunch 8-27-2025 We are back in Raleigh which is good because we have a lot of 16mms to scan and share. #16mmfilms #avgeeks Reporting and Explaining Jack and the Robbers Stone Forest Tomorrow's Quake Stamp Saving Day PSA 2025-08-28T06:13:11.000Z yes A/V Geeks 16mm Films no 4095 A/V Geeks16mm filmcommunication skillseffective communicationJack and the Robbersearthquake predictionPetrified Forestvintage educationalreportingexplainingpublic speakinggeologyearthquakesanimated storyArizona https://avgeeks.videonest.co/videos/1460991/guidance-for-the-seventies-kids-parents-and-pressures-1971 https://img.videonest.org/gamma/1460991_thumbnail_resized_v2.webp https://gamma.videonest.org/1460991_video_v4.mp4 Guidance For The Seventies: Kids, Parents and Pressures (1971) Discusses the complexities of interpersonal relationships, particularly focusing on family dynamics and communication. It highlights the fears individuals have regarding their reputations and how these fears can affect their relationships. The conversation explores the idea of "buttons" that people have, which are emotional triggers that can lead to conflict. The speaker emphasizes the importance of modifying one's own reactions rather than trying to change others. The dialogue also touches on the desire for better communication and understanding within family relationships, particularly between parents and children. The overall message encourages self-reflection and personal responsibility in fostering healthier relationships. **Keywords:** interpersonal relationships, family dynamics, communication, emotional triggers, reputation, self-reflection, personal responsibility, conflict resolution, understanding, pressures. 2025-08-28T04:00:37.000Z yes A/V Geeks 16mm Films no 973 family dynamicscommunication skillsemotional triggersinterpersonal relationshipsself-reflectionpersonal responsibilityconflict resolution1970srelationship dynamicsrelationship issuespersonal growthparental relationshipsgroup therapytriggerreaction https://avgeeks.videonest.co/videos/1460992/gossip-1987 https://img.videonest.org/gamma/1460992_thumbnail_resized_v2.webp https://gamma.videonest.org/1460992_video_v4.mp4 Gossip (1987) Revolves around a group of high school students dealing with rumors and gossip about a girl named Terry. Amy, one of the students, spreads stories about Terry, claiming she is involved with older boys and may be pregnant. This leads to tension among the students, with some defending Terry and others joining in on the gossip. A confrontation occurs, resulting in a fight that injures a student named Alex. The teacher, Mrs. Clark, decides to address the issue by proposing a class project to create a play about the harmful effects of gossip and rumors, aiming to foster cooperation among the students. Keywords: rumors, gossip, Terry, Amy, high school, drama, friendship, confrontation, injury, class project, Mrs. Clark, cooperation, consequences, relationships, communication. 2025-08-27T16:00:10.000Z yes A/V Geeks 16mm Films no 1000 gossiprumorshigh schoolteen dramafriendshipbullyingschool playMrs. Clarkteenage rumorsteen gossipinghighschool friendshipssocial groupsteenage friendshipsMedical EmergencyFirst Aid https://avgeeks.videonest.co/videos/1460993/av-geeks-16mm-lunch-8-26-2025 https://img.videonest.org/gamma/1460993_thumbnail_resized_v2.webp https://gamma.videonest.org/1460993_video_v4.mp4 AV Geeks 16mm Lunch 8-26-2025 It's another day of some great 16mm films! Join us and find out why. #avgeeks #16mmfilms Alone at Home The People Shop Autumn: Tales of the Riverbank 2025-08-27T05:52:02.000Z yes A/V Geeks 16mm Films no 2869 Skip ElsheimerA/V Geeks16mm filmAlone at HomeThe People ShopTales of the Riverbankhome safetychild safetyhospital careemergency preparednessvintage filmanimationanimalsparentingmedical https://avgeeks.videonest.co/videos/1460994/just-for-openers-1969 https://img.videonest.org/gamma/1460994_thumbnail_resized_v2.webp https://gamma.videonest.org/1460994_video_v4.mp4 Just for Openers (1969) The speaker welcomes attendees to a business meeting focused on Caterpillar equipment and its performance. Emphasizing the importance of effective maintenance and product support, the speaker outlines how all participants—owners, operators, mechanics, and superintendents—share a common goal of maximizing the value and efficiency of their Caterpillar machines. The meeting aims to provide valuable insights into maintenance practices, parts replacement, and service options to enhance productivity and reduce costs. The speaker concludes by highlighting the fast-paced nature of the industry and the commitment to keeping attendees informed about future developments. Keywords: Caterpillar, equipment, maintenance, performance, business meeting, product support, efficiency, operators, mechanics, owners, productivity, costs, service options, industry developments. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-27T04:00:17.000Z yes A/V Geeks 16mm Films no 668 CaterpillarConstruction EquipmentHeavy Equipmentequipment maintenanceproduct supportreplacement partsservice contractsequipment partsbulldozertractorbeauty pageantman speakingAdvertismenttrade valuebikini https://avgeeks.videonest.co/videos/1460995/good-day-at-bad-milk-1969 https://img.videonest.org/gamma/1460995_thumbnail_resized_v2.webp https://gamma.videonest.org/1460995_video_v4.mp4 Good Day At Bad Milk (1969) Revolves around a conversation in a bar where a stranger discusses the benefits of using a specific type of hay conditioning machinery (Hestized hay and a windrower) for better milk production from cows. The locals are skeptical and defensive about their traditional methods and equipment. The stranger explains how his machinery can improve hay quality, reduce costs, and ultimately increase milk yield. Tensions rise as the locals challenge the stranger to a competition to prove the effectiveness of his methods. Keywords: heat, milk, bartender, hay, machinery, cows, Hestized hay, windrower, milk production, nutrients, digestible protein, soil compaction, competition, traditional methods, skepticism, efficiency, farming, agriculture. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-26T16:01:33.000Z yes A/V Geeks 16mm Films no 1086 Hesston CorphayWindrowerwindrowfarmingagricultureruraldairycattlealfalfaWichita Kansasold westfarm equipmentHestongrain crops https://avgeeks.videonest.co/videos/1460996/fashions-on-the-ice-and-snow https://img.videonest.org/gamma/1460996_thumbnail_resized_v2.webp https://gamma.videonest.org/1460996_video_v4.mp4 Fashions On the Ice and Snow discusses the growing popularity of skiing and ice skating as winter sports in America, highlighting the excitement and physical demands of skiing, including the need for coordination and balance. It emphasizes the importance of proper clothing for comfort and performance, showcasing various stylish and practical ski and skating outfits designed for both functionality and aesthetics. The text also mentions the appeal of cross-country skiing and the thrill of ski jumping, while noting the increasing interest in ice skating, particularly among women, and the fashionable costumes available for this activity. Keywords: skiing, winter sports, ice skating, fashion, clothing, skiing outfits, cross-country skiing, ski jumping, coordination, balance, comfort, performance, Sakone, outdoor recreation, thrill, sportswear. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-08-26T04:00:00.000Z yes A/V Geeks 16mm Films no 685 skiingwinter sportsnow sportsski fashionwinter recreationdownhill skiingski jumpingcross-country skiingice skatingwinter fashionwomen's fashionsports wearSaconySkiingWinter Sportswear https://avgeeks.videonest.co/videos/1461446/av-geeks-16mm-lunch-11-18-2025 https://img.videonest.org/gamma/1461446_thumbnail_resized_v2.webp https://gamma.videonest.org/1461446_video_v4.mp4 AV Geeks 16mm Lunch 11-18-2025 Short 16mm films for you to watch and enjoy! #avgeeks #16mmfilms 2025-11-18T19:16:33.000Z yes A/V Geeks 16mm Films no 4796 Diet-Rite Colasuperconductorsheart disease16mm filmadvertising campaignaerobic exercisecardiovascular healthenergy breakthroughpreventive medicinemagnetic separationMagneplanetreadmill testheart soundsA/V Geekssoda industry https://avgeeks.videonest.co/videos/1461551/discovery-68-with-commercials-1969 https://img.videonest.org/gamma/1461551_thumbnail_resized_v2.webp https://gamma.videonest.org/1461551_video_v4.mp4 Discovery 68 with Commercials (1969) This episode of "Discovery 68" explores the history of the Mesa Verde National Park and its ancient inhabitants, particularly focusing on the cliff dwellings of the Ancestral Puebloans. The program discusses the architecture of these dwellings, the daily lives of the people, and the mysterious disappearance of their civilization around the late 13th century, likely due to prolonged drought and external conflicts. The episode also introduces a 1,600-year-old mummy named Esther, providing insight into the lives of early Native Americans in the region. Plus there are some great TV commercials spliced into this print. 2025-11-19T05:00:08.000Z yes A/V Geeks 16mm Films no 1774 Mesa VerdeNational Parkcliff dwellingancient PuebloNative AmericanAmerican historyEstherPueblo Indiansancestral puebloansvintage toyCommercialsBalcony HousekivasAnasaziStone Age Americans https://avgeeks.videonest.co/videos/1461854/conservation-of-energy-1959 https://img.videonest.org/gamma/1461854_thumbnail_resized_v2.webp https://gamma.videonest.org/1461854_video_v4.mp4 Conservation Of Energy (1959) Demonstrates the principle of conservation of energy using a coal-fired power plant as a practical example. It details the process of converting the potential energy of coal into thermal energy and then into electrical energy. Key components of the plant, such as the boiler, turbine, and condenser, are explained, showcasing how energy flows through the system. The video emphasizes that energy is conserved throughout the process, with minimal losses, as it transitions from coal to electricity. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-19T17:00:24.000Z yes A/V Geeks 16mm Films no 1602 Conservation of EnergyPower PlantElectrical EnergyThermal EnergyEnergy ConversionCoal PowerSteam TurbineEnergy GenerationCoal AnalysisFuel AnalysisBoiler SystemCombustion AirFurnace SectionElectrical Power GenerationBTU https://avgeeks.videonest.co/videos/1462155/av-geeks-16mm-lunch-11-19-2025 https://img.videonest.org/gamma/1462155_thumbnail_resized_v2.webp https://gamma.videonest.org/1462155_video_v4.mp4 AV Geeks 16mm Lunch 11-19-2025 It's hard of us to think a Wednesday without watching at least a couple of 16mm films! #avgeeks #16mmfilms 2025-11-19T19:12:33.000Z yes A/V Geeks 16mm Films no 4496 16mm filmA/V Geeksvintage footagefamilyhome movieeconomic educationelementary schoolKings Dominionroller coasterplant adaptationschool lunchclassroomchildren1970sopportunity cost https://avgeeks.videonest.co/videos/1462209/hard-brought-up-1955 https://img.videonest.org/gamma/1462209_thumbnail_resized_v2.webp https://gamma.videonest.org/1462209_video_v4.mp4 Hard Brought Up (1955) Discusses a juvenile court hearing involving two boys, Jimmy and Walter, who have gotten into trouble. The judge decides to send them to a state training school, emphasizing the importance of early intervention for at-risk youth. The narrative highlights the differing backgrounds of the boys, their family dynamics, and the efforts of a child welfare worker to provide support and guidance to help them improve. The story illustrates the challenges faced by both boys and their families while outlining the potential for positive change through proper support and understanding. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-20T05:00:59.000Z yes A/V Geeks 16mm Films no 2446 Juvenile courtState training schoolChild welfareWalter JonesJames ThompsonCourt hearingFamily lifeSocial workerJuvenile crimeParental responsibilityChild custodyFoster homeOrphanageVintage filmChild well-being https://avgeeks.videonest.co/videos/1462413/eternal-children-1959 https://img.videonest.org/gamma/1462413_thumbnail_resized_v2.webp https://gamma.videonest.org/1462413_video_v4.mp4 Eternal Children (1959) **OUTDATED TERMINOLOGY. Discusses the challenges faced by children with mental retardation, exemplified by a boy named Kevin, who has a mental age of four despite being nine years old. It outlines the causes of mental retardation, the different categories of affected children, and the importance of specialized education and support for their development. The narrative highlights the emotional struggles of families, the need for acceptance, and the future concerns regarding the care of these individuals as they transition into adulthood. 2025-11-20T17:00:55.000Z yes A/V Geeks 16mm Films no 1714 mental retardationintellectual disabilitychild developmentspecial educationlearning disabilitieschildrenparentingvocational trainingskills trainingemotional stabilityspeech therapycognitive disabilityschoolCanadaNational Film Board Of Canada https://avgeeks.videonest.co/videos/1462569/av-geeks-16mm-lunch-11-20-2025 https://img.videonest.org/gamma/1462569_thumbnail_resized_v2.webp https://gamma.videonest.org/1462569_video_v4.mp4 AV Geeks 16mm Lunch 11-20-2025 Feeling blue? We're feeling red today! #avgeeks #16mmfilms 2025-11-20T19:09:34.000Z yes A/V Geeks 16mm Films no 4200 16mm filmfire safetyRed NightmareCold Warvintage advertisementfire drillSoviet UnionAmerican Dreamcommunismanti-communismhouse firefire preventionWatson-Rootersewer cleaningBig Red https://avgeeks.videonest.co/videos/1462680/home-movie-all-aboard-for-california-1980 https://img.videonest.org/gamma/1462680_thumbnail_resized_v2.webp https://gamma.videonest.org/1462680_video_v4.mp4 Home Movie - All Aboard For California (1980?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The home movie showcases a journey to California, highlighting the ease of modern travel compared to the past. It features iconic locations such as Hollywood, the Universal Studios tour, and the Queen Mary, while emphasizing the rich history and culture of California's entertainment industry. The video also touches on paleontological discoveries at the La Brea Tar Pits, the grandeur of Hollywood Boulevard, and the bustling attractions that draw millions of tourists each year. 2025-11-21T05:00:48.000Z yes A/V Geeks 16mm Films no 1548 CaliforniaHollywoodUniversal StudiosQueen MaryLos AngelesHollywood BoulevardLa Brea Tar PitsMann's Chinese TheatreUniversal Studios TourLong Beachtraveltourismfilm setsmarine museumcruise ship https://avgeeks.videonest.co/videos/1462960/the-smiles-have-it-1940 https://img.videonest.org/gamma/1462960_thumbnail_resized_v2.webp https://gamma.videonest.org/1462960_video_v4.mp4 The Smiles Have It (1940) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Dental industry-sponsored educational film that introduces viewers to dental health: different types of teeth, proper brushing technique, and the importance of early intervention to prevent decay. 2025-11-21T17:01:15.000Z yes A/V Geeks 16mm Films no 623 The Smiles Have Itdental checkuptooth brushinganimal teethzooelephantszebra teethtigerhippodentistryhealthy eatingpicnicOld filmJ.W. FittsA Finer Films https://avgeeks.videonest.co/videos/1463177/av-geeks-16mm-lunch-11-21-2025 https://img.videonest.org/gamma/1463177_thumbnail_resized_v2.webp https://gamma.videonest.org/1463177_video_v4.mp4 AV Geeks 16mm Lunch 11-21-2025 Films about Oranges! #avgeeks #16mmfilms 2025-11-21T19:15:40.000Z yes A/V Geeks 16mm Films no 4042 orange juicecitrus fruitvintage foodvitamin CCalifornia orangeslemon juiceorange recipesvintage advertisementScurvy Preventionfruit harvestingcanning processorange grovefruit juiceorange peel16mm film https://avgeeks.videonest.co/videos/1463178/av-geeks-16mm-lunch-10-14-2025 https://img.videonest.org/gamma/1463178_thumbnail_resized_v2.webp https://gamma.videonest.org/1463178_video_v4.mp4 AV Geeks 16mm Lunch 10-14-2025 More 16mm films for you! Orange you happy?! #avgeeks #16mmfilms 2025-11-21T18:30:49.000Z yes A/V Geeks 16mm Films no 376 Skip ElsheimercitruslemonrecipessaladfruitA/V Geekslemon juicetomato juicebaked potatocarrot stripscottage cheesesweet potato16mm films https://avgeeks.videonest.co/videos/1463281/mountain-farmers-switzerland-1949 https://img.videonest.org/gamma/1463281_thumbnail_resized_v2.webp https://gamma.videonest.org/1463281_video_v4.mp4 Mountain Farmers - Switzerland (1949) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Cites the reasons for the economic prosperity of Switzerland--high-quality products, abundant hydroelectric power and a flourishing tourist industry. 2025-11-22T05:00:46.000Z yes A/V Geeks 16mm Films no 1127 Mountain farmersSwitzerlandEmmenthalDairy productsTraditional farmingSwiss Emmental Valleycheese makingEmmental CheeseSwiss Alpsskiingwinter sportsgrainfarmingwater electricityhaying https://avgeeks.videonest.co/videos/1463457/unknown-russian-music-video-footage-silent-1980s https://img.videonest.org/gamma/1463457_thumbnail_resized_v2.webp https://gamma.videonest.org/1463457_video_v4.mp4 [Unknown Russian Music Video Footage, silent, 1980s] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. he footage presents a vibrant mix of energetic dance performances set against misty backdrops, juxtaposed with introspective scenes featuring individuals in dimly lit, artistic environments. This combination evokes a sense of dynamic expression and deeper emotional narratives, blending movement and contemplation in a visually engaging manner. #Dynamic Dance #Emotional Narratives #Artistic Expression #Mysterious Atmosphere #Vibrant Visuals Timeline 00:00:06 - 00:27:30 Dynamic Dance Performances 00:00:06 A silhouetted dancer performs energetically against a dusk-like sky, with lighting emphasizing their movements and a hat adding a distinctive element. 00:05:41 Three individuals dance energetically against a cloudy sky, wearing casual attire and moving in synchronized choreography, suggesting a dynamic performance. 00:07:05 Four individuals stand confidently against a cloudy sky, with a central figure in a white tank top and jeans striking a powerful pose, enhancing a dramatic or musical performance. 00:11:05 A woman in a striped shirt and denim jacket strikes a pose against a cloudy sky, engaged in an energetic performance with another figure visible in the background. 00:15:18 Two individuals perform or dance against a soft blue backdrop, one in a denim jacket and the other in a light-colored top, suggesting a lively musical setting. 00:27:30 - 00:44:49 Mysterious Figures and Settings 00:27:30 A hand gently touches black leather boots in dim lighting, creating an intimate and mysterious atmosphere. 00:36:41 A person stands in a dimly lit room with a glowing blue neon frame and warm light from an ornate door, blending traditional and modern aesthetics. 00:39:38 A silhouette is prominently displayed against a blue background in dim lighting, suggesting movement within an atmospheric or dramatic scene. 00:41:06 A man in a loose-fitting suit stands in a dimly lit room, illuminated by warm golden light, appearing to be in a moment of introspection. 00:41:08 A man walks through a dimly lit room filled with scattered papers and disarranged furniture, with sunlight casting a warm glow on the contemplative scene. 2025-11-22T17:01:08.000Z yes A/V Geeks 16mm Films no 2690 dancingmusic videoperformanceexercisedance routinechoreographyfemale vocalistmale dancersvintage stylecigarette smokingleather jacketmotorcycleneon lightsaxophone playingvintage room https://avgeeks.videonest.co/videos/1463675/give-or-take-private-or-public-1982 https://img.videonest.org/gamma/1463675_thumbnail_resized_v2.webp https://gamma.videonest.org/1463675_video_v4_360.mp4 Give Or Take - Private Or Public (1982) Students transform a neglected lot into a park, seeking permission from the owner, Mr. Hanley. As the park gains popularity, they face pressure from a businessman wanting to sell the land for a fast-food outlet. The community debates the benefits of public parks versus private interests and funding challenges. 2025-11-23T05:01:04.000Z yes A/V Geeks 16mm Films no 904 public servicePSAcommunity projecturban renewalstudent parkpublic parkstudent projectcity governmentfast foodland zoningpublic conveniencestudent jobsconsumer educationreal estate https://avgeeks.videonest.co/videos/1463676/bakers-pumpernickel-dance-spelling-singing-and-energetic-moves-shorts https://img.videonest.org/gamma/1463676_thumbnail_resized_v2.webp https://gamma.videonest.org/1463676_video_v4_360.mp4 Baker's Pumpernickel Dance! Spelling, Singing, and Energetic Moves! #shorts Ever struggle with tricky words? This stylish speller makes even P-U-M-P-E-R-N-I-C-K-E-L look easy. Watch and learn! #Pumpernickel #SpellingTips #Pronunciation #WordChallenge 2025-11-23T01:48:52.000Z yes A/V Geeks 16mm Films no 19 PumpernickelSpelling TipsPronunciationWord ChallengeDanceSpelling https://avgeeks.videonest.co/videos/1463677/bakers-pumpernickel-polka-the-catchy-song-that-gets-everyone-dancing-shorts https://img.videonest.org/gamma/1463677_thumbnail_resized_v2.webp https://gamma.videonest.org/1463677_video_v4_360.mp4 Baker's Pumpernickel Polka: The Catchy Song That Gets Everyone Dancing! #shorts When he sings the pumpernickel polka, the people love to gather! Some songs just have that special magic to bring everyone together in celebration. #Polka #Community #Gathering #Singing 2025-11-23T01:43:18.000Z yes A/V Geeks 16mm Films no 9 PumpernickelPolkaCommunitySingingGathering https://avgeeks.videonest.co/videos/1463788/projecting-ideas-on-the-overhead-projector-1960 https://img.videonest.org/gamma/1463788_thumbnail_resized_v2.webp https://gamma.videonest.org/1463788_video_v4_360.mp4 Projecting Ideas On The Overhead Projector (1960) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The overhead projector serves as a powerful visual aid in education, business, and the military, enhancing teaching methods. It supports various materials and techniques, from transparencies to silhouettes, enabling dynamic presentations and demonstrations, including chemical reactions and creative performances, showcasing its versatility as a teaching tool. #Teaching Aid #Overhead Projector #Visual Presentations #Educational Techniques #Dynamic Demonstrations 2025-11-23T17:01:29.000Z yes A/V Geeks 16mm Films no 950 overhead projectorvisual aidstransparenciesclassroom teachingeducationteaching aidtransparency techniqueschemical reactionschartsmapsdiagramspolarized lightState University of IowaDallas R. Johnstonprojector lens https://avgeeks.videonest.co/videos/1464039/heart-sounds-mostly-silent-1950s https://img.videonest.org/gamma/1464039_thumbnail_resized_v2.webp https://gamma.videonest.org/1464039_video_v4.mp4 Heart Sounds (mostly silent, 1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Made for doctors, this shows and records heartbeats, correlating the physical motion of the heart with the sound it makes. Amazing footage, but yes it is graphic! 2025-11-24T05:00:00.000Z yes A/V Geeks 16mm Films no 1041 heart soundsheart valvesmitral valvetricuspid valveaortic valvediastoleelectrocardiogramphonocardiogramopen heart surgerycardiac valvesventricular musclemedical researchH. L. SmithH. E. EssexE. J. Baldes https://avgeeks.videonest.co/videos/1464223/dr-dial-public-service-announcments-1970s https://img.videonest.org/gamma/1464223_thumbnail_resized_v2.webp https://gamma.videonest.org/1464223_video_v4.mp4 Dr Dial public service announcments (1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Dr. Dial emphasizes the importance of oral health, highlighting that clean teeth and healthy gums lead to a beautiful smile. He discusses the prevalence of periodontal disease, especially among those aged 35 to 50, and the significance of regular dental checkups. Additionally, he points out that mouth pollution is a major contributor to dental issues and encourages the use of disclosing tablets to assess toothbrushing effectiveness. 2025-11-24T17:01:07.000Z yes A/V Geeks 16mm Films no 209 Dr Dialoral healthdental checkupsperiodontal diseasemouth pollutiondisclosing tabletstoothbrushingdental hygieneclean teethhealthy gums https://avgeeks.videonest.co/videos/1464411/av-geeks-16mm-lunch-11-24-2025 https://img.videonest.org/gamma/1464411_thumbnail_resized_v2.webp https://gamma.videonest.org/1464411_video_v4.mp4 AV Geeks 16mm Lunch 11-24-2025 Sigh, Youtube.. #avgeeks #16mmfilms 2025-11-24T19:06:28.000Z yes A/V Geeks 16mm Films no 1911 16mm filmfilm scanningsports filmfilm analysisKodaksports analysiseducational filmbasketballfootballbiological sciencemolecular biologymicroscopemicrobiologyA/V GeeksKodak film https://avgeeks.videonest.co/videos/1464412/av-geeks-16mm-lunch-11-24-2025 https://img.videonest.org/gamma/1464412_thumbnail_resized_v2.webp https://gamma.videonest.org/1464412_video_v4.mp4 AV Geeks 16mm Lunch 11-24-2025 16mm films at your service! avgeeks #16mmfilms 2025-11-24T18:34:14.000Z yes A/V Geeks 16mm Films no 2010 https://avgeeks.videonest.co/videos/1464537/coronary-counter-attack-1976 https://img.videonest.org/gamma/1464537_thumbnail_resized_v2.webp https://gamma.videonest.org/1464537_video_v4.mp4 Coronary Counter Attack (1976) Discusses the increasing prevalence of heart disease in America, particularly among younger individuals. It emphasizes the importance of preventive measures, including regular exercise, healthy eating, and avoiding smoking, to reduce the risk of heart attacks. The narrative highlights the role of treadmill stress tests in diagnosing heart disease and the significance of physical fitness. It advocates for a lifestyle change towards more vigorous physical activity to combat chronic diseases and improve overall health. 2025-11-25T05:00:50.000Z yes A/V Geeks 16mm Films no 1265 heart diseasepreventive medicineexerciseheart attackheart healthtreadmill testregular exerciseaerobic exercisecardiovascular systemgood healthEKGphysical examinationrunningsportspulmonary disease https://avgeeks.videonest.co/videos/1464538/the-community-ecology-1962 https://img.videonest.org/gamma/1464538_thumbnail_resized_v2.webp https://gamma.videonest.org/1464538_video_v4.mp4 The Community Ecology (1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the concept of community ecology, focusing on the roles and niches of various organisms within both human and natural communities. It explains how organisms interact in a biotic community, highlighting the importance of primary food producers, consumers, and decomposers in maintaining ecological balance. The text also describes the food chain and food web dynamics, emphasizing how different organisms fulfill their roles in various habitats, including pine forests and intertidal communities. 2025-11-25T05:00:23.000Z yes A/V Geeks 16mm Films no 678 EcologyBiotic communityFood chainFood webNicheEcosystemFood producersHerbivoreCarnivoreScavengerDominant plantsMarine biologyGrasslandTropical rainforestDesert https://avgeeks.videonest.co/videos/1465022/av-geeks-16mm-lunch-11-25-2025 https://img.videonest.org/gamma/1465022_thumbnail_resized_v2.webp https://gamma.videonest.org/1465022_video_v4.mp4 AV Geeks 16mm Lunch 11-25-2025 There's a song in our heart and it's on 16mm! #avgeeks #16mmfilms 2025-11-25T19:06:58.000Z yes A/V Geeks 16mm Films no 3988 A/V Geeks16mm filmSoundiesvintage musicclassic filmeducational filmsilent film1940smusical performanceegg safetyTom Dick and Harrietbarber shop quartetdance performancefilm digitizationfilm projector https://avgeeks.videonest.co/videos/1467570/care-report-1970s https://img.videonest.org/gamma/1467570_thumbnail_resized_v2.webp https://gamma.videonest.org/1467570_video_v4.mp4 CARE Report (1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Hundreds of thousands flee hardship, leading to overcrowded relief camps and urgent aid needs. CARE, an international nonprofit, provides essential goods and services, addressing starvation and malnutrition among refugees. Through careful distribution of emergency kits and support, CARE empowers individuals, remaining committed to aid as long as necessary. #HumanitarianAid #RefugeeRelief #Starvation #CAREOrganization #EmergencyAssistance Timeline 00:00:09 Hundreds of thousands of people are displaced from their homes, facing starvation and sickness in overcrowded relief camps. 00:00:31 A family discusses the worsening situation and considers contributing to the CARE organization to help those in need. 00:00:49 Mike Hamster from Thailand reports on the dire situation in border camps, confirming that relief operations have begun. 00:01:11 Ed Wesley, CAR's chairman, urgently requests help, stating that CARE is providing food, medical aid, and basic kits to severely malnourished children and their families. 00:01:49 L. Samia, executive director of CARE, explains that the organization converts donations into vital goods and services, a practice that began during World War II to aid war-torn Europe. 00:02:20 A historical clip shows a check being handed over for a food package for starving people in Europe, with a speaker commending CARE's role in supplementing ENRA to provide food for hungry Europeans in 1946. 00:02:51 CARE now operates globally, supported by contributions from individuals, foundations, and businesses in various countries, with food commodities donated from programs like Food for Peace. 00:03:13 Local governments overseas contribute to distribution costs, and beneficiaries often perform labor in self-help development projects, alongside relief efforts for refugees like those in Cambodia. 00:03:32 The global community has responded to the call for help from Cambodia, recognizing the immense need for aid due to the tragedy. 00:04:02 Voluntary agencies have been working to assist the growing number of refugees, and Americans are urged to support these efforts. 00:04:16 Care is collaborating with other agencies, bringing its experience and expertise to the relief effort, which is acknowledged by the international community. 00:04:28 Care has engaged with local government, UN agencies, and other private organizations to identify the most critical areas for assistance. 00:04:48 The organization established local headquarters in Bangkok, arranged transportation, and brought in medical personnel to assist in hospitals and dispense medication in refugee camps. 00:05:04 Food and medical supplies were flown and trucked in, as the need for more food was critical due to severe starvation and malnutrition among the refugees. 00:05:25 Leveraging years of experience, the organization built food storage warehouses and kitchens, hired local staff, and within weeks, fed thousands daily with donated and locally purchased ingredients. 00:06:06 The severely malnourished and those unable to walk were prioritized for feeding, with special nutrients given to the very ill before medical treatment. 00:06:23 - 00:07:45 Providing Basic Necessities and Emergency Kits 00:06:23 Feeding centers were established and basic necessities like buckets for water and washing were distributed to each family. 00:06:39 Care prepared practical basic needs kits containing soap, combs, sewing kits, towels, sarongs, t-shirts, sandals, and cotton cloth for those who had lost everything. 00:07:01 Recipients were carefully chosen based on need, with one bucket distributed to each family at various points in the camps, restoring personal dignity to thousands. 00:07:25 The health of the children improved remarkably, allowing them to smile again, though thousands more still require assistance. 00:07:45 CARE will continue to provide assistance as long as there is a need and concerned individuals offer resources. 00:08:03 The executive director assures that aid transmitted through CARE will quickly reach those most in need. 00:08:12 CARE expresses gratitude for the concern and support provided to suffering families. 2025-11-26T05:01:10.000Z yes A/V Geeks 16mm Films no 539 Cambodian refugeesRelief effortCAREHumanitarian aidMedical suppliesCambodiaMalnutritionRefugee campsFood for Peace programEmergency AssistanceStarvationCARE Organization https://avgeeks.videonest.co/videos/1467571/av-geeks-lunch-11-26-2025 https://img.videonest.org/gamma/1467571_thumbnail_resized_v2.webp https://gamma.videonest.org/1467571_video_v4.mp4 AV Geeks Lunch 11-26-2025 Moving film equipment today but still have to share some 16mm films with you! #avgeeks #16mmfilms A Step-Saving Kitchen The REA Story Intrepreting the Bicentennial 2025-11-26T01:05:29.000Z yes A/V Geeks 16mm Films no 3812 16mm filmsA/V Geekskitchen designrural electrificationBicentennialREAFarm WorkerselectricityAmerican farmsmodern kitchenelectrical powerRural Americafarmingnational parksAmerican people https://avgeeks.videonest.co/videos/1467572/av-geeks-pumpkin-spliced-11-27-2025 https://img.videonest.org/gamma/1467572_thumbnail_resized_v2.webp https://gamma.videonest.org/1467572_video_v4.mp4 AV Geeks Pumpkin Spliced (11-27-2025) Happy Thanksgiving! Here are a bunch of films featuring pumpkins! #16mmfilms #avgeeks 2025-11-25T14:52:23.000Z yes A/V Geeks 16mm Films no 3857 vintage filmpumpkinthanksgiving themehalloweenA/V geekspumpkin patchautumn harvestpumpkin carvingharvestingsilent filmhalloween specialcarvel ice creamdorothy in the land of ozfamily lifeamerican values https://avgeeks.videonest.co/videos/1471542/flying-cadets-silent https://img.videonest.org/gamma/1471542_thumbnail_resized_v2.webp https://gamma.videonest.org/1471542_video_v4.mp4 Flying Cadets (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. "Flying Cadets" offers an engaging look into the rigorous training and daily routines of aviation cadets. The footage captures a variety of activities, from leisurely drives to structured aviation exercises, showcasing the cadets' commitment and preparation for their future careers. Viewers witness the cadets receiving parachute training, accompanied by a motivational scene in which one character is encouraged to overcome self-doubt and pursue flying lessons. The narrative unfolds further on an airfield where cadets engage in lively conversations before taking to the skies in vintage biplanes, evoking a nostalgic training environment reminiscent of earlier aviation history. The training intensifies with a simulated dogfight segment, where cadets practice targeting and firing skills, highlighting their dedication to developing proficiency and confidence in piloting. The video also includes static images that complement the theme, likely derived from a film or presentation about flying cadets. Overall, the footage presents a comprehensive view of the challenges, camaraderie, and aspirations that define the life of aspiring pilots. 2025-11-26T17:00:31.000Z yes A/V Geeks 16mm Films no 1226 Flying Cadetspilot trainingAir Corpsbiplaneaviationflight trainingvintage airplaneaerobaticsmilitary trainingpilotsaircraftU.S. Army Air Corpsmilitary pilotshistorical footageairplane https://avgeeks.videonest.co/videos/1471871/the-high-wall-1952 https://img.videonest.org/gamma/1471871_thumbnail_resized_v2.webp https://gamma.videonest.org/1471871_video_v4.mp4 The High Wall (1952) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the origins and implications of prejudice and hate among youth, focusing on a gang fight between two groups of children from different ethnic backgrounds. It explores how these negative feelings are often instilled in children by their parents and society, emphasizing that no one is born prejudiced. The narrative highlights the importance of understanding, love, and acceptance in combating hate and fostering a more inclusive community. 2025-11-27T05:00:44.000Z yes A/V Geeks 16mm Films no 1718 prejudicehategang violencechildhooddiscriminationracial prejudicefamily issuessocial issuesracismteaching hatefamily conflictgangfightsocial tension1950s societal norms https://avgeeks.videonest.co/videos/1472018/ask-forthe-order-and-get-it-1972 https://img.videonest.org/gamma/1472018_thumbnail_resized_v2.webp https://gamma.videonest.org/1472018_video_v4.mp4 Ask ForThe Order And Get It (1972) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Emphasizes the crucial importance of asking for the order in sales. It contrasts two salesmen with similar skills, highlighting that the one who asks for the order successfully closes the sale, while the other does not. Fear of rejection often prevents salespeople from asking, but overcoming this fear through dedication, discipline, and determination is essential for success. The video provides various techniques for closing sales, emphasizing the need to ask questions that prompt decisions. 2025-11-27T17:00:49.000Z yes A/V Geeks 16mm Films no 1652 Joe Battenask for orderSales trainingclosing salessales techniqueclosing techniquessales strategyclosing questionssales techniquesselling strategiesnegotiation skillssales callBusinesscustomer benefitsselling profession https://avgeeks.videonest.co/videos/1472225/regulating-body-temperature-1972 https://img.videonest.org/gamma/1472225_thumbnail_resized_v2.webp https://gamma.videonest.org/1472225_video_v4_360.mp4 Regulating Body Temperature (1972) Discusses how animals regulate their body temperature despite varying environmental conditions. It explains the concepts of ectotherms and endotherms, detailing how different species maintain their internal temperature through behavioral and physiological adjustments. Key mechanisms for temperature regulation include heat exchange through radiation, conduction, convection, and evaporation, as well as the role of the hypothalamus in maintaining homeostasis. LIMITED DISTRIBUTION. 2025-11-28T05:00:23.000Z yes A/V Geeks 16mm Films no 1264 body temperatureEndothermsEctothermsHeat lossHeat regulationPhysiological adjustmentsMetabolic rateinternal temperaturephysiologythermoregulationanimalevolution of lifehypothalamusblood flowexercise https://avgeeks.videonest.co/videos/1472372/peripheral-nervous-system-1977 https://img.videonest.org/gamma/1472372_thumbnail_resized_v2.webp https://gamma.videonest.org/1472372_video_v4_360.mp4 Peripheral Nervous System (1977) Discusses the structure and function of the nervous system, focusing on the peripheral and central nervous systems, reflexes, and neuron communication. It explains how sensory receptors and neurons work together to process stimuli and generate responses, emphasizing the complexity and intricacy of the nervous system. Reflex reactions, both innate and learned, are highlighted, along with the importance of the brain in controlling bodily functions. The video also touches on the speed of nerve impulse transmission and the role of myelin in increasing that speed. 2025-11-28T17:01:16.000Z yes A/V Geeks 16mm Films no 1133 nervous systemperipheralneuronsreflex reactionspinal cordsensory neuronsmotor neuronsnerve cellaxondendritenerve impulseSchwann cellsmyelin sheathreflex actionshuman nervous system https://avgeeks.videonest.co/videos/1472555/av-geeks-16mm-lunch-11-28-2025 https://img.videonest.org/gamma/1472555_thumbnail_resized_v2.webp https://gamma.videonest.org/1472555_video_v5_converted.mp4 AV Geeks 16mm Lunch 11-28-2025 Lots to be thankful for.. especially 16mm films. #avgeeks #16mmfilms The Man Who Bought Monday Night The Magic Lantern Show and How It Grew Stories Speak Up! 2025-11-28T19:12:44.000Z yes A/V Geeks 16mm Films no 4372 16mm filmAV Geeksvintage filmeducational filmstorytellingfilm historyearly cinemamagic lantern showclassroomcreative writingcharacter developmentfilm projectorsilent filmchildrenclassroom discussion https://avgeeks.videonest.co/videos/1472646/office-etiquette-1950 https://img.videonest.org/gamma/1472646_thumbnail_resized_v2.webp https://gamma.videonest.org/1472646_video_v4_360.mp4 Office Etiquette (1950) Reflects on the lessons learned from a typing class taught by Miss Purcell, emphasizing the importance of office etiquette and interpersonal relationships in the workplace. The narrator recalls how Miss Purcell's teachings about enjoying one's work, being considerate of colleagues and employers, and knowing one's job were crucial in their first job experience. The narrator shares anecdotes about their initial challenges, the significance of learning from mistakes, and the value of courtesy and organization in a professional setting. Overall, the text highlights how foundational lessons from a typing class can translate into real-world business success. Keywords: typing class, Miss Purcell, office etiquette, business world, attitude, interpersonal relationships, first job, consideration, mistakes, organization, courtesy, professionalism. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-11-29T05:00:46.000Z yes A/V Geeks 16mm Films no 745 Office etiquetteTyping classBusiness worldOffice workEmployeeJob InterviewConsiderationCourtesyOffice workerOffice environmentWork ethicStarting new jobSecretaryJob ApplicationScheduling Appointments https://avgeeks.videonest.co/videos/1472773/letter-to-grandmother-1964 https://img.videonest.org/gamma/1472773_thumbnail_resized_v2.webp https://gamma.videonest.org/1472773_video_v4_360.mp4 Letter To Grandmother (1964) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. These are what real film emulsion scratches look like. This film was run through a dirty projector. Follows a young girl named Mary as she writes a letter to her grandmother requesting her dog Chips' ball and blanket left at her farm. The video details the journey of the letter through the postal system, from being mailed to its arrival back at Mary’s home, showcasing how mail is sorted, transported, and delivered. It emphasizes the importance of the postal service in connecting people and delivering messages and packages. 2025-11-29T17:01:32.000Z yes A/V Geeks 16mm Films no 822 US Postal Servicemail systemmailing lettersletter writingpost officepostal serviceletter sortingmail carrierdelivery trucktrain stationrural routemail serviceparcel postchildrenCoronet Film https://avgeeks.videonest.co/videos/1472992/wrapping-toothbrushes-silent-1939 https://img.videonest.org/gamma/1472992_thumbnail_resized_v2.webp https://gamma.videonest.org/1472992_video_v4.mp4 [Wrapping Toothbrushes, silent, 1939] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A worker is shown meticulously wrapping toothbrushes individually in a production setting. The process emphasizes careful handling, organization, and assembly, ensuring the toothbrushes are properly prepared for packaging and distribution, showcasing the attention to detail required in manufacturing. #Wrapping Toothbrushes #Manufacturing Process #Attention to Detail #Packaging and Distribution #Production Environment Timeline 00:00:42 - 00:03:52 Wrapping Toothbrushes 00:00:42 A person is seen individually wrapping toothbrushes, placing each into protective sleeves. 00:03:09 An individual packages toothbrushes into boxes, ensuring careful placement for distribution. 00:03:43 A worker meticulously wraps toothbrushes at a production station, focusing on secure packaging. 00:03:51 A worker organizes and wraps toothbrushes at a workstation, preparing them for sale or distribution. 00:03:52 - 00:07:03 Wrapping Toothbrushes 00:03:52 A person is carefully wrapping toothbrushes at a workstation, surrounded by organized trays and packaging materials. 00:05:30 A woman is packaging toothbrushes into boxes, suggesting a small-scale manufacturing or assembly environment. 00:06:23 A worker is focused on arranging and packing a large pile of toothbrushes into boxes, indicating a manual and systematic production process. 2025-11-30T05:01:19.000Z yes A/V Geeks 16mm Films no 423 wrappingmanufacturingfactory workassembly linebrush applicatorsindustrial factorypacking jobblack and white filmfactory worker https://avgeeks.videonest.co/videos/1473295/gaines-dog-food-tv-commercials https://img.videonest.org/gamma/1473295_thumbnail_resized_v2.webp https://gamma.videonest.org/1473295_video_v4.mp4 Gaines Dog Food TV Commercials Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The Gaines dog food commercials showcase various products like Gaines Meal and Gaines Multime, emphasizing their nutritional value, taste, and convenience. Testimonials from breeders highlight the health benefits, while ads promote Gainesburgers as a convenient alternative to canned food, offering complete nutrition at an affordable price. #Gaines Dog Food #Nutritious Dog Food #Convenient Pet Meals #Dog Food Advertisements #Healthy Dog Nutrition 00:00:01 The first commercial introduces New Gaines Meal, emphasizing its basted nuggets for flavor and aroma that dogs will enjoy. 00:01:07 The second commercial addresses the common problem of dogs disliking nutritious food, presenting Gaines Meal as the solution with its basted, flavorful nuggets. 00:02:09 The first commercial introduces Gaines Multime as a new dog food that comes in three meat varieties (beef, liver, and chicken) and is almost like people food, with each packet equaling a one-pound can without excess water. 00:02:55 The second commercial features Princess, highlighting Gaines Multime's three meat varieties and convenient packaging that eliminates the need for spoons or refrigeration, making it a complete and mess-free meal. 00:03:42 The third commercial showcases Tippy, reinforcing that Gaines Multime is a complete and balanced meal in three meat varieties, designed for dogs treated as family members, offering natural juices and no mess. 00:04:32 The commercial introduces Rally, a new dog food that comes in a can with a pull string, making it easy for a 2-year-old to open and serve. 00:06:28 A basset hound breeder praises Gaines Meal for providing a well-balanced diet that results in healthy, peppy dogs with lovely coats and good bone structure. 00:07:38 A collie breeder discusses feeding Gaines Meal to eight or nine generations of collies, noting their nice coats and overall health. 00:08:27 A man tries to guess the name of a new dog food, eventually figuring out 'Multime' and its three meat varieties. 00:09:17 Gaines Multime is introduced as a new dog food offering three meat varieties in packets, providing a complete and balanced meal. 00:09:34 The first commercial showcases Gaines Meal, emphasizing its homogenized nuggets that provide complete nourishment and rich meat proteins for dogs. 00:10:03 Subsequent commercials introduce New Rally, a dog food described as rich in meat and bone meal, eliminating the need for owners to add extra ingredients. 00:10:53 Several ads feature people expressing skepticism about Rally's claims, only to be convinced by its beef-like taste and complete nutritional value. 00:12:18 The commercials consistently promote Rally as a convenient and nutritious option for dogs, developed at the Gaines Research Kennels, that doesn't need to be 'doctored up'. 00:14:51 The commercial introduces new high-protein, low-fat Gaines meal, promising a longer prime of life, sleek beauty, and extra years of vitality for dogs. 00:15:06 Cindy, a 7-year-old dog, exemplifies the benefits of Gaines meal, maintaining her trim and youthful appearance due to its concentrated formula. 00:15:23 Gaines meal boasts 50% more protein per cup compared to other puffed-up dog foods, offering superior nutritional value. 00:15:39 The commercial emphasizes that Gaines meal contains no greasy excess fat, unlike other dog foods where fat can be visibly felt and seen. 00:15:54 Homer initially rejects nutritious food until Gaines Meal, basted for flavor and aroma, makes nutrition appealing with its new nugget size. 00:17:08 Gaines Complete dog food is introduced as a more affordable alternative to leading semi-moist foods, offering a balanced blend of soy and meat protein, vitamins, minerals, and a moist, meaty taste that dogs love. 00:17:58 Another commercial features a couple discussing their budget, with Helen introducing Gaines Complete as a new meaty-tasting dog food that costs less while still providing a banquet of nutrition. 00:19:39 Even with tight budgets, Gaines Complete is presented as a solution for dog owners to provide their pets with moist, meaty-tasting food every day at a low price, ensuring great taste without hurting the wallet. 00:24:48 Gainesburgers are introduced as a convenient alternative to canned dog food, offering the same meaty, moist texture and nutritional value without the can. 00:25:21 New Gainesburgers with egg are presented, providing dogs with the taste they love and the goodness of real egg in each burger. 00:26:46 Gainesburgers are shown to be preferred by dogs who typically eat canned food, with owners expressing surprise at their dogs' enjoyment of the moist and meaty product. 00:28:43 A comparison reveals that Gainesburgers are often more cost-effective than leading national brands of canned dog food, offering more meals for less money. 2025-11-30T17:00:38.000Z yes A/V Geeks 16mm Films no 1759 Gaines MealGaines Multi-Menudog foodvintage commercialpet fooddog nutritionanimal careGeneral FoodsRally dog foodGaines Completebeef flavorGaines-burgersdog treatsmeat proteinvitamins https://avgeeks.videonest.co/videos/1473547/home-movies-waterfowl-2-1960s-silent https://img.videonest.org/gamma/1473547_thumbnail_resized_v2.webp https://gamma.videonest.org/1473547_video_v4.mp4 [Home Movies: Waterfowl 2, 1960s, silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:01:48 - 00:24:43 Waterfowl and Birds in Nature 00:01:48 A bird is perched atop a tree against a clear blue sky, observing its surroundings. 00:06:06 A bird perches on a tree branch silhouetted against a twilight sky, as day transitions to night. 00:15:49 A group of waterfowl is gathered at the edge of a wetland, foraging or resting in their natural habitat. 00:18:13 A solitary white bird gracefully soars against a clear blue sky, showcasing the elegance of its flight. 00:21:50 A bird is perched on a wire against a clear blue sky, captured in silhouette, possibly part of home movie footage. 00:22:41 A bird perches atop a branch amidst lush foliage, set against a clear blue sky, highlighting tranquility. 00:24:43 - 00:32:18 Waterfowl in Natural Habitats 00:24:43 A duck with distinctive head markings floats serenely on tranquil water amidst a green environment, indicating a peaceful, secluded habitat. 00:27:59 A white waterfowl forages among reeds and dry vegetation in a wetland, with other birds visible in the background, suggesting a thriving habitat. 00:31:16 Two birds fly against a darkening sky over a grassy field with a utility pole, creating a serene, twilight atmosphere in a rural setting. 00:31:50 A large flock of waterfowl flies and rests in a grassy field, showcasing their natural behavior and habitat during migration or daily activities. 2025-12-01T05:00:09.000Z yes A/V Geeks 16mm Films no 1938 waterfowlbird watchingbirds flyingduckswan swimminggeese swimmingegretsbird perchedbird foragingwildlifebird flightlakeforestshorebirdbird species https://avgeeks.videonest.co/videos/1473732/science-news-vol-1 https://img.videonest.org/gamma/1473732_thumbnail_resized_v2.webp https://gamma.videonest.org/1473732_video_v4.mp4 Science News, Vol 1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:00:24 Eniwetok Atoll, part of the Marshall Islands, is shown preparing for secret atomic weapon tests in 1948, with the purpose of measuring atomic effects on 30,000 tons of different materials. 00:00:49 Automatic cameras in special towers will record the explosions, with no newsmen or foreign observers present as the 10,000-man task force T leaves for safety before the explosion of America's sixth atom bomb. 00:01:16 Robot planes take off for atmospheric measurements at the atomic energy commission's permanent proving ground, as all is ready for bomb number six, a new atomic weapon design. 00:01:42 The flash of bomb number six is seen by shipboard observers, followed by bomb number seven, whose radioactive cloud spreads for miles above the Pacific, and finally bomb number eight, presenting an argument for peace and preparedness. 00:02:42 American experts are studying and photographing two million ancient parchment pages in various languages at St. Catherine's Monastery, some of which are believed to be lost sacred scriptures. 00:03:35 Among the many treasures being rescued from obscurity is a scroll believed by the monks to be written by the prophet Muhammad. 00:03:48 At an ultramodern dairy in Delano, California, cows are stimulated with a lukewarm spray before moving onto a conveyor line for simultaneous feeding and milking. 00:04:14 The conveyor system, invented by dairyman HC Kain, allows a herd of 100 cows to be milked in less than an hour, with each cow completing the process in 7 minutes. 00:06:02 Professor Lo Sang Sai introduces his cooperation machine designed for an experiment in animal relations. 00:06:15 A rat and a cat, raised together and loving each other, are placed in the first compartment of the machine. 00:06:42 After separation, the rat lets the cat into its compartment by stepping on a floor plate, and they both push food buttons together. 00:07:08 Scientists in Tennessee are using atomic byproducts for medical purposes, with laboratories heavily guarded due to the dangerous nature of the materials. 00:08:18 A heavy lead shipping case is used and checked with a Geiger counter to ensure no dangerous atomic rays escape before being weighed and labeled with a warning. 00:08:31 At a medical research center, radioactive iodine is used to locate thyroid cancer tissues by having the patient drink a diluted solution that concentrates in the cancerous area, which is then detected by a Geiger counter. 00:10:10 The new 82nd Congress convenes in Washington D.C., facing important challenges both domestically and internationally, with significant changes among both Republican and Democratic members. 00:11:28 The Capital Building, continually rebuilt and repaired since 1793, has undergone its latest repairs and is ready for the 82nd Congress to convene in 1951. 00:12:26 President Truman delivers his annual State of the Union address in the newly refurbished House chamber, calling for strength and unity at home and abroad. 00:13:05 Professor Satalie begins his demonstration by introducing liquid air, which is air turned into liquid at 300 degrees below zero. 00:13:30 He starts by dropping various objects like a banana, an egg, daffodils, and a chunk of rubber tubing into the super frigid liquid air. 00:14:10 A contraption is used to demonstrate the pressure possibilities of liquid air, showing how it rapidly expands when it warms and turns back into a gas, inflating a balloon. 00:14:54 The demonstration concludes with pyrotechnics, as an open jar of liquid air gradually becomes almost pure oxygen and highly inflammable, creating a memorable experience for the students. 00:15:39 The Army's waterproof jeeps are demonstrated at Marineland, Florida, using a snorkel system to allow the engine to breathe underwater. 00:16:49 The segment transitions to the Union Connecting Railroad, a large zero-gauge model railroad operated by the New York Society of Model Engineers. 00:17:43 The UCRR, built to a scale of a quarter of an inch to a foot, meticulously duplicates actual railroad operations, reflecting the powerful lure of railroading for Americans. 00:18:09 Canadian scientists at Chalk River operate the world's most powerful atomic pile, producing materials like Cobalt 60 for peaceful applications in radiography and other fields. 00:21:04 At the world's highest observatory in Climax, Colorado, Dr. Walter Orur Roberts uses a coronagraph to study the sun's surface, forecasting radio reception quality and capturing violent solar upheavals. 00:22:25 In White Sands, New Mexico, rockets equipped with special cameras photograph the Earth from record altitudes, providing new perspectives on our planet and foreshadowing future scientific and travel advancements. 2025-12-01T17:00:29.000Z yes A/V Geeks 16mm Films no 1435 atomic weaponsatomic testsradioactive iodineliquid airdairy farmingunderwater jeep82nd US Congressreligious manuscriptssolar prominencesCobalt 60White SandsNew MexicoEniwetok Atollanimal relationsinnovations https://avgeeks.videonest.co/videos/1475753/av-geeks-16mm-lunch-12-1-2025 https://i.ytimg.com/vi/_0wPgpj7hmw/maxresdefault_live.jpg https://gamma.videonest.org/1475753_video_v4_360.mp4 AV Geeks 16mm Lunch 12-1-2025 Ooff.. rushing to get this show together! #avgeeks #16mmfilms 2025-12-01T19:01:48.000Z yes A/V Geeks 16mm Films no 3551 https://avgeeks.videonest.co/videos/1476715/moroccan-casbah-silent-1970s https://img.videonest.org/gamma/1476715_thumbnail_resized_v2.webp https://gamma.videonest.org/1476715_video_v4_360.mp4 [Moroccan Casbah, silent, 1970s] Raw silent footage of Morocco. [Moroccan Casbah, silent, 1970s] Overview The footage captures the daily life of a Moroccan casbah during the 1970s. #MoroccanCasbah #1970sCulture #TraditionalLife #MarketScenes #CulturalHeritage 00:00:00 - 00:00:55 Moroccan Casbah Life in the 1970s 00:00:10 A bustling market scene in a Moroccan casbah features people in traditional attire, colorful stalls, and a donkey 00:00:26 A person walks through a dimly lit alleyway, emerging into a sunlit, bustling street scene that captures Moroccan architecture and daily life. 00:00:27 A cloaked figure navigates a narrow, dark alley, with bright sunlight at the entrance revealing a busy street with people and shops. 00:00:35 A bustling Moroccan street in the 1970s shows people on a cobblestone path, traditional architecture, and groups gathered near an alley entrance 00:00:55 - 00:01:50 Daily Life in a Moroccan Casbah 00:00:55 A person in traditional attire guides a donkey through a narrow, sunlit alleyway in a Moroccan casbah 00:01:03 A bustling market scene unfolds with people in traditional attire navigating narrow, lively streets, as stalls display colorful goods and household items. 00:01:26 A crowded street in a Moroccan casbah showcases people in traditional attire navigating narrow alleys lined with diverse goods, reflecting the rich cultural tapestry of the era. 00:01:46 People navigate narrow alleyways, carrying large bundles amidst traditional architecture and crowded paths Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-12-02T05:00:38.000Z yes A/V Geeks 16mm Films no 111 Moroccan Casbah1970s CultureTraditional LifeMarket ScenesCultural HeritageMoroccoVintage FootageHistorical FootageOld MarketMoroccan LifestyleMoroccan Culture https://avgeeks.videonest.co/videos/1476716/av-geeks-16mm-lunch-12-2-2025 https://img.videonest.org/gamma/1476716_thumbnail_resized_v2.webp https://gamma.videonest.org/1476716_video_v4_360.mp4 AV Geeks 16mm Lunch 12 2 2025 Join us for some 16mm films! It's what we watch! #16mmfilms #avgeeks Telling Time with Count Clock Salute to a Crusader Robert Frost 2025-12-02T02:46:59.000Z yes A/V Geeks 16mm Films no 3473 Telling TimeCount ClockRobert FrostDwight EisenhowerWorld War IIAmerican poetryeducational filmlearningteaching16mm filmspoetryVermontPolitical CampaignNew Englandrural life https://avgeeks.videonest.co/videos/1476889/so-long-1951 https://img.videonest.org/gamma/1476889_thumbnail_resized_v2.webp https://gamma.videonest.org/1476889_video_v4_360.mp4 So Long (1951) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Snader telescription where the Weavers sing "So Long". 2025-12-02T17:00:45.000Z yes A/V Geeks 16mm Films no 212 the weaversso long songsnader telescription1951folk musicvintage performanceAmerican folk https://avgeeks.videonest.co/videos/1477235/the-lonely-night-part-1-1954 https://img.videonest.org/gamma/1477235_thumbnail_resized_v2.webp https://gamma.videonest.org/1477235_video_v4.mp4 The Lonely Night (part 1, 1954) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Narrator, Frank Silvera. Explores the themes of loneliness and connection during the night, highlighting the contrast between solitude and family togetherness. It delves into the emotional struggles of individuals like Carolyn, who grapple with feelings of abandonment and unfulfilled needs for love and acceptance. The narrative emphasizes the significance of family interactions and the complexities of growing up, illustrating how childhood experiences shape one’s understanding of relationships and self-worth. 2025-12-03T05:00:39.000Z yes A/V Geeks 16mm Films no 1656 The Lonely Nightlonelinessfamilypsychiatrynighttimeparentingchildhood traumafamily dynamicmental healthdivorcegrowing upchildhoodfather daughtersingle parentingtherapy https://avgeeks.videonest.co/videos/1477504/the-lonely-night-part-2-1954 https://img.videonest.org/gamma/1477504_thumbnail_resized_v2.webp https://gamma.videonest.org/1477504_video_v4.mp4 The Lonely Night (part 2, 1954) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Explores the emotional struggles of a young girl named Carolyn as she navigates her feelings about relationships, self-identity, and the challenges of growing up. Through her conversations, she reflects on her past experiences, fears of rejection, and the complexities of her interactions with others, particularly with boys. The narrative emphasizes the importance of understanding emotions, building confidence, and the role of supportive relationships in overcoming loneliness and mental health issues. 2025-12-03T17:00:36.000Z yes A/V Geeks 16mm Films no 2099 mental healthlonelinessrelationshipschildhoodemotionsself-identityemotional expressiontherapy sessionanxietyfeardatinglovesadnessfamilypsychiatry https://avgeeks.videonest.co/videos/1477505/av-geeks-16mm-lunch-12-3-2025 https://img.videonest.org/gamma/1477505_thumbnail_resized_v2.webp https://gamma.videonest.org/1477505_video_v5_360.mp4 AV Geeks 16mm Lunch 12 3 2025 Do you prefer your films to be 16mm? We do too! #16mmfilms #avgeeks Transportation USA Caller Mustang - Managing a Misfit 2025-12-03T05:01:16.000Z yes A/V Geeks 16mm Films no 4078 16mm filmsAV GeeksTransportation USAsquare dancingwild mustangsDenver Pylevintage videoAmerican Mustanghorse managementanimal conservationloggingAmerican Airlinesfolk dancemustangtransportation https://avgeeks.videonest.co/videos/1477825/phoney-express-1962 https://img.videonest.org/gamma/1477825_thumbnail_resized_v2.webp https://gamma.videonest.org/1477825_video_v4.mp4 Phoney Express (1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The cartoon features Inspector Willoughby, a criminologist tasked with capturing the international spy known as X13 in London. The narrative unfolds with comedic elements as Inspector Willoughby pursues X13 through various locations. The chase includes encounters with suspicious characters and a series of close calls. 2025-12-04T05:00:23.000Z yes A/V Geeks 16mm Films no 387 https://avgeeks.videonest.co/videos/1478027/bmw-zacks-and-perrier-inc-silent-a-and-b-rolls-1970s https://img.videonest.org/gamma/1478027_thumbnail_resized_v2.webp https://gamma.videonest.org/1478027_video_v4.mp4 [BMW Zacks and Perrier Inc (silent, A and B-rolls, 1970s)] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:01:02 A motorcyclist rides a classic BMW motorcycle across a grassy field, emphasizing the vehicle's performance and design from the 1970s. 00:02:57 Motorcyclists perform a demonstration or race on a wide, gravel-covered track, showcasing skillful maneuvering and the dynamics of motorcycle handling. 00:04:04 A motorcyclist navigates through a wooded terrain, focusing on adventure and exploration in a rugged environment. 00:04:42 Motorcyclists participate in a street event, possibly a race or demonstration, with spectators watching from the roadside, capturing the excitement of 1970s motorcycle culture. 00:06:09 - 00:12:48 BMW Motorcycle Features and Performance 00:07:29 The segment opens with a close-up view of a vintage motorcycle's handlebar and dashboard, emphasizing its intricate 1970s design. 00:08:13 A motorcyclist is shown riding a BMW motorcycle on a tree-lined road, highlighting the vehicle's dynamic performance and the rider's safety gear. 00:11:02 A close-up shot focuses on a BMW engine component, specifically the Bing carburetor, illustrating the mechanical precision of 1970s engineering. 00:12:05 The segment concludes with a view of the motorcycle in motion, focusing on its rear wheel and suspension system to demonstrate its dynamic capabilities. 2025-12-04T17:01:47.000Z yes A/V Geeks 16mm Films no 769 https://avgeeks.videonest.co/videos/1478178/av-geeks-16mm-lunch-12-4-2025 https://img.videonest.org/gamma/1478178_thumbnail_resized_v2.webp https://gamma.videonest.org/1478178_video_v4.mp4 AV Geeks 16mm Lunch 12-4-2025 1500! #avgeeks #16mmfilms 2025-12-04T19:06:25.000Z yes A/V Geeks 16mm Films no 3900 16mm filmA/V GeeksEducational Filmfilm preservationchildrenanimation studiosvintage aestheticexperimental filmfilm printsfilm restorationshort filmcommunityTrash WheelBaltimore Marylandfilm animation https://avgeeks.videonest.co/videos/1478290/responsibility-1953 https://img.videonest.org/gamma/1478290_thumbnail_resized_v2.webp https://gamma.videonest.org/1478290_video_v4.mp4 Responsibility (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the experiences of Hank Evans, a student at Lincoln High School, who grapples with the concept of responsibility in both academic and social contexts. Through various incidents, including missed assignments and a debate competition, Hank learns the importance of being accountable for his actions and the impact of his choices on himself and others. The narrative culminates in a school election where Hank's popularity is contrasted with his friend Lloyd Smith's reliability, prompting viewers to consider the value of responsibility versus popularity. #Responsibility #StudentLife #LifeLessons 2025-12-05T05:00:12.000Z yes A/V Geeks 16mm Films no 674 Lincoln High Schoolhigh schoolHank EvansLloyd Smithschool electionstudent liferesponsibilityclass assignmentsstudyingclass discussiondebate teampolitical electionvotingpresidentabsentee ballot https://avgeeks.videonest.co/videos/1478374/av-geeks-16mm-lunch-12-5-2025 https://img.videonest.org/gamma/1478374_thumbnail_resized_v2.webp https://gamma.videonest.org/1478374_video_v4.mp4 AV Geeks 16mm Lunch 12 5 2025 16mm films ready to eat! With milk! #avgeeks #16mmfilms Post Cereal TV Ads. 2025-12-05T05:33:57.000Z yes A/V Geeks 16mm Films no 3856 A/V Geeks16mm filmPost cerealvintage adsTV commercialPost cerealscorn flakesbreakfast cerealSugar CrispGrape NutsAlpha BitsPost ToastiesRaisin BranVintage AdvertisingCereal Commercial https://avgeeks.videonest.co/videos/1479407/the-weavers-the-roving-kind-snader-telescription-1950s https://img.videonest.org/gamma/1479407_thumbnail_resized_v2.webp https://gamma.videonest.org/1479407_video_v4.mp4 The Weavers - The Roving Kind (Snader telescription, 1950s) The Weavers - The Roving Kind (Snader telescription, 1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-12-05T17:01:39.000Z yes A/V Geeks 16mm Films no 199 The WeaversThe Roving KindSnader telescription1950s musicfolk musicwestern electric recordinggroup performance16mm film https://avgeeks.videonest.co/videos/1486918/av-geeks-16mm-lunch-12-8-2025 https://img.videonest.org/gamma/1486918_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1486918/av-geeks-16mm-lunch-12-8-2025 AV Geeks 16mm Lunch 12-8-2025 Slowly things are getting back to normal at the archive! Live scanning! 2025-12-08T19:16:29.000Z yes A/V Geeks 16mm Films no 4615 16mm filmvintage filmeducational filmAmerican historytrade offsDonald Duckhome safetyeconomic educationDust Bowlphotographyfilm projectorbarteringrural lifedog bitesafety awareness https://avgeeks.videonest.co/videos/1487027/crosstown-adventure-1970 https://img.videonest.org/gamma/1487027_thumbnail_resized_v2.webp https://gamma.videonest.org/1487027_video_v4.mp4 Crosstown Adventure (1970) This highly creative film invites young viewers to become active participants instead of passive viewers. An eight-year-old boy is accidentally shut up in a delivery truck that takes off across town. He can only guess where he is by listening to the outside sounds—warning bells on a drawbridge, fire truck sirens, the roar of a train. When the truck stops in a strange neighborhood, the boy climbs out and hides behind a hedge. What happens next? The teacher stops the film and the children make up their own endings before she shows the three filmed possibilities. 2025-12-09T05:00:08.000Z yes A/V Geeks 16mm Films no 754 https://avgeeks.videonest.co/videos/1487489/av-geeks-16mm-lunch-12-9-2025 https://img.videonest.org/gamma/1487489_thumbnail_resized_v2.webp https://gamma.videonest.org/1487489_video_v4.mp4 A/V Geeks 16mm Lunch 12-9-2025 Spawning over 100 years of audiovisual technology. #avgeeks #16mmfilms 2025-12-09T19:05:31.000Z yes A/V Geeks 16mm Films no 3627 16mm filmAmerican FarmerGreat DepressionUS Coast Guardboating safetyinternal combustion enginevintage technologycar mechanicsChristmas celebrationSwedenfarm automationWorld War IIAV GeeksSkip Elsheimerfuel efficiency https://avgeeks.videonest.co/videos/1487637/trade-offs-why-money https://img.videonest.org/gamma/1487637_thumbnail_resized_v2.webp https://gamma.videonest.org/1487637_video_v4.mp4 Trade Offs: Why Money? Explores the complexities and implications of financial decisions and the trade-offs involved in managing money. It discusses how choices related to spending, saving, and investing impact individuals and society. 2025-12-10T05:01:04.000Z yes A/V Geeks 16mm Films no 1203 MoneyTradingTrade OffsBarterCurrencyEconomic educationCashCredit cardAntique storeantiquestrading itemsSkateboardWhitbyCheck writingAIT https://avgeeks.videonest.co/videos/1488068/av-geeks-16mm-lunch-12-10-2025 https://img.videonest.org/gamma/1488068_thumbnail_resized_v2.webp https://gamma.videonest.org/1488068_video_v5_360.mp4 AV Geeks 16mm Lunch 12-10-2025 More 16mm films funneled through digital technologies so you can watch them on your phone! #avgeeks #16mmfilms 2025-12-10T19:10:39.000Z yes A/V Geeks 16mm Films no 4236 16mm filmAV Geeksvintage filmlibrary resourcesCanterbury CathedralKyoto Japaneducational filmfilm reelfilm projectorlibrary card catalogmissionary filmWorld War IIcathedral citychoirmissionaries https://avgeeks.videonest.co/videos/1489130/av-geeks-16mm-lunch-12-11-2025 https://img.videonest.org/gamma/1489130_thumbnail_resized_v2.webp https://gamma.videonest.org/1489130_video_v5_360.mp4 A/V Geeks 16mm Lunch 12-11-2025 16mm films boom go the dynamite! #avgeeks #16mmfilms 2025-12-11T19:09:02.000Z yes A/V Geeks 16mm Films no 4210 16mm filmAV Geeksfilm projectorInsect EnemiesCoronet Filmsinsect controlChristmasvintage psachild developmentparentingChristianityreligious filmsalvationeternal lifeJesus Christ https://avgeeks.videonest.co/videos/1489542/av-geeks-16mm-lunch-12-12-2025 https://img.videonest.org/gamma/1489542_thumbnail_resized_v2.webp https://gamma.videonest.org/1489542_video_v5_360.mp4 A/V Geeks 16mm Lunch 12-12-2025 What technical problem are we having today? Join us and find out! #avgeeks #16mmfilms 2025-12-12T19:12:14.000Z yes A/V Geeks 16mm Films no 4325 16mm filmAV Geekspotteryceramicsfire safetyLawrence Welkvintage filmclayhospital firepopulation explosionchristianbig bandnurse trainingvintage televisioncraft https://avgeeks.videonest.co/videos/1489645/fire-in-the-patient-care-facility-rehearsal-for-survival-1970s https://img.videonest.org/gamma/1489645_thumbnail_resized_v2.webp https://gamma.videonest.org/1489645_video_v4.mp4 Fire in the patient-care facility : rehearsal for survival. (1970s) This training film uses testimony from a real nursing-home fire to argue that even “prepared” facilities can fail when the first minute is mishandled, especially at night with reduced staffing. It reframes fire response around the people most likely to discover a patient-area fire—nurses and frontline patient-care staff—and presents a rehearsal-style format: viewers are shown staged emergencies, asked to decide what to do, then shown the safest, fastest course of action. Through scenarios like a wastebasket fire, a bed fire, and a rapidly growing room fire, it teaches “first-aid firefighting” with improvised tools (blankets, sheets, towels, water), stresses immediate patient protection before anything else, and emphasizes containment (closing doors, checking heat before reentry, sealing door gaps) and rapid communication (sounding the alarm to bring help). It also highlights complications unique to healthcare—smoke and toxic gases, multiple patients, and medical devices like IVs and oxygen—insisting these become secondary to removing patients from life-threatening smoke and flame. The film concludes with a clear sequence of priorities: remove the patient from immediate danger, communicate/raise the alarm, then attempt limited firefighting, followed by progressive patient movement from emergency removal to staging behind fire doors, with full evacuation treated as a last resort. 2025-12-13T05:00:00.000Z yes A/V Geeks 16mm Films no 827 fire safetypatient careemergency responsefire fightinghealthcare facilityfire preparednessnurse trainingdisaster managementfire drillpatient rescuesmoke inhalationsafety protocolhospital firefire emergencyemergency removal https://avgeeks.videonest.co/videos/1489646/inspection-of-pleasure-craft-for-federal-requirements-1970s https://img.videonest.org/gamma/1489646_thumbnail_resized_v2.webp https://gamma.videonest.org/1489646_video_v4.mp4 Inspection Of Pleasure Craft for Federal Requirements (1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Provides a detailed overview of a Coast Guard inspection of a pleasure craft, highlighting the procedures and safety checks performed by the boarding officer. Key points include the importance of proper communication, the examination of safety equipment, and the issuance of warnings for violations. The officer emphasizes courteous interaction with boat operators while ensuring compliance with federal regulations. Keywords Coast Guard, boat inspection, safety equipment, federal regulations, courtesy 2025-12-13T03:00:00.000Z yes A/V Geeks 16mm Films no 767 Coast GuardBoat InspectionBoating SafetyBoating RegulationsFederal boatingBoating lawslife vestfire extinguisherboatingboatmarine enginePersonal Safetywarning sticker https://avgeeks.videonest.co/videos/1489964/tradeoffs-helping-out-1978 https://img.videonest.org/gamma/1489964_thumbnail_resized_v2.webp https://gamma.videonest.org/1489964_video_v4.mp4 TradeOffs: Helping Out (1978) This Canadian economic-education film, Tradeoffs, teaches the idea of indirect benefits (and the policy choices they create) through a story about rabies vaccination. A town-council member, Martin, argues against publicly funded “life-saving classes” and insists people should pay for what they want—until his daughter Sarah is bitten by a stray red dog and faces the prospect of painful rabies shots if the animal can’t be found and proven vaccinated. The frantic search reveals the real problem: when vaccination is left purely to individual choice and cost, some owners skip it, creating risks for everyone—especially when animals roam and records are hard to verify quickly. After learning the dog actually had a recent rabies shot (paid for by someone else), Martin recognizes that one person’s action protected strangers like Sarah and reverses his stance, concluding the community may need to ensure universal coverage. The film then explicitly frames the policy “tradeoffs,” asking viewers to evaluate three alternatives—fines/penalties, tax-funded subsidies, or encouragement/voluntary compliance—using criteria like owner freedom, owner responsibility, and who benefits. 2025-12-14T05:00:00.000Z yes A/V Geeks 16mm Films no 1138 economic educationrabies shotsdog bitesvaccinationowner responsibilitytown councilhealthcarepet ownershipanimal healthethical issuesgovernment subsidydogred dogDogHelping Out https://avgeeks.videonest.co/videos/1490342/where-mileage-begins-1949 https://img.videonest.org/gamma/1490342_thumbnail_resized_v2.webp https://gamma.videonest.org/1490342_video_v4.mp4 Where Mileage Begins (1949) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film explains the principles and development of the gasoline-powered internal combustion engine by tracing its evolution from early concepts likened to a cannon to the refined automobile engines of the modern era. It compares gasoline to other explosive fuels to illustrate its superior efficiency, then methodically breaks down engine operation using the four-stroke cycle—intake, compression, power, and exhaust—explaining how components such as pistons, crankshafts, carburetors, valves, camshafts, and ignition systems work together. The film explores combustion science, including smooth versus knocking combustion and the role of fuel chemistry, before moving through the step-by-step assembly of an engine and its integration into a car’s drivetrain. It concludes by situating the engine within the larger automobile system—transmission, differential, brakes, steering, and chassis—emphasizing the sophistication, efficiency, and engineering precision that define the modern automobile. 2025-12-15T05:00:00.000Z yes A/V Geeks 16mm Films no 1094 internal combustion enginegasoline enginefour-stroke cycleengine componentsengine assemblyautomotive enginemodern engineautomotive engineeringautomobileGeneral Motorshistoryengine blockcompression ratioanti-knock fuelssmooth burning https://avgeeks.videonest.co/videos/1490592/av-geeks-16mm-lunch-12-15-2025 https://img.videonest.org/gamma/1490592_thumbnail_resized_v2.webp https://gamma.videonest.org/1490592_video_v4.mp4 AV Geeks 16mm Lunch 12-15-2025 How can we tell what day it is when we watch vintage 16mm films everyday? #avgeeks #16mmfilms 2025-12-15T19:03:37.000Z yes A/V Geeks 16mm Films no 3834 AV Geeks16mm Filmturkey farmbaseballCasey StengelNew York MetsHoly CommunionJesus ChristThanksgivingChristianitypoultry farmShea StadiumBabe RuthEucharistChristian tradition https://avgeeks.videonest.co/videos/1491973/how-to-witness-1961 https://img.videonest.org/gamma/1491973_thumbnail_resized_v2.webp https://gamma.videonest.org/1491973_video_v4.mp4 How To Witness (1961) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A dialogue between Jim and a pastor discussing the importance of witnessing for Christ and effectively sharing the Gospel. Jim expresses his feelings of failure after trying to witness to Walter Reynolds, who rejected him. The pastor advises Jim on how to prepare for witnessing, emphasizing prayer, understanding scripture, and guiding the conversation to help others recognize their need for salvation. The conversation shifts to Jim's successful attempt to witness to Reynolds, where he explains key biblical concepts of sin, repentance, and accepting Christ. Suggest up to 3 tags related to video content: #ChristianWitnessing #Evangelism #BibleStudy Keywords Witnessing, Salvation, Evangelism 2025-12-16T05:00:00.000Z yes A/V Geeks 16mm Films no 1049 Christian WitnessingEvangelismSalvationPastorJimWalter ReynoldsBibleChristianityReligionJesus ChristBible readingRomansthe afterlifeeternal lifeRepent https://avgeeks.videonest.co/videos/1492247/av-geeks-16mm-lunch-12-16-2025 https://img.videonest.org/gamma/1492247_thumbnail_resized_v2.webp https://gamma.videonest.org/1492247_video_v4.mp4 AV Geeks 16mm Lunch 12-16-2025 Skip's sick but that won't stop him from showing old 16mm films! #avgeeks #16mmfilms 2025-12-16T18:58:12.000Z yes A/V Geeks 16mm Films no 3543 16mm filmA/V GeeksSkip ElsheimerBank RobberyBunco BoysPrison LifeClassroomEducationScamsFraudTeacherStudentVintage AdsDocumentaryCrime https://avgeeks.videonest.co/videos/1492458/insect-enemies-and-their-control-1962 https://img.videonest.org/gamma/1492458_thumbnail_resized_v2.webp https://gamma.videonest.org/1492458_video_v4.mp4 Insect Enemies And Their Control (1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film introduces the work of **entomologists** and shows how studying insect life cycles and behavior helps people manage the small but destructive share of insects that threaten crops, health, animals, and property. After noting beneficial insects (fruit flies for genetics research, bees for pollination, scavengers that break down waste), it surveys major pests and the control methods used against them: the **European corn borer** (managed through altered planting dates, resistant corn varieties, and insecticides), the **codling moth** in apples (orchard sanitation such as burning infested debris plus repeated spraying), and the **boll weevil** in cotton (including aerial insecticide dusting). The film then broadens into **integrated control**, contrasting chemicals tailored to chewing vs. sucking insects with natural controls such as birds and predatory/parasitoid insects (a parasitic wasp attacking a caterpillar, and lady beetles released to reduce cottony cushion scale in citrus groves). It also covers public-health and household pests—the **housefly** and **mosquitoes** (sanitation, screening, and larval control on standing water, including malaria-carrying Anopheles), **clothes moths** (dry cleaning and moth crystals), **termites** (soil treatments forming a toxic barrier), and **elm bark beetles** that spread Dutch elm disease (removing and burning infected trees). The film closes by framing pest control as a continuous, evolving “war,” emphasizing that everyone benefits from coordinated prevention and control strategies. 2025-12-17T05:00:00.000Z yes A/V Geeks 16mm Films no 609 entomologistinsect pestscrop damageintegrated pest managementboll weevilEuropean corn borercodling mothinsecticidesbiological controlmosquito controltermite treatmenthousefliesDutch elm diseaselady beetlespest control https://avgeeks.videonest.co/videos/1492881/av-geeks-16mm-lunch-12-17-2025 https://img.videonest.org/gamma/1492881_thumbnail_resized_v2.webp https://gamma.videonest.org/1492881_video_v4.mp4 AV Geeks 16mm Lunch 12-17-2025 16mm films? Yes! #avgeeks #16mmfilms 2025-12-17T18:00:06.000Z yes A/V Geeks 16mm Films no 3582 Synthetic RubberWorld War II16mm filmBuna SUnited States Rubber CompanyHallmark CardsChristmas CardsTire ManufacturingPetroleumButadieneStyreneChemical processRubber ManufacturingChristmasAdvertising https://avgeeks.videonest.co/videos/1492995/down-on-the-farm-1969 https://img.videonest.org/gamma/1492995_thumbnail_resized_v2.webp https://gamma.videonest.org/1492995_video_v4.mp4 Down On The Farm (1969) "Down On The Farm" explores the evolution of American agriculture from colonial times through the 20th century. It highlights the significant role of farmers in the economy, the hardships faced during the Great Depression, and the technological advancements that transformed farming practices. The narrative details the struggles of farmers, including the impact of drought and economic downturns, while also showcasing the resilience and adaptability of the agricultural sector, leading to a modern era of increased productivity and innovation. keyword American agriculture 2025-12-18T05:00:00.000Z yes A/V Geeks 16mm Films no 908 American FarmerGreat DepressionDust BowlFarm Foreclosurefarm familiesdroughtdust stormsWorld War IIharvestingfarmingagricultural revolutionUS AgricultureGrainOld FilmRetro https://avgeeks.videonest.co/videos/1493289/av-geeks-16mm-lunch-12-18-2025 https://img.videonest.org/gamma/1493289_thumbnail_resized_v2.webp https://gamma.videonest.org/1493289_video_v5_360.mp4 A/V Geeks 16mm Lunch 12-18-2025 16mm films about mail?! #avgeeks #16mmfilms 2025-12-18T19:22:06.000Z yes A/V Geeks 16mm Films no 4928 https://avgeeks.videonest.co/videos/1493818/childhood-of-jesus-1952 https://img.videonest.org/gamma/1493818_thumbnail_resized_v2.webp https://gamma.videonest.org/1493818_video_v4.mp4 Childhood Of Jesus (1952) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Recounts the early life of Jesus, highlighting his birth in Bethlehem, the presentation at the temple, and the visit of the wise men. It describes the recognition of Jesus as the Savior by Simeon and Anna, Herod's plot to kill him, and the family's escape to Egypt. The narrative concludes with Jesus' return to Nazareth and his early awareness of his divine mission. Suggest up to 3 tags related to video content: #Jesus #BibleStories #Nativity keyword Childhood of Jesus 2025-12-19T05:00:00.000Z yes A/V Geeks 16mm Films no 807 Childhood of JesusJesusNativityBethlehemVirgin MaryJosephThree Wise MenHerod the GreatTemple of JerusalemPresentation of JesusNazarethGalileeKing of the JewsSimeonAnna https://avgeeks.videonest.co/videos/1494077/av-geeks-16mm-lunch-12-19-2025 https://img.videonest.org/gamma/1494077_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1494077/av-geeks-16mm-lunch-12-19-2025 AV Geeks 16mm Lunch 12-19-2025 Fridays are a time to each lunch and watch old 16mm films. #avgeeks #16mmfilms 2025-12-19T19:12:42.000Z yes A/V Geeks 16mm Films no 4504 16mm filmvintage filmlaundrydry cleaningGlam-O-RamaBounce fabric softenervintage commercialslaundry equipmentfranchiserhythmic ball skillsexercisestatic clingsoftnessNorth CarolinaBanner Machinery https://avgeeks.videonest.co/videos/1494467/explosion-1970s https://img.videonest.org/gamma/1494467_thumbnail_resized_v2.webp https://gamma.videonest.org/1494467_video_v4.mp4 Explosion (1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Bob Kurtz discusses the overwhelming challenges posed by the rapid global population growth, highlighting the need for Christians to take action in addressing issues like hunger, education, and spiritual famine. He emphasizes the responsibility of those who have been given much to help those in need and urges viewers to consider their role in global evangelism. Kurtz calls for creativity and initiative in spreading the message of Jesus Christ, particularly among the youth, and stresses the importance of supporting missionaries and engaging in the church's mission. Keywords Population explosion, Christian responsibility, global evangelism, spiritual famine, missionary work. 2025-12-20T05:00:00.000Z yes A/V Geeks 16mm Films no 1160 Bob Kurtzchristianoverpopulationworld populationglobal issuesAfricapovertyChristianityreligionworldevangelizationJesus ChristChristian missionmissionaryworld evangelism https://avgeeks.videonest.co/videos/1494905/holy-communion-1975 https://img.videonest.org/gamma/1494905_thumbnail_resized_v2.webp https://gamma.videonest.org/1494905_video_v4.mp4 Holy Communion (1975) Discusses the significance of Holy Communion in Christianity, highlighting its biblical origins and various interpretations across denominations such as Baptists, Methodists, and Episcopalians. It emphasizes the communal aspect of the Lord's Supper, the personal connection to Jesus Christ, and the importance of remembrance and participation in the sacrament. Suggest up to 3 tags related to video content: #HolyCommunion #Christianity #Sacraments Keyword Holy Communion 2025-12-21T05:00:00.000Z yes A/V Geeks 16mm Films no 1154 Holy CommunionLord's SupperJesus ChristChristianityLast SupperEucharistReligious CeremonyChurch serviceBaptist traditionMethodist traditionEpiscopalcommunionGospelBreadWine https://avgeeks.videonest.co/videos/1495400/keys-to-the-library-1951 https://img.videonest.org/gamma/1495400_thumbnail_resized_v2.webp https://gamma.videonest.org/1495400_video_v4.mp4 Keys To The Library (1951) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Serves as a guide for new students at a community college on how to effectively utilize the library's resources. It emphasizes the importance of familiarizing oneself with the library's layout, including key areas such as the card catalog, reading rooms, and book stacks. The guide explains how to locate books using the card catalog and the Dewey Decimal classification system, as well as how to find pamphlets, magazine articles, and encyclopedic information. It also highlights the use of dictionaries and biographical dictionaries for word definitions and information about notable individuals. The overarching message encourages students to actively engage with library resources and seek assistance from librarians when needed, reinforcing the idea that the library is a valuable tool for both academic and personal enrichment. 2025-12-22T05:00:00.000Z yes A/V Geeks 16mm Films no 838 libraryK-B Educational Filmscommunity collegecard cataloghigher educationcollege studentlibrary researchbook stackspamphlet fileperiodical literatureencyclopediaReader's Guideresearch skillsreference bookslibrary guide https://avgeeks.videonest.co/videos/1495772/av-geeks-16mm-lunch-12-22-2025 https://img.videonest.org/gamma/1495772_thumbnail_resized_v2.webp https://gamma.videonest.org/1495772_video_v4_converted.mp4 AV Geeks 16mm Lunch 12-22-2025 16MMonday! #avgeeks #16mmfilms 2025-12-22T19:10:12.000Z yes A/V Geeks 16mm Films no 4280 16mm filmvintage filmfarmers of indiaIndian culturerural IndiaGanges RiverAmerican family1880spublic service announcementaccident preventioncommunity safetyNational Safety CouncilsafetywheelchairAV Geeks https://avgeeks.videonest.co/videos/1496163/bunco-boys-and-how-to-beat-them-1973 https://img.videonest.org/gamma/1496163_thumbnail_resized_v2.webp https://gamma.videonest.org/1496163_video_v4.mp4 Bunco Boys And How To Beat Them (1973) "Bunco Boys And How To Beat Them" (1973) depicts various con schemes, particularly focusing on the "pigeon drop." It follows a bank examiner, Robert Mars, who investigates fraudulent activities involving con artists attempting to swindle unsuspecting victims out of their money. Key characters, including Mrs. Kushman, are manipulated into believing they are helping with an investigation, only to discover they are being set up to lose their savings. The film emphasizes the importance of caution, awareness of scams, and the need to avoid gullibility, greed, and misplaced goodness when confronted with suspicious financial situations. 2025-12-23T05:00:00.000Z yes A/V Geeks 16mm Films no 1190 Pigeon DropCon menFraud schemeFinancial crimeBank fraudRobert MarksMildred Kushmanscammoneycon artistfraudcrime preventionsavings accountLos Angeles County SheriffGino Conforti https://avgeeks.videonest.co/videos/1496758/the-nativity-1946-fL1LdE7pF3 https://img.videonest.org/gamma/1496758_thumbnail_resized_v2.webp https://gamma.videonest.org/1496758_video_v4.mp4 The Nativity (1946) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Recounts the biblical narrative of the birth of Jesus Christ, highlighting key events surrounding his arrival. It describes Mary giving birth to Jesus in a manger due to a lack of accommodation, the announcement of his birth to shepherds by an angel, and the subsequent visit of the shepherds to see the newborn. Additionally, it mentions the arrival of wise men from the East, guided by a star, who come to worship Jesus and present him with gifts of gold, frankincense, and myrrh. The overarching themes include joy, worship, and the significance of Jesus' birth as a savior for all people. 2025-12-24T05:00:00.000Z yes A/V Geeks 16mm Films no 1010 The NativityJesus ChristMaryJosephBethlehemThree Wise MenshepherdsChristianitybiblical storygoldfrankincensemyrrhnativity scenemangerAngel Gabriel https://avgeeks.videonest.co/videos/1496771/av-geek-16mm-lunch-12-23-2025-lOYGB3y8j- https://img.videonest.org/gamma/1496771_thumbnail_resized_v2.webp https://gamma.videonest.org/1496771_video_v4.mp4 AV Geek 16mm Lunch 12-23-2025 Another day, another computer.. #avgeeks #16mmfilms 2025-12-24T07:14:44.000Z yes A/V Geeks 16mm Films no 4009 https://avgeeks.videonest.co/videos/1497303/a-v-geeks-16mm-lunch-12-24-2025-mXl0fTGS6u https://img.videonest.org/gamma/1497303_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1497303/a-v-geeks-16mm-lunch-12-24-2025-mXl0fTGS6u A/V Geeks 16mm Lunch 12-24-2025 Christmas Eve? Why, yes, it is. 16mm films? Why, yes, they are.. 2025-12-24T17:58:41.000Z yes A/V Geeks 16mm Films no 4450 https://avgeeks.videonest.co/videos/1497453/casey-at-the-mets-1965-B4ITOy5K5Y https://img.videonest.org/gamma/1497453_thumbnail_resized_v2.webp https://gamma.videonest.org/1497453_video_v4.mp4 Casey At The Mets (1965) "Casey At The Mets" is a documentary that captures the passionate relationship between the New York Mets and their fans during the team's tumultuous first season in 1962. Despite the Mets' struggles and losses, fans remained loyal and hopeful, viewing the team as underdogs. The film highlights the emotional connection fans have with the Mets, the team's journey to find a new stadium, and the charismatic leadership of manager Casey Stengel, who played a pivotal role in fostering this unique bond. The documentary reflects on the Mets' early challenges and the unwavering support from their fanbase, culminating in the excitement of moving into a new stadium, signaling a new chapter for the team. 2025-12-25T05:00:00.000Z yes A/V Geeks 16mm Films no 907 New York MetsCasey StengelBaseballBaseball FanBaseball historyNew York GiantsShea StadiumNew York Citybaseball teambaseball fansBabe RuthLou Gehrigbaseball gameBrooklyn DodgersUmpire https://avgeeks.videonest.co/videos/1497456/early-one-morning-PeN-UKLhZJ https://img.videonest.org/gamma/1497456_thumbnail_resized_v2.webp https://gamma.videonest.org/1497456_video_v4.mp4 Early One Morning Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2025-12-25T05:01:07.000Z yes A/V Geeks 16mm Films no 518 SwedenChristmasVillage ChurchEarly Morning ServiceScandia FilmsChildren's ChoirChristmas SongChurchChurchyardSnowWinterNatureGosta RooslingPhilip Godfrey https://avgeeks.videonest.co/videos/1497674/av-geeks-16mm-lunch-12-25-2025-7BB9FTN2aa https://img.videonest.org/gamma/1497674_thumbnail_resized_v2.webp https://gamma.videonest.org/1497674_video_v4.mp4 AV Geeks 16mm Lunch 12 25 2025 Happy Holidays to you! Opening gifts? So are folks in these home movies! 2025-12-25T18:00:06.000Z yes A/V Geeks 16mm Films no 3761 vintage videochristmas presentschristmas treegift openingfamily timevintage christmasholiday seasonchristmas celebrationfamily gatheringchristmas dayvintage home videochildren playingchristmas giftshome movieopening presents https://avgeeks.videonest.co/videos/1497903/franchise-opportunities-in-the-world-of-work-1970-q7J8O9E0Ra https://img.videonest.org/gamma/1497903_thumbnail_resized_v2.webp https://gamma.videonest.org/1497903_video_v4_360.mp4 Franchise Opportunities In The World of Work (1970) Mr. Sam shares his journey of exploring franchise opportunities after feeling stuck in a dead-end job. He emphasizes the importance of researching reputable franchise companies, understanding financing options, and the significance of location for business success. Gus Sam, a young entrepreneur, is eager to start his own business and learns about the franchise process, including training, location scouting, and operational support. He receives guidance on accounting, advertising, and promotion, ultimately feeling excited about opening his store. The franchise represents a chance for Gus to escape his previous job and build something of his own. Keywords: franchise, business ownership, Gus Sam, research, financing, location, training, operational support, accounting, advertising, entrepreneurship, Small Business Administration, career change. 2025-12-26T05:00:32.000Z yes A/V Geeks 16mm Films no 652 Franchise OpportunityFranchiseKentucky Fried ChickenInternational House of PancakesFranchisingice creamfranchise businessfood qualitystore openingCarvelfood countersmall business1970s https://avgeeks.videonest.co/videos/1498114/av-geeks-16mm-lunch-12-26-2025-dkv5df-Mg_ https://img.videonest.org/gamma/1498114_thumbnail_resized_v2.webp https://gamma.videonest.org/1498114_video_v4_360.mp4 AV Geeks 16mm Lunch 12-26-2025 Happy Boxing Day! Boxing, boxes, jack-in-the-boxes? #16mmfilms #avgeeks 2025-12-26T18:00:06.000Z yes A/V Geeks 16mm Films no 3532 Boxing Dayvintage adsAtlas batteryfast foodJack in the Boxboxingautomotive engineeringbattery technologyCommunity Food Martrechargeable batteryscientific researchelectricitychemical processsportsfilm footage https://avgeeks.videonest.co/videos/1498294/in-the-crash-1970-oUwF3uSiFj https://img.videonest.org/gamma/1498294_thumbnail_resized_v2.webp https://gamma.videonest.org/1498294_video_v4_360.mp4 In The Crash (1970) Discusses highway safety, emphasizing that while preventing accidents is important, it is equally crucial to focus on protecting people and property during crashes. The speaker, Ben Kelly from the Insurance Institute for Highway Safety, argues that effective crash protection should be built into vehicles and road designs rather than relying solely on human behavior to prevent accidents. The film highlights various safety features, such as airbags, seatbelts, and improved vehicle designs that can significantly reduce injuries and fatalities in crashes. It also points out the need for better roadside designs, like breakaway poles and shock-absorbing barriers, to minimize damage during collisions. The overall message is that society should prioritize advancements in vehicle and road safety to protect individuals and reduce economic losses from accidents. Keywords: highway safety, accident prevention, crash protection, airbags, seatbelts, vehicle design, roadside design, economic loss, safety features, human behavior, crash data, breakaway poles, shock-absorbing barriers. 2025-12-27T05:01:14.000Z yes A/V Geeks 16mm Films no 1296 Highway safetyCrash Protectioncar safetyautomobile designairbagseat beltcar crashcrash datavehicle designbreakaway polesroadside safetyvehicle safetycrash testsInsurance InstituteBen Kelly https://avgeeks.videonest.co/videos/1498814/case-study-8-data-processing-1967-BpZ-bGFYQp https://img.videonest.org/gamma/1498814_thumbnail_resized_v2.webp https://gamma.videonest.org/1498814_video_v4_360.mp4 Case Study 8: Data Processing (1967) Mrs. Carson from data processing discusses workplace issues with Millie. Millie reports that a new employee, Helen, is outperforming others, leading to hostility from her coworkers, particularly Jane, who is the ringleader. Millie has encouraged Helen to stand her ground but is concerned about the negative treatment she is receiving. Millie has struggled with Jane for two years, and despite her efforts to enforce rules against gossiping and distractions, the girls continue to undermine her authority. Millie contemplates firing Jane but fears it would lead to more resignations. Keywords: Mrs. Carson, data processing, Millie, workplace issues, Helen, performance, Jane, ringleader, hostility, encouragement, authority, gossiping, distractions, firing, resignations. 2025-12-28T05:00:23.000Z yes A/V Geeks 16mm Films no 246 American Management AssociationMrs. Carsondata processingworkplace issuesHelenemployee performanceJane Bentleyemployee conflictsupervisory skills https://avgeeks.videonest.co/videos/1499136/cave-dwellers-of-the-stone-age-1960-6JwBTaqjqu https://img.videonest.org/gamma/1499136_thumbnail_resized_v2.webp https://gamma.videonest.org/1499136_video_v4.mp4 Cave Dwellers Of The Stone Age (1960) Whoa, this print has some damage to it! 2025-12-29T05:00:39.000Z yes A/V Geeks 16mm Films no 1029 Cave DwellerStone AgeNeanderthalCro-MagnonStone toolsHunting ToolsCave paintingsArchaeologyAnimal HuntingCave ArtCave DwellingPaleolithic ArtFlint ToolsIce Age AnimalsLeather Processing https://avgeeks.videonest.co/videos/1499520/a-v-geeks-16mm-lunch-12-29-2025-kjGS8h3WIT https://img.videonest.org/gamma/1499520_thumbnail_resized_v2.webp https://gamma.videonest.org/1499520_video_v5_360.mp4 A/V Geeks 16mm Lunch 12-29-2025 Live! 16mm films! Snarky comments! Join us! #avgeeks #16mmfilms 2025-12-29T17:59:32.000Z yes A/V Geeks 16mm Films no 4089 https://avgeeks.videonest.co/videos/1499703/string-sounds-1968-yJaG3X26KO https://img.videonest.org/gamma/1499703_thumbnail_resized_v2.webp https://gamma.videonest.org/1499703_video_v4_360.mp4 String Sounds (1968) Discusses the principles of sound production in string instruments, highlighting how the tension and length of strings affect pitch. Tighter and shorter strings produce higher sounds, while longer strings create lower sounds. The interaction between the strings and surrounding materials, such as walls or wooden boxes, can amplify sound. The text also touches on the need for tuning due to loosening from play and mentions various cultural string instruments, such as the Japanese koto and the Indian sitar, emphasizing the unique sounds of each. Additionally, it briefly references American mountain music and the collaborative nature of playing stringed instruments. 2025-12-30T05:00:41.000Z yes A/V Geeks 16mm Films no 917 string soundsstring instrumentinstrument physicssound productionstring vibrationstringed instrumentsmusical instrumentskoto musicsitar musicIndian musicstring musicAmerican mountain musicViolinGuitarBanjo https://avgeeks.videonest.co/videos/1499956/a-v-geeks-16mm-lunch-12-30-2025-75zcN8YH0j https://img.videonest.org/gamma/1499956_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1499956/a-v-geeks-16mm-lunch-12-30-2025-75zcN8YH0j A/V Geeks 16mm Lunch 12-30-2025 Can't wait to get rid of 2025. Lots of turmoil at AV Geeks and we are eager to start fresh in 2026. #avgeeks #16mmfilms 2025-12-30T17:53:38.000Z yes A/V Geeks 16mm Films no 4630 https://avgeeks.videonest.co/videos/1500046/hostage-survival-1977-hKuXqwZnZT https://img.videonest.org/gamma/1500046_thumbnail_resized_v2.webp https://gamma.videonest.org/1500046_video_v4_360.mp4 Hostage Survival (1977) Revolves around strategies for surviving a hostage situation, emphasizing the psychological dynamics between hostages and their captors. Experts highlight the importance of remaining calm and rational, especially during the initial moments of abduction, and suggest that hostages should avoid aggressive behavior and instead seek to establish a rapport with their captors. The conversation also touches on the role of law enforcement, the significance of time in negotiations, and the potential for emotional connections to develop between hostages and kidnappers. Additionally, the risks associated with different types of kidnappers, including psychotic individuals and terrorists, are examined, with a focus on the need for hostages to prioritize their safety and cooperate to increase their chances of survival. Overall, the key takeaway is that hostages should aim to maintain composure, engage in dialogue, and avoid actions that could escalate the situation. 2025-12-31T05:00:54.000Z yes A/V Geeks 16mm Films no 1508 hostage survivalhostage situationkidnappingsurvival strategieslaw enforcementthreat analysisemotional distressTerrorismTerrorist psychologypsychotic personhostagecritical periodsgun violencefilm grainold film https://avgeeks.videonest.co/videos/1500247/a-v-geeks-16mm-lunch-12-31-2025--HGUmPx06M https://img.videonest.org/gamma/1500247_thumbnail_resized_v2.webp https://gamma.videonest.org/1500247_video_v4_360.mp4 A/V Geeks 16mm Lunch 12-31-2025 Everybody else can stay, but 2025.. you've worn out your welcome! Buh-bye! #avgeeks #16mmfilms 2025-12-31T17:55:21.000Z yes A/V Geeks 16mm Films no 4083 16mm filmAV Geekseducational filmvintage filmcultural valuessustainable farminghand toolstool safetySentence Citypuppetsgrammaranimationfilm projectoragricultureeducation https://avgeeks.videonest.co/videos/1500329/the-necklace-1982-8Khlp7WeUo https://img.videonest.org/gamma/1500329_thumbnail_resized_v2.webp https://gamma.videonest.org/1500329_video_v4.mp4 The Necklace (1982) The story revolves around Matilde, a beautiful woman born into a modest family, who marries a petty clerk but yearns for a life of luxury. After borrowing a diamond necklace from her wealthy friend for a gala, she loses it and, in an attempt to replace it, plunges herself and her husband into debt for ten years. 2026-01-01T05:01:32.000Z yes A/V Geeks 16mm Films no 1315 The NecklaceGuy de Maupassant1880smarriageMadame Forestiersocial classborrowing jewelsdebtdiamond necklacenecklace losslost jewelryjewelry replacementpaying debtpoor livingmanual labor https://avgeeks.videonest.co/videos/1500527/a-v-geeks-16mm-lunch-1-1-2026-o_qINc5dIP https://img.videonest.org/gamma/1500527_thumbnail_resized_v2.webp https://gamma.videonest.org/1500527_video_v4.mp4 A/V Geeks 16mm Lunch 1-1-2026 We have the greatest hope for 2026! #avgeeks #16mmfilms 2026-01-01T18:00:06.000Z yes A/V Geeks 16mm Films no 3654 Bob HopeTexacoNational GuardMilitaryMotor OilOil DrillingMilitary ExerciseCar MaintenanceGasolineArmed ForcesHavolineWorld War IIMilitary HistoryRadio ShowAnti-Freeze https://avgeeks.videonest.co/videos/1500632/deadline-1985-RmFRcZuquh https://img.videonest.org/gamma/1500632_thumbnail_resized_v2.webp https://gamma.videonest.org/1500632_video_v4.mp4 Deadline (1985) The film "Deadline" revolves around high school student Jeff, who is struggling with feelings of isolation and pressure from his peers and family. After failing his SATs and being cut from the track team, he writes a letter expressing his suicidal thoughts. His friends and school staff become concerned and work together to find him before it's too late. The narrative explores themes of mental health, the importance of communication, and the impact of societal expectations on youth. Features Lance Kerwin, Ike Eisenmann and Bruno Kirby! 2026-01-02T05:00:52.000Z yes A/V Geeks 16mm Films no 1368 Lance KerwinSherry HurseyIke EisenmannMichael RhodesHigh Schoolsuicide noteJeff Freemantrack teammissing personsuicide concernsfriendshiprevolver1980sBalconyBeach https://avgeeks.videonest.co/videos/1500913/a-v-geeks-16mm-lunch-1-2-2026-vsBuj5sVv7 https://img.videonest.org/gamma/1500913_thumbnail_resized_v2.webp https://gamma.videonest.org/1500913_video_v4.mp4 A/V Geeks 16mm Lunch 1-2-2026 New Year! New 16mm films! #avgeeks #16mmfilms 2026-01-02T17:58:54.000Z yes A/V Geeks 16mm Films no 3969 AV Geeks16mm filmcakescake bakingscience magazinescientific researchfamilyvintagelightning protectionfruit fliesarcheological sitetelecommunicationsclassroom activitybakingdesserts https://avgeeks.videonest.co/videos/1500914/army-navy-screen-magazine-30-W1ncVo0LEO https://img.videonest.org/gamma/1500914_thumbnail_resized_v2.webp https://gamma.videonest.org/1500914_video_v4_360.mp4 Army Navy Screen Magazine #30 This program honors bravery in combat, highlighting the Chaplain Corps and the impact of soldier injuries. It showcases a massive bomber raid, recounts Japanese atrocities in Nanking, and features entertainment for troops, including songs about love, longing, and joy, reflecting the diverse experiences of soldiers during wartime. #ArmyNavyScreenMagazine #WartimeEntertainment #ChaplainCorps #CombatBravery #SoldierSongs Timeline 00:00:00 - 00:01:37 Decorations and the Chaplain Corps 00:00:00 The segment opens with sounds of combat and mentions various decorations for wounds, heroism, and gallantry in action. 00:00:41 It emphasizes that decorations in combat units prove soldiers are exceeding expectations. 00:00:52 The focus shifts to the unarmed Chaplain Corps, noting their high percentage of honors within the army. 00:01:05 Specific examples of decorations within the 34th Division's Chaplain Corps are provided, including Distinguished Service Cross, Purple Hearts, Legion of Merits, and Silver Stars. 00:01:37 - 00:03:06 The Dangers of Accidents in the Army 00:01:37 The Axis powers benefit from counting American soldiers killed and injured by accidents, which are numerous. 00:02:08 Improper lifting of heavy objects leads to hernias, resulting in soldiers being lost for service. 00:02:20 American fighting men sometimes engage in risky behaviors, such as swimming in unsafe areas or engaging in playful but dangerous activities, which can lead to injury. 00:02:48 Avoidable accidents are increasing, and this trend is advantageous to the enemy. 00:03:06 - 00:03:47 American Bombers: A Thousand-Plane Raid 00:03:06 American bombers conduct a massive thousand-plane raid. 00:03:16 The gasoline consumed in a single operation of this size could power a family car for 71 years. 00:03:43 The segment concludes with an exclamation about the intensity of the raid. 00:03:47 - 00:08:11 The Battle for Hill 700 00:05:40 In 1944, the Japanese 6th Division, responsible for the Nanking massacre, captured Hill 700 in Bougainville, a critical location for strategic airfields. 00:05:57 The Japanese, known for their brutality, faced American soldiers in the dense jungle, where the enemy was often unseen but their presence was known through gunfire. 00:06:38 Unlike their previous battles against unarmed civilians in Nanking, the Japanese now faced a different kind of warfare in the jungle, with tanks and heavy artillery. 00:06:50 The jungle warfare was challenging, characterized by concealed snipers, difficult terrain, and the arduous task of supplying the front lines, as American troops slowly pushed back the Japanese. 00:08:11 - 00:16:01 Jubilee Radio Show 00:08:11 The Jubilee radio show is introduced as a popular program among soldiers, receiving fan mail from various fronts and outposts. 00:10:09 Lena Horne performs a song titled "Consequences," which humorously addresses the repercussions of actions. 00:12:29 Private Babe Wallace and Timmie Rodgers perform a comedic song about receiving a draft letter, advising listeners to "bring enough clothes for three days" because they won't be turned loose. 00:14:47 Ernie "Bubbles" Whitman explains that Jubilee uses a personal and informal language to connect with soldiers, aiming to provide entertainment reminiscent of home. 00:16:01 - 00:17:50 The Man I Love 00:16:01 The singer expresses her anticipation for the arrival of 'the man I love,' envisioning him as big and strong. 00:16:31 She imagines a silent understanding between them, where a smile and a hand-hold will convey their feelings. 00:16:57 The singer muses about the uncertainty of when she will meet him, but remains confident that it will happen one day. 00:17:24 She dreams of a future where they build a home together, emphasizing her unwavering commitment to him. 00:17:50 - 00:21:00 Musical Performances 00:17:50 The first song, 'Gertie from Missouri,' begins with a lively swing tune and praises Gertie's beauty and charm. 00:19:05 The song continues to express affection for Gertie, despite a language barrier, highlighting the joy she brings. 00:19:33 The second song, 'Everybody Whistles in Wyoming,' starts with a cheerful melody and describes the whistling tradition in Wyoming. 00:20:18 The song explains that people in Wyoming whistle when a pretty girl walks by, adding a playful element to the state's character. 00:21:00 - 00:27:47 A Medley of Melodies 00:21:00 The first song, "Don't Get Around Much Anymore," expresses a feeling of sadness and disinterest in social activities due to the absence of a loved one. 00:23:14 The second song, "Wait For Me, Mary," is a heartfelt request for a loved one to wait until better times, filled with promises of shared dreams and untold words. 00:25:23 The final song, "When the Red, Red Robin Comes Bob, Bob, Bobbin' Along," is a cheerful and optimistic tune encouraging listeners to wake up, cheer up, and embrace happiness. 2026-01-02T16:03:51.000Z yes A/V Geeks 16mm Films no 1668 Army-NavyScreen MagazineChaplain CorpsNanking MassacreWorld War IIJubilee Radio ShowLena HorneAmerican soldiersJapanese ArmyJungle WarfareArmed Forces Radio ServiceErnie Bubbles WhitmanBig BandVintageMusical performance https://avgeeks.videonest.co/videos/1501029/microorganisms-beneficial-activities-1958-ITCman67Ru https://img.videonest.org/gamma/1501029_thumbnail_resized_v2.webp https://gamma.videonest.org/1501029_video_v4_360.mp4 Microorganisms Beneficial Activities (1958) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the dual nature of microorganisms, highlighting that while some bacteria cause diseases, many are essential for various beneficial processes. Microorganisms play crucial roles in decomposition, the nitrogen cycle, and the production of antibiotics, food, and organic chemicals. They aid in soil fertility, sewage treatment, and food production, such as cheese and vinegar. The video emphasizes that most microorganisms are beneficial and vital for human life and the environment, contributing to agriculture, industry, and health. 2026-01-03T05:00:10.000Z yes A/V Geeks 16mm Films no 862 microorganismsbeneficial activitiesnitrogen cycleantibioticsfood productionsewage treatmentnitrogenbacteriologyfermentationdairy industrymilk productsorganic chemicalsyeastenzymesIndiana University https://avgeeks.videonest.co/videos/1501526/fishers-of-men-1941-CaROAndCEX https://img.videonest.org/gamma/1501526_thumbnail_resized_v2.webp https://gamma.videonest.org/1501526_video_v4_360.mp4 Fishers Of Men (1941) Fishers of Men (1941) is a 22-minute black-and-white religious film produced by the Religious Film Society in London. It dramatizes the biblical story of Simon and Andrew, fishermen on the Sea of Galilee, who become disciples of Jesus, emphasizing how Jesus’ personality transforms the disciples, their families, and the surrounding community. 2026-01-04T05:00:19.000Z yes A/V Geeks 16mm Films no 1225 Fishers of MenReligious FilmSea of GalileeSimon PeterJesus of NazarethAndrewChristian filmdiscipleBiblical DramaJesus ChristChristianityreligious dramahealingexorcismCapernaum https://avgeeks.videonest.co/videos/1501902/last-journey-to-jerusalem-1953-ER3Do0XSi3 https://img.videonest.org/gamma/1501902_thumbnail_resized_v2.webp https://gamma.videonest.org/1501902_video_v4_360.mp4 Last Journey To Jerusalem (1953) The film depicts Jesus and his disciples on their journey to Jerusalem for Passover, highlighting significant moments such as Jesus' foretelling of his death, his interactions with his disciples, and his compassionate acts towards a blind beggar named Bartimaeus and a tax collector named Zacchaeus. Despite the disciples' confusion and fear about the impending events, Jesus emphasizes servitude and love. As they approach Jerusalem, Jesus instructs his disciples to retrieve a colt, symbolizing his entry as a king. The film illustrates the contrasting reactions of the people, who initially celebrate him but will soon turn against him, culminating in his healing miracles and teachings in the temple. 2026-01-05T05:00:38.000Z yes A/V Geeks 16mm Films no 1019 Jesus ChristJerusalemPassoverDisciplesHoly CityBartimaeusJerichoChristianityhealingblind beggarZacchaeustax collectorforgivenessPalm SundayTemple https://avgeeks.videonest.co/videos/1502522/a-v-geeks-16mm-lunch-1-5-2026-kHlo-0Fz1x https://img.videonest.org/gamma/1502522_thumbnail_resized_v2.webp https://gamma.videonest.org/1502522_video_v4.mp4 A/V Geeks 16mm Lunch 1-5-2026 Mondays! Lasagna! 16mm films! #avgeeks #16mmfilms It's Her Future (partial) Switzerland: Land and Its People Breath of Life On the Level - Daddy's Girl 2026-01-05T17:56:56.000Z yes A/V Geeks 16mm Films no 3864 16mm filmSwitzerlandfirst aidCPRfamily relationshipseducational filmvocational educationwomen employmentdrowningrescue breathingtrade schoolteenage girlfatherargumentAV Geeks https://avgeeks.videonest.co/videos/1502655/sentence-city-1978-ZxfT_NvMZk https://img.videonest.org/gamma/1502655_thumbnail_resized_v2.webp https://gamma.videonest.org/1502655_video_v4.mp4 Sentence City (1978) In "Sentence City," Rolo the talking dog learns about writing and the components of sentences, including name words and action words. He discovers that sentences must express complete thoughts and can include descriptive words for more detail. The story emphasizes the importance of punctuation and the different types of sentences: statements, questions, exclamations, and commands. Rolo and his friends prepare for a parade showcasing their sentences, highlighting the fun of writing and creativity. Features Hal Smith doing a variety of voices.. 2026-01-06T05:00:51.000Z yes A/V Geeks 16mm Films no 931 Sentence CityBarr Filmswriting sentenceslearningnounsverbsaction wordsname wordsEducational videoDescriptive wordsProfessor Wordsworthtypes of sentencespunctuation marksstatementquestion https://avgeeks.videonest.co/videos/1502901/av-geeks-16mm-lunch-1-6-2026-L9e3vCiIG3 https://img.videonest.org/gamma/1502901_thumbnail_resized_v2.webp https://gamma.videonest.org/1502901_video_v4.mp4 AV Geeks 16mm Lunch 1-6-2026 Let's watch old 16mm films instead of doomscrolling! #avgeeks #16mmfilms 2026-01-06T17:58:28.000Z yes A/V Geeks 16mm Films no 4321 https://avgeeks.videonest.co/videos/1503071/2001-a-space-odyssey-production-short-clip-ZnujiqZyNa https://img.videonest.org/gamma/1503071_thumbnail_resized_v2.webp https://gamma.videonest.org/1503071_video_v4.mp4 [2001: A Space Odyssey Production Short Clip?] Or maybe its an educational film about early man? Discusses the evolutionary development of humans, particularly focusing on the transition to upright walking, which began with Homo erectus approximately 750,000 years ago. Professor Tobias, an expert in prehistoric anatomy, explains the significance of uprightness in human evolution, highlighting its role in freeing the hands and facilitating brain enlargement. The video also touches on the sensory functions of nasal structures in early hominins. 2026-01-07T05:00:30.000Z yes A/V Geeks 16mm Films no 164 Homo erectusHuman evolutionPrehistoric manape-man suitsProfessor Tobiasupright walkinganatomy16mm filmA/V Geeks https://avgeeks.videonest.co/videos/1503354/a-v-geeks-16mm-lunch-1-7-2026-qU8CfVGSVk https://img.videonest.org/gamma/1503354_thumbnail_resized_v2.webp https://gamma.videonest.org/1503354_video_v5_360.mp4 A/V Geeks 16mm Lunch 1-7-2026 Why yes, we are still watching 16mm films during lunch. Thanks for asking! #avgeeks #16mmfilms Shaping Progress What Are Letters For? Initial Consonants Face of the Earth Dare To Care 2026-01-07T18:00:13.000Z yes A/V Geeks 16mm Films no 4042 https://avgeeks.videonest.co/videos/1503611/abcs-of-hand-tools-part-1-1945-Nmus_lFR8k https://img.videonest.org/gamma/1503611_thumbnail_resized_v2.webp https://gamma.videonest.org/1503611_video_v4.mp4 ABCs Of Hand Tools, Part 1 (1945) Animated by Disney for General Motors. Explores the historical significance and proper use of hand tools, tracing their evolution from primitive inventions to modern designs. It highlights the importance of using tools correctly to avoid damage and improve efficiency, emphasizing the various types of hammers, screwdrivers, pliers, and wrenches, along with tips for their effective use. 2026-01-08T05:00:35.000Z yes A/V Geeks 16mm Films no 1070 hand toolshammerscrewdriverplierswrenchtool usagetool carehome repairelectrical workGeneral Motorsopen-end wrenchadjustable wrenchbox wrenchratchet handleusing tools https://avgeeks.videonest.co/videos/1503857/av-geeks-16mm-lunch-1-8-2025-RfG2vFNY6- https://img.videonest.org/gamma/1503857_thumbnail_resized_v2.webp https://gamma.videonest.org/1503857_video_v4.mp4 AV Geeks 16mm Lunch 1-8-2025 Burying our heads into old 16mm films to keep sane! #avgeeks #16mmfilms 2026-01-08T17:51:07.000Z yes A/V Geeks 16mm Films no 3907 16mm filmfilm splicingfilm processingfilm projectoreducational filmIcelandIcelandic landscapesfamilyhome videosibling rivalryvowel soundsphonicsfilm scannerSkip Elsheimerstudent film https://avgeeks.videonest.co/videos/1503971/abcs-of-hand-tools-part-2-1945-oNFs5Ai8aS https://img.videonest.org/gamma/1503971_thumbnail_resized_v2.webp https://gamma.videonest.org/1503971_video_v4.mp4 ABCs Of Hand Tools, Part 2 (1945) The film "ABCs of Hand Tools Part 2" provides essential tips and techniques for using various hand tools effectively. It emphasizes the importance of proper tool usage, maintenance, and safety precautions, particularly when using chisels, planes, punches, files, and saws. The video also highlights the significance of keeping tools organized and in good condition to enhance productivity and ensure safety during work. 2026-01-09T05:00:03.000Z yes A/V Geeks 16mm Films no 894 hand toolstool tutorialwoodworking toolswood planehand planedrill bitwood filetool usewoodworkinghand sawrip sawcross-cut sawtool maintenancehacksawsawing https://avgeeks.videonest.co/videos/1504386/who-cares-1968--ufOpUmXQT https://img.videonest.org/gamma/1504386_thumbnail_resized_v2.webp https://gamma.videonest.org/1504386_video_v4.mp4 Who Cares? (1968) "Who Cares?" features a conversation between a mother and her son, Charles, as they navigate morning routines and school. Charles expresses indifference towards school and responsibilities, while his mother encourages him to take education seriously. The scene shifts to a classroom setting where students are preparing for band tryouts, 2026-01-09T21:14:58.000Z yes A/V Geeks 16mm Films no 637 School daysGoing to schoolMusical instrumentsCharles Simmonsband leader auditionelementary schoolmusic classchildren playingtrombone playerpeer pressurechildrenteachercaringUrban lifeCityscape https://avgeeks.videonest.co/videos/1504387/a-v-geeks-16mm-lunch-1-9-2026-44Kmlmxiqi https://img.videonest.org/gamma/1504387_thumbnail_resized_v2.webp https://gamma.videonest.org/1504387_video_v4.mp4 A/V Geeks 16mm Lunch 1-9-2026 Sometimes current headlines make it hard for us to show you old 16mm films but we will continue! #avgeeks #16mmfilms 2026-01-09T17:58:49.000Z yes A/V Geeks 16mm Films no 3669 16mm filmModern DanceSpace ExplorationArgentinaAstronomyVintage projectorDance TechniqueEstanciaPampasCattle farmingSpace ageNASAVintage fashionGauchoBeef https://avgeeks.videonest.co/videos/1504478/kyoto-story-1945-dIeG3A-Urs https://img.videonest.org/gamma/1504478_thumbnail_resized_v2.webp https://gamma.videonest.org/1504478_video_v4.mp4 Kyoto Story (1945) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Describes a missionary's experiences in Kyoto, Japan, highlighting the beauty of the city and the impact of missionary work on local communities. The narrator shares interactions with locals, particularly a man named Bill, and provides insights into the educational and humanitarian efforts of missionaries. They emphasize the importance of developing national leadership and supporting impoverished families, illustrating their work through stories of specific individuals like Maro and Yuki Chan. The narrative captures the essence of hope, compassion, and the transformative power of faith in challenging circumstances. 2026-01-10T05:00:10.000Z yes A/V Geeks 16mm Films no 1413 Kyoto StoryKyoto JapanMissionary WorkJapanMissionariesDoshisha SchoolPost-War JapanEducationMedical CareReligious MissionsChristianityAid WorkFarmingTemple RoofsTorii Arch https://avgeeks.videonest.co/videos/1504801/giant-mobile-nature-in-balance-1974-ZapW0WkrHs https://img.videonest.org/gamma/1504801_thumbnail_resized_v2.webp https://gamma.videonest.org/1504801_video_v4.mp4 Giant Mobile: Nature in Balance (1974 Brought to you by The Fertilizer Institute, this film discusses the essential practices farmers use to maintain soil health and balance in nature, which are crucial for food production. It highlights techniques such as contour farming, strip cropping, windbreaks, and crop rotation that help prevent soil erosion and promote sustainable agriculture. The farmer plays a vital role in ensuring food security by managing land effectively and conserving resources. 2026-01-11T05:00:10.000Z yes A/V Geeks 16mm Films no 777 farmingsoil healthland managementsoil erosionstrip croppingcontour farmingwindbreakscrop rotationsustainable agriculturefood productionfertilizersmodern farmingcrop yieldagriculturenature https://avgeeks.videonest.co/videos/1505098/teenage-crusade-trailer-1960s-x6CFbpBC4g https://img.videonest.org/gamma/1505098_thumbnail_resized_v2.webp https://gamma.videonest.org/1505098_video_v4.mp4 Teenage Crusade Trailer (1960s) Discusses a series of films produced by Family Films aimed at teenagers, focusing on Christian themes and issues relevant to youth. The films were developed with input from teenagers to address their challenges, such as relationships with parents, standing up for Christian values, and understanding one's calling in life. The series aims to provide churches with tools to engage young people and promote Christian decision-making. Additionally, the films feature dedicated Christian actors and emphasize the importance of evangelism and community outreach among youth. 2026-01-12T05:00:51.000Z yes A/V Geeks 16mm Films no 796 Family FilmsTeenage CrusadeChristian filmsreligious filmsfilm seriesChristianityfaithyouth ministryyouth evangelismChristian convictionsteenage problemsChristian ministryspiritual enrichmentministrychurch https://avgeeks.videonest.co/videos/1511326/av-geeks-16mm-lunch-1-11-2026-aSfcm7HEtT https://img.videonest.org/gamma/1511326_thumbnail_resized_v2.webp https://gamma.videonest.org/1511326_video_v4.mp4 AV Geeks 16mm Lunch 1-11-2026 It's a Monday where we watch old 16mm films together! Won't you join us?! #avgeeks #16mmfilms 2026-01-12T18:00:06.000Z yes A/V Geeks 16mm Films no 3423 A/V Geeks16mm filmsfilm archiveChevroletAdvertisementmarriage reasonsweddingdivorcefood consumptionKodak Instamaticadvertisinghome moviesKodakcommercialfamily https://avgeeks.videonest.co/videos/1511505/on-stage-1950-9JJhzdOhB8 https://img.videonest.org/gamma/1511505_thumbnail_resized_v2.webp https://gamma.videonest.org/1511505_video_v4.mp4 On Stage (1950) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The documentary highlights the enduring appeal of live theater in New York City, emphasizing the dreams and struggles of aspiring actors like Margaret Garland. It explores the challenges faced by performers and technicians in the industry, including a decline in the number of theaters and productions. The importance of Actors Equity Association in improving working conditions is noted, along with the role of various theatrical professionals in maintaining high standards. The narrative follows Margaret's journey from auditions to landing a small role in a significant play, culminating in the critical reception of the opening night, which can determine a show's success. 2026-01-13T05:01:02.000Z yes A/V Geeks 16mm Films no 1115 Stage ActingAmerican StageNew YorkNYCTheater CultureActorActressActors Equity Associationtheatrical productiontheater technicianMargaret Garlandstage playBroadwayPlay reviewcostume design https://avgeeks.videonest.co/videos/1513416/av-geeks-16mm-lunch-1-13-2026-WigtoBa0hg https://img.videonest.org/gamma/1513416_thumbnail_resized_v2.webp https://gamma.videonest.org/1513416_video_v4.mp4 AV Geeks 16mm Lunch 1-13-2026 It's a great Tuesday for watching 16mm films! #avgeeks #16mmfilms 2026-01-13T18:00:06.000Z yes A/V Geeks 16mm Films no 4037 https://avgeeks.videonest.co/videos/1513551/farmers-of-india-1949-985nE7Poog https://img.videonest.org/gamma/1513551_thumbnail_resized_v2.webp https://gamma.videonest.org/1513551_video_v4.mp4 Farmers Of India (1949) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film "Farmers of India" explores the life of farmers in the Indian Peninsula, highlighting the region's geography, climate, and agricultural practices. It depicts the struggles of families, particularly children like Shal, who balance school and work in the fields. The narrative emphasizes the importance of crops such as rice and sugarcane, the challenges of food scarcity, and the reliance on traditional farming methods. The film also touches on cultural practices, including Hindu rituals, the significance of the Ganges River, and the role of markets in rural life. Education is presented as a key factor in addressing food shortages and improving living conditions for future generations. 2026-01-14T05:00:38.000Z yes A/V Geeks 16mm Films no 1224 IndiaIndian FarmersFarmingRiceSugarcaneRural LifestyleIndian PeninsulaGanges RiverHinduismIndian CultureFamily MealsIrrigationCrop HarvestingGanges ValleyBenares https://avgeeks.videonest.co/videos/1513959/av-geeks-16mm-lunch-1-14-2026-Mo_z0wMjt_ https://img.videonest.org/gamma/1513959_thumbnail_resized_v2.webp https://gamma.videonest.org/1513959_video_v4.mp4 AV Geeks 16mm Lunch 1-14-2026 Even though we are on the road, we still want to show you some great 16mm films that we scanned in KY! #avgeeks #16mmfilms 2026-01-14T18:00:06.000Z yes A/V Geeks 16mm Films no 3444 AV Geeks16mm films16mm Luncharson investigationfirefightingUSDAfood marketstatistical datafirearsoninsurance fraudfire safetyarsonistA/V GeeksKentucky https://avgeeks.videonest.co/videos/1514091/bread-and-butterflies-me-myself-and-maybe-1974-Xk0qHfTtto https://img.videonest.org/gamma/1514091_thumbnail_resized_v2.webp https://gamma.videonest.org/1514091_video_v4.mp4 Bread And Butterflies: Me, Myself, And Maybe (1974) Characters discuss the importance of taking chances and overcoming fears, particularly in a classroom setting. One character, Kathy, encourages her friend Deianne to participate in role-playing activities despite her fears of making mistakes and being laughed at. The conversation highlights the value of self-acceptance, trying new things, and building confidence through experience. As they interact, they also touch on personal interests such as art and the significance of family support. The piece concludes with a positive note about embracing new opportunities and the joy of creativity. 2026-01-15T05:00:11.000Z yes A/V Geeks 16mm Films no 873 Bread and Butterfliesclassroom1970svintage educationlearning skillsteaching studentsclassroom activityfamily dinnerschoolparentingmotherdaughtercraftingsewingmacrame https://avgeeks.videonest.co/videos/1515314/a-v-geeks-16mm-lunch-1-15-2026-Kvv8LYql2Z https://img.videonest.org/gamma/1515314_thumbnail_resized_v2.webp https://gamma.videonest.org/1515314_video_v4_converted.mp4 A/V Geeks 16mm Lunch 1-15-2026 And we're back in the archive! #avgeeks #16mmfilms 2026-01-15T17:59:53.000Z yes A/V Geeks 16mm Films no 4032 AV Geeks16mm filmsewing machinemarching bandbehavior theoryanimal trainingvintage filmold filmfilm archiveUnforgiving Debtorreligious filmfootball gamepigeon trainingdog trainingCoca-Cola https://avgeeks.videonest.co/videos/1515398/traffic-court-1972-HA8LS77Ruh https://img.videonest.org/gamma/1515398_thumbnail_resized_v2.webp https://gamma.videonest.org/1515398_video_v4.mp4 Traffic Court (1972) The film "Traffic Court" illustrates the importance of traffic laws and the procedures followed in traffic court. It emphasizes that traffic rules are established for motorists' safety and outlines the consequences of violating these laws, including receiving citations and attending court. The court proceedings are depicted, showing how defendants can plead, the role of the judge, and the potential outcomes of cases. The film highlights the significance of responsible driving and the traffic court's role in promoting highway safety. 2026-01-16T05:00:08.000Z yes A/V Geeks 16mm Films no 829 Traffic CourtTraffic LawsTraffic citationcourtspeedingdrivingcourtroomjudgetraffic violationdriving safetytraffic courtdriving under influenceillegal turnspeeding violationdriving responsibility https://avgeeks.videonest.co/videos/1515464/jesus-teaches-forgiveness-1953-zmawvesO4N https://img.videonest.org/gamma/1515464_thumbnail_resized_v2.webp https://gamma.videonest.org/1515464_video_v4.mp4 Jesus Teaches Forgiveness (1953) A teaching of Jesus on forgiveness, emphasizing its importance through parables and interactions with his disciples and others. It highlights the contrast between the Pharisees' skepticism of Jesus and the compassion shown by a sinful woman who seeks his forgiveness. Jesus illustrates the concept of forgiveness through parables, stressing that those who have been forgiven much should also forgive others. The narrative concludes with a strong message about the necessity of forgiving from the heart. 2026-01-16T05:00:38.000Z yes A/V Geeks 16mm Films no 766 JesusforgivenessparableJesus ChristKingdom of HeavenUnmerciful ServantBiblical ParableDebt ForgivenessSinSimon the Phariseesermon on the mountprayerdebtsKingPrison https://avgeeks.videonest.co/videos/1526861/a-v-geeks-16mm-lunch-1-16-2026-47t-B3Qrwy https://img.videonest.org/gamma/1526861_thumbnail_resized_v2.webp https://gamma.videonest.org/1526861_video_v4_converted.mp4 A/V Geeks 16mm Lunch 1-16-2026 FRIIIIDDDDAAAAYYYYYY means 16mm films for you! 2026-01-16T17:59:44.000Z yes A/V Geeks 16mm Films no 4096 https://avgeeks.videonest.co/videos/1527335/jesus-at-nazareth-and-capernaum-1952-GRWdCJFQ32 https://img.videonest.org/gamma/1527335_thumbnail_resized_v2.webp https://gamma.videonest.org/1527335_video_v4.mp4 Jesus At Nazareth And Capernaum (1952) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses Jesus' ministry as he travels from Jerusalem to Galilee, highlighting his growing influence and the mixed reactions he receives. After driving merchants out of the temple, Jesus returns to Galilee, where he performs miracles, including healing a nobleman's son. Despite his popularity in Capernaum, he faces rejection in his hometown of Nazareth, where the people doubt his authority. The narrative emphasizes the fulfillment of prophecy and the challenges Jesus faces in gaining acceptance. 2026-01-18T05:00:10.000Z yes A/V Geeks 16mm Films no 654 JesusNazarethCapernaumGalileeHealingChristianityReligious LeadersPreachingSynagogueIsaiahProphecyReligious TextPassoverJerusalemSon of Joseph https://avgeeks.videonest.co/videos/1527336/playing-touch-football-1975-9dL8OUbWGy https://img.videonest.org/gamma/1527336_thumbnail_resized_v2.webp https://gamma.videonest.org/1527336_video_v4.mp4 Playing Touch Football (1975) The film discusses the fundamentals of playing touch football in a school setting, emphasizing skills such as passing, catching, running, and kicking. It explains the rules, including minimal body contact and the proper techniques for passing and receiving the ball. The importance of practice through drills and teamwork is highlighted, encouraging players to improve their skills while having fun. Key techniques include the grip for throwing, securing the ball while running, and executing punts and place kicks. 2026-01-17T23:00:56.000Z yes A/V Geeks 16mm Films no 730 touch footballfootball tutorialfootball skillsfootball drillsteamworkpassingreceivingrunningkicking skillsfootballyouth sportsfootball practiceamerican footballfootball basicsOxford Films https://avgeeks.videonest.co/videos/1527765/new-social-studies-grade-2-1960s-uFMtm0h3wq https://img.videonest.org/gamma/1527765_thumbnail_resized_v2.webp https://gamma.videonest.org/1527765_video_v4.mp4 New Social Studies Grade 2 (1960s) A kinescope that discusses a teaching demonstration on how to help second-grade students understand the concept of community and the impact of changes, such as a new highway, on their environment. It emphasizes the importance of using interactive methods like maps, field trips, and role-playing to engage students in learning about their community's structure, services, and the social, economic, and political implications of changes. The curriculum aims to foster a sense of responsibility and appreciation for their community among young learners. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-01-19T05:00:31.000Z yes A/V Geeks 16mm Films no 979 Marie SchillingNew Social Studiescommunity changegrade 2community developmentcommunity jobscommunity rulestown mapschool busesclassroom codeschool lessonclassroom teachingcommunity servicesAmerican heritageSocial Studies https://avgeeks.videonest.co/videos/1528845/a-v-geeks-16mm-lunch-1-19-2026-tnT2oTZudD https://img.videonest.org/gamma/1528845_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1528845/a-v-geeks-16mm-lunch-1-19-2026-tnT2oTZudD A/V Geeks 16mm Lunch 1-19-2026 Some of you have a day off today! We show films even on our day's off.. #16mmfilms #avgeeks 2026-01-19T17:59:43.000Z yes A/V Geeks 16mm Films no 4732 https://avgeeks.videonest.co/videos/1531202/use-of-service-hand-tools-wrenches-sockets-etc-194-oqVXkElMga https://img.videonest.org/gamma/1531202_thumbnail_resized_v2.webp https://gamma.videonest.org/1531202_video_v4.mp4 Use Of Service Hand Tools: Wrenches, Sockets, Etc (1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film discusses the various types of service hand tools, primarily focusing on wrenches and sockets. It categorizes wrenches into six groups, including open-end, adjustable, box, spanner, inverted socket (Allen), and socket wrenches. The video emphasizes the importance of using the correct tool for the job, proper technique, and maintenance to ensure safety and effectiveness. Misuse of tools can lead to damage and accidents, so it is crucial to handle them correctly and keep them organized. 2026-01-20T05:01:18.000Z yes A/V Geeks 16mm Films no 1193 wrenchsocket wrenchhand tooladjustable wrenchbox wrenchtoolstoolshop safetytighteningnutmechanicwrench maintenancePlomb Tool Companysocket attachmentspeeder handle https://avgeeks.videonest.co/videos/1531523/a-v-geeks-16mm-lunch-1-20-2026-Vp54ft_B7I https://img.videonest.org/gamma/1531523_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1531523/a-v-geeks-16mm-lunch-1-20-2026-Vp54ft_B7I A/V Geeks 16mm Lunch 1-20-2026 It's that time of day! Time to give yourself a break and watch vintage 16mm films! #avgeeks #16mmfilms Symbol of a Bell Pathe New Segments (Babe Ruth, Winter Sports) Theater In Shakespeare's Time The Toymaker The Home 2026-01-20T17:59:04.000Z yes A/V Geeks 16mm Films no 4214 https://avgeeks.videonest.co/videos/1531672/trade-offs-malcolm-decides-1978-zut00dxzvM https://img.videonest.org/gamma/1531672_thumbnail_resized_v2.webp https://gamma.videonest.org/1531672_video_v4.mp4 Trade-Offs: Malcolm Decides (1978) The film "Trade-Offs: Malcolm Decides" illustrates a decision-making process through the story of Malcolm, a paper carrier who receives a $15 gift certificate. The narrative follows Malcolm as he navigates various options for spending his certificate, emphasizing the importance of defining problems, listing alternatives, stating criteria, evaluating options, and making decisions. Ultimately, Malcolm learns to make thoughtful choices based on what is important to him. 2026-01-21T05:00:23.000Z yes A/V Geeks 16mm Films no 1168 Trade OffsDecision MakingMalcolmGift CertificateFinancial LiteracyProblem SolvingPaper CarrierToy StorePurchase DecisionHockey GameSoccer BallBike RepairSaving MoneyEconomic EducationBirthday Gifts https://avgeeks.videonest.co/videos/1531954/a-v-geeks-16mm-lunch-1-21-2026-Ww-9booAvM https://img.videonest.org/gamma/1531954_thumbnail_resized_v2.webp https://gamma.videonest.org/1531954_video_v4.mp4 A/V Geeks 16mm Lunch 1-21-2026 Is the hump in hump day caused by a lack of 16mm films? We can fix that! #avgeeks #16mmfilms 2026-01-21T18:00:38.000Z yes A/V Geeks 16mm Films no 4294 16mm filmspacemissilesvintage filmeducationalmodel rocketsrocket sciencespace explorationRobert Goddard https://avgeeks.videonest.co/videos/1532072/how-vast-is-space-1959-xFcGSywlT1 https://img.videonest.org/gamma/1532072_thumbnail_resized_v2.webp https://gamma.videonest.org/1532072_video_v4.mp4 How Vast Is Space (1959) The film "How Vast Is Space" explores the immense scale of the universe by comparing distances and sizes, from the human body to cosmic structures. It emphasizes the relativity of size and distance, illustrating how we can visualize the universe through a series of magnified and reduced scales. The journey takes viewers from the atomic level to the edge of the observable universe, highlighting the vastness of space and the smallness of human existence within it. This concept was later shown in the Eames' "Power of Ten" and National Film Board of Canada's "Cosmic Zoom" 2026-01-22T01:17:57.000Z yes A/V Geeks 16mm Films no 1086 vastness of spacedistances in spacescale comparisonastronomical distanceslight yearssolar systemgalaxyalpha centauriouter spacespace explorationastronomyatomsnucleus of the atomScienceearth https://avgeeks.videonest.co/videos/1532113/bread-and-butterflies-treasure-hunt-1974-qIKczQhqpA https://img.videonest.org/gamma/1532113_thumbnail_resized_v2.webp https://gamma.videonest.org/1532113_video_v4.mp4 Bread And Butterflies: Treasure Hunt (1974) In this film, a group of friends discusses their desire to go to a carnival but realizes they need to earn money first. They brainstorm various ways to make money, including washing dogs and selling art. Each character shares their experiences and challenges as they attempt to gather enough funds by Sunday. Ultimately, they all succeed in earning enough money to enjoy the carnival together. 2026-01-22T05:00:54.000Z yes A/V Geeks 16mm Films no 884 treasure huntcarnivalearn moneyselling artwashing dogschildhood friendsentrepreneurshipfair gamesearning moneyeducational televisionBread and Butterfilesopen marketselling cardsdog washingcarnival game https://avgeeks.videonest.co/videos/1532314/mining-community-kimberly-1984-nQhy-NO6Je https://img.videonest.org/gamma/1532314_thumbnail_resized_v2.webp https://gamma.videonest.org/1532314_video_v4.mp4 Mining Community - Kimberly (1984) A film featuring Jason, a young boy from Kimberly, Canada, who shares insights about his hometown, its mining heritage, and community life. He discusses his family's involvement in mining, the local hockey scene, and the importance of tourism as the town faces potential changes in its economic future due to the mining industry. 2026-01-22T17:00:00.000Z yes A/V Geeks 16mm Films no 822 KimberleyKimberley BCmining communitymining historymining townSullivan Minelead zinc minemininghockeywinter sportsRocky Mountainseco-tourismKootenaysskiingWinter Fest https://avgeeks.videonest.co/videos/1532554/a-v-geeks-16mm-lunch-1-22-2026-DyO9p5eeKh https://img.videonest.org/gamma/1532554_thumbnail_resized_v2.webp https://gamma.videonest.org/1532554_video_v4_360.mp4 A/V Geeks 16mm Lunch 1-22-2026 Take a moment from looking at weather forecasts and watch some ole 16mm films with us! #avgeeks #16mmfilms 2026-01-22T17:58:44.000Z yes A/V Geeks 16mm Films no 3800 16mm filmvintage filmchimpanzeechildsilent filmart lessonline drawingseducationKimberley BCmining communitywinter sportsmining1984animalliteracy https://avgeeks.videonest.co/videos/1532654/word-world-1978-zpf0EMX6ix https://img.videonest.org/gamma/1532654_thumbnail_resized_v2.webp https://gamma.videonest.org/1532654_video_v4.mp4 Word World (1978) Puppets discuss the fun of creating comic strips and learning about words, specifically distinguishing between nouns (name words) and verbs (action words). Characters engage in playful dialogue about the importance of both types of words in communication. They explore how combining nouns and verbs can create complete thoughts and ideas, emphasizing that both are necessary for effective expression. 2026-01-23T05:00:13.000Z yes A/V Geeks 16mm Films no 936 Word Worldnounsverbslanguageaction wordsname wordspuppetlearninggrammarBarr FilmsEducational GamesReadingPam and PatNouns and VerbsAdventures in Language Land https://avgeeks.videonest.co/videos/1532978/a-band-is-1973-9OiiAWgm2R https://img.videonest.org/gamma/1532978_thumbnail_resized_v2.webp https://gamma.videonest.org/1532978_video_v4.mp4 A Band Is.. (1973) Discusses the essence of being in a band, highlighting its various aspects such as teamwork, musical expression, and the joy of learning music together. It emphasizes that a band is not just about playing instruments but also about forming a community and having fun while practicing and performing. The transcript features interactions between band members and their teacher, showcasing the educational and social benefits of being part of a band. 2026-01-23T17:00:00.000Z yes A/V Geeks 16mm Films no 857 band classmarching bandbrass bandschool bandmusic lessonmusic learninguniversity bandfootball fieldmarching performanceschool spiritgame dayband practiceFlorida State UniversityTubaClarinet https://avgeeks.videonest.co/videos/1532979/behavior-theory-in-practice-part-4-1965-Vk5tav4LSF https://img.videonest.org/gamma/1532979_thumbnail_resized_v2.webp https://gamma.videonest.org/1532979_video_v4_360.mp4 Behavior Theory In Practice, Part 4 (1965) The film discusses the concept of operant conditioning, focusing on the establishment of behavior sequences or chains under multiple stimulus control. It differentiates between homogeneous chains, where responses have the same topography, and heterogeneous chains, which involve varied responses. The text illustrates these concepts through examples involving birds and dogs, detailing how successive responses are shaped and reinforced by discriminative stimuli (SDs). It emphasizes the importance of the order of responses and the role of conditioned reinforcers in maintaining behavior. The training of guide dogs is highlighted, showcasing the use of both reinforcement and punishment in teaching avoidance of obstacles. The overall message underscores the principles of behavior learned through operant conditioning, suggesting that it is more accurately described as trial and success learning. Keywords: operant conditioning, behavior sequences, homogeneous chains, heterogeneous chains, discriminative stimuli, reinforcement, conditioned reinforcers, training, guide dogs, avoidance behavior, trial and success learning. 2026-01-23T17:00:00.000Z yes A/V Geeks 16mm Films no 1183 operant conditioningbehavior theoryanimal trainingbehavior sequenceshomogeneous chainsheterogeneous chainsconditioned reinforcersstimulus controlanimal behaviordog trainingpigeonconditioningB. F. Skinnerseeing eye dogbehavior practice https://avgeeks.videonest.co/videos/1545222/av-geeks-16mm-lunch-1-23-2026-AuLjuEe1hL https://img.videonest.org/gamma/1545222_thumbnail_resized_v2.webp https://gamma.videonest.org/1545222_video_v4_360.mp4 AV Geeks 16mm Lunch 1-23-2026 Sweets! Literally! #avgeeks #16mmfilms 2026-01-23T17:59:11.000Z yes A/V Geeks 16mm Films no 3925 AV Geeks16mm filmdental healthtooth decaysugar canesugar beetRoses Incroseflower arrangementcommercial filmcartoonhealthy eatingOral Healthagriculturegardening https://avgeeks.videonest.co/videos/1545339/bread-and-butterflies-decisions-decisions-1974-W-bgYr6Xhq https://img.videonest.org/gamma/1545339_thumbnail_resized_v2.webp https://gamma.videonest.org/1545339_video_v4_360.mp4 Bread And Butterflies: Decisions Decisions (1974) Film revolves around a young boy named Tommy who faces a dilemma about whether to accompany his friend Joey to paint his grandma's chicken coop. While Tommy is eager to earn money for a horse, he grapples with peer pressure and the negative perception of Joey among his classmates. Ultimately, he learns the importance of making thoughtful decisions and being kind, regardless of what others think. 2026-01-24T05:00:10.000Z yes A/V Geeks 16mm Films no 865 Bread & ButterfliesVintageEducational filmMaking Decisionschildrenmaking friendsfriendshipsmiddle schoolpeer pressurefamily relationshipsdecision makingchildhoodfriendschicken coopTommy https://avgeeks.videonest.co/videos/1545471/face-value-1981-xUBoCh1Irg https://img.videonest.org/gamma/1545471_thumbnail_resized_v2.webp https://gamma.videonest.org/1545471_video_v4_360.mp4 Face Value (1981) This film explores themes of social anxiety, self-image, and the complexities of relationships, particularly in the context of parties. The speaker expresses feelings of confusion and frustration about social interactions, particularly regarding romantic interests and the pressure to impress others. The metaphor of "head games" suggests emotional manipulation and the challenges of genuine connection. The speaker also discusses wearing a mask as a way to cope with insecurities and the desire to be accepted. Keywords: Daylight, head games, social anxiety, self-image, relationships, parties, emotional manipulation, insecurities, acceptance, connection. 2026-01-24T17:00:00.000Z yes A/V Geeks 16mm Films no 594 Face Value1980ssocial anxietyrelationshipspartiesemotional manipulationself-imageacceptanceconnectionteen angstgroup of friendsmaskidentityhead gamesmarijuana use https://avgeeks.videonest.co/videos/1545472/thy-word-given-1950s-pqcT0DNkps https://img.videonest.org/gamma/1545472_thumbnail_resized_v2.webp https://gamma.videonest.org/1545472_video_v4.mp4 Thy Word Given (1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film tells the story of John Wilson, a young man who became permanently blind after serving in the war. Initially, John struggled with despair and bitterness over his blindness, feeling that his life was over. However, through the support of a chaplain and the discovery of the Bible in Braille, John found renewed hope and purpose. The story emphasizes the transformative power of faith and the importance of providing scriptures to the blind, highlighting the work of the American Bible Society in distributing Braille Bibles and other resources. Ultimately, John learns to live a fulfilling life despite his blindness, illustrating that spiritual light can penetrate physical darkness. Keywords: blindness, hope, faith, John Wilson, American Bible Society, Braille, transformation, despair, scriptures, support, renewal, purpose, spiritual light, physical handicap. 2026-01-24T17:00:00.000Z yes A/V Geeks 16mm Films no 1054 American Bible SocietyJohn Wilsonblindnessvisual impairmentfaithBraille BiblerehabilitationWorld War IIloss of sightadversitydisabilityBraillespiritual lightBible Societyreligious https://avgeeks.videonest.co/videos/1545699/vivre-en-france-french-1970s-FeBDkPuVmd https://img.videonest.org/gamma/1545699_thumbnail_resized_v2.webp https://gamma.videonest.org/1545699_video_v4.mp4 Vivre En France (French,1970s) The film discusses the influence of Jacques Tati, a renowned French comedian and filmmaker, on the artistic landscape of France. It highlights his unique comedic style, his experiences with friends, and his observations of everyday life, which he captured in his films. The narrative also touches on the significance of cultural institutions, such as the Pompidou Center, in promoting language learning and appreciation for different cultures. 2026-01-25T05:00:53.000Z yes A/V Geeks 16mm Films no 1048 Jacques TatiFrench filmfrench cinemaFrench languageLanguage LearningCentre PompidouGeorges PompidouHuloJour de FêteGeorges MoustakiEdith PiafAccordionPublic Library of Informationaudio documents1970s https://avgeeks.videonest.co/videos/1545795/rim-of-the-wheel-dn9AYMq_Gm https://img.videonest.org/gamma/1545795_thumbnail_resized_v2.webp https://gamma.videonest.org/1545795_video_v4.mp4 Rim Of The Wheel Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This religious film explores the hectic lives of modern individuals, particularly Virginia Sutton, who feels overwhelmed by her responsibilities and social obligations. A conversation with Mrs. Hammond and Dad Dickerson emphasizes the importance of prioritizing one's spiritual life and finding peace by staying close to God, rather than getting caught up in the chaos of daily activities. The narrative suggests that many people are "riding on the rim of the wheel," which symbolizes a life of stress and distraction, and advocates for a simpler, more centered approach to life. 2026-01-25T17:00:00.000Z yes A/V Geeks 16mm Films no 1344 Family FilmsVirginia Sutton1950sReligiondomestic lifefamilyvintage filmDad Dickersonhome lifeparentingboyschildrenWheel MetaphorHomemakinghousewife https://avgeeks.videonest.co/videos/1546064/family-encounter-1970-1j4bGNoKoW https://img.videonest.org/gamma/1546064_thumbnail_resized_v2.webp https://gamma.videonest.org/1546064_video_v4.mp4 Family Encounter (1970) Various scenarios featuring families, including a husband's hopeful work promotion, playful card games, discussions of past misunderstandings, and a young man's struggles with graduation credits. Tensions rise as he expresses a desire to drop out, prompting differing reactions from his family members. 2026-01-26T05:00:52.000Z yes A/V Geeks 16mm Films no 465 Family EncounterMovieRelationshipsMarriageFranciscan Communications CenterParentingAirport arrivalfamily dinnerdropping outspending time https://avgeeks.videonest.co/videos/1546525/a-v-geeks-16mm-lunch-1-26-2026-74iu68L2MO https://img.videonest.org/gamma/1546525_thumbnail_resized_v2.webp https://gamma.videonest.org/1546525_video_v4_360.mp4 A/V Geeks 16mm Lunch 1-26-2026 It's a snow (well actually, sleet) day at the archive. Here are some TV commercials to warm your heart! #avgeeks #16mmfilms 2026-01-26T17:07:27.000Z yes A/V Geeks 16mm Films no 10060 vintage commercialstv commercials16mm film1960s1970screst toothpastemaxwell house coffeepampers diaperstexacocharminhardeespost cerealgaines burgerssugar crisp cerealretro tv commercials https://avgeeks.videonest.co/videos/1546526/it-s-her-future-1978-zHmmzu20TZ https://img.videonest.org/gamma/1546526_thumbnail_resized_v2.webp https://gamma.videonest.org/1546526_video_v4.mp4 It's Her Future (1978) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film discusses the future prospects of young women, particularly in relation to their education and career choices. It highlights that most female students will likely be employed, balancing work with family life. Many are attending vocational technical schools, where they can choose from various trades, traditionally male-dominated, such as plumbing, welding, and electrical maintenance. The narrative includes personal experiences and concerns from students and their families about entering these fields, emphasizing the importance of determination and the changing perceptions of women in vocational roles. The text also notes the growing number of women in vocational education and the demand for female workers in non-traditional fields. Keywords: women, vocational education, career choices, employment, family, trades, determination, non-traditional roles, education, labor force, personal experiences, future prospects. 2026-01-26T17:00:00.000Z yes A/V Geeks 16mm Films no 1096 Vocational EducationFemale EmpowermentCareer optionsVocational schoolTechnical educationGender rolesFemale studentsConstruction TradeTechnical Schoolwoman workersmetal fabricationWoodworkingEngineering Careercareer placementwomen's rights https://avgeeks.videonest.co/videos/1546704/dancing-prophet-1971-kSpf05c_0g https://img.videonest.org/gamma/1546704_thumbnail_resized_v2.webp https://gamma.videonest.org/1546704_video_v4.mp4 Dancing Prophet (1971) The film revolves around Doug Crutchfield, an American dancer and teacher, who shares his journey from aspiring minister to a passionate advocate for dance. He emphasizes the importance of personal growth, believing in oneself, and helping others, especially those with disabilities, through the transformative power of dance. Doug’s philosophy centers on the idea that everyone has their own path and that true fulfillment comes from sharing experiences and supporting one another. 2026-01-27T05:00:29.000Z yes A/V Geeks 16mm Films no 919 Doug CrutchfieldDance performanceJazz balletDancing prophetDance instructorArtistic expressiondance therapydisabilityelderly carephysical fitnessdancedisabled childrenvintageTeleKETICSLos Angeles https://avgeeks.videonest.co/videos/1546999/argentina-horsemen-of-the-pampa-1948-Rs9QLcOvQO https://img.videonest.org/gamma/1546999_thumbnail_resized_v2.webp https://gamma.videonest.org/1546999_video_v4.mp4 Argentina: Horsemen Of The Pampa (1948) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Argentina, the second largest nation in South America, is rich in resources such as cattle, wheat, corn, and wool, primarily produced on the fertile plains known as the PMPA. The capital, Buenos Aires, is a bustling city with European-style architecture and a vibrant culture. The PMPA's black soil supports extensive agriculture and livestock farming, with large ranches called estancias managed by workers known as pesteros. Daily life includes traditional practices like drinking mate and riding horses. The country exports significant amounts of beef, wool, corn, and wheat, making it the wealthiest nation in South America. Keywords: Argentina, South America, Buenos Aires, PMPA, cattle, wheat, corn, wool, estancias, pesteros, agriculture, livestock, mate, exports, wealth. 2026-01-27T17:00:00.000Z yes A/V Geeks 16mm Films no 1285 ArgentinaPampaGauchosBuenos AiresSouth Americacattlehorsemencattle ranchingestanciawoolcornwheathorseback ridingcattle drivegaucho culture https://avgeeks.videonest.co/videos/1547146/a-v-geeks-16mm-lunch-1-27-2026-oKYCqFFWV4 https://img.videonest.org/gamma/1547146_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1547146/a-v-geeks-16mm-lunch-1-27-2026-oKYCqFFWV4 A/V Geeks 16mm Lunch 1-27-2026 thawing out? nah, it's still cold. Watch 16mm films with us instead of shovelling the sidewalk! #avgeeks #16mmfilms 2026-01-27T17:54:44.000Z yes A/V Geeks 16mm Films no 4091 https://avgeeks.videonest.co/videos/1547252/engineering-robots-intelligent-machines-serving-ma-Y_GFYP03pn https://img.videonest.org/gamma/1547252_thumbnail_resized_v2.webp https://gamma.videonest.org/1547252_video_v4.mp4 Engineering : Robots Intelligent Machines Serving Mankind (1981) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film discusses advancements in industrial robotics and their impact on manufacturing. It highlights the transition from manual to automated production, the development of computer-aided design systems, and the integration of sensory intelligence in robots for improved efficiency and adaptability. The report emphasizes the benefits of robotics in manufacturing, including safer work environments and enhanced product quality. 2026-01-28T05:01:03.000Z yes A/V Geeks 16mm Films no 846 industrial robotsmanufacturing robotsautomationmanufacturingroboticscomputer technologyassemblymachine visionrobot programmingautomatic assemblyrobotic inspectionrobot jointsbatch manufacturingmass productionblock stacking https://avgeeks.videonest.co/videos/1547253/home-the-1940s-i6lhu8uAE4 https://img.videonest.org/gamma/1547253_thumbnail_resized_v2.webp https://gamma.videonest.org/1547253_video_v4.mp4 Home, The (1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Palestine, a small country located east of the Mediterranean, has a rich historical significance, particularly during the Roman Empire. The region features important roads connecting various cities, and life in its villages has changed little over the centuries. Daily routines include waking up, preparing breakfast, and engaging in household chores. The text describes the life of a carpenter's family, detailing their morning activities, including fetching water, grinding grain, and baking bread. The women of the village often gather to socialize while working on needlework and embroidery. Keywords: Palestine, Mediterranean, history, Roman Empire, roads, villages, daily life, carpenter, household chores, breakfast, water fetching, grain grinding, bread baking, socializing, needlework, embroidery. 2026-01-28T05:00:00.000Z yes A/V Geeks 16mm Films no 977 Palestine historyvillage lifehouseworkchildbirthmotherhoodinfant carewater wellgrain preparationbread makingneedleworkembroideryvillage womensocial gatheringfriendshipThe Home https://avgeeks.videonest.co/videos/1547969/a-v-geeks-16mm-lunch-1-28-2026-2-n6ZNZBKb https://img.videonest.org/gamma/1547969_thumbnail_resized_v2.webp https://gamma.videonest.org/1547969_video_v4.mp4 A/V Geeks 16mm Lunch 1-28-2026 16mm films? Ever heard of them? Maybe we can help you understand.. 2026-01-28T17:57:03.000Z yes A/V Geeks 16mm Films no 3778 16mm FilmVintage FilmPolice TrainingPlanktonMarine BiologyYouth SportsPoliceLaw EnforcementBMXBicycle RacingInstructional FilmOceanRacingEducationalSports https://avgeeks.videonest.co/videos/1560412/dare-to-care-1970s-unbTXKybNh https://img.videonest.org/gamma/1560412_thumbnail_resized_v2.webp https://gamma.videonest.org/1560412_video_v4.mp4 Dare To Care (1970s) This kinescope illustrates the daily operations and interactions in a hospital setting. It emphasizes the importance of care, attention to detail, and communication among staff and patients. The narrative highlights various scenarios where small lapses can lead to bigger issues, underscoring that a little extra care can significantly impact patient experiences and outcomes. 2026-01-29T05:00:14.000Z yes A/V Geeks 16mm Films no 1105 hospital scenepatient caremedical safetymedical professionalhospital procedureshealthcarepatient transfermedical carehospital bedpatient medicationhealth riskpatient fallincident reportnurse assistancebed rails https://avgeeks.videonest.co/videos/1560578/david-livingstone-1950-jLoTzeCOjh https://img.videonest.org/gamma/1560578_thumbnail_resized_v2.webp https://gamma.videonest.org/1560578_video_v4_360.mp4 David Livingstone (1950) The film explores the life of David Livingstone, a dedicated doctor and missionary, embarked on remarkable explorations in Africa, confronting the slave trade and navigating uncharted territories. Despite facing hardships and declining health, he discovered significant landmarks and continued his mission until his death, ultimately being buried in Westminster Abbey. 2026-01-29T17:00:00.000Z yes A/V Geeks 16mm Films no 940 David LivingstoneAfrican explorationMissionary workSlave tradeVictoria FallsZambezi RiverAfrican tribesColonial AfricaHenry StanleyRiver NileLake TanganyikaLake NyasaMissionaryTravelerHistorical figure https://avgeeks.videonest.co/videos/1563471/a-v-geeks-16mm-lunch-1-29-2026-amsvSrMl6J https://img.videonest.org/gamma/1563471_thumbnail_resized_v2.webp https://gamma.videonest.org/1563471_video_v4_360.mp4 A/V Geeks 16mm Lunch 1-29-2026 It's a wonderful time to be watching classic 16mm films! Ask anybody.. #avgeeks #16mmfilms 2026-01-29T17:58:48.000Z yes A/V Geeks 16mm Films no 3820 16mm filmsmokeless tobaccohealth risksweight trainingphysical educationtobacco advertisingyouth addictionoral cancerfilm projectorAV Geekseducational filmpeer pressuresmokingadvertisinghealth warning https://avgeeks.videonest.co/videos/1572085/different-people-different-values-1977-bi3cGtu6DK https://img.videonest.org/gamma/1572085_thumbnail_resized_v2.webp https://gamma.videonest.org/1572085_video_v4_360.mp4 Different People, Different Values (1977) The film "Different People, Different Values" explores how individuals on Market Street utilize gasoline differently based on their personal circumstances, such as family size, wealth, and lifestyle. It highlights the concept of the price effect, where changes in gasoline prices influence consumer behavior and demand. As prices rise, people tend to use less gasoline and prioritize their needs, while lower prices encourage more usage. The video also discusses the consequences of price controls, leading to shortages and reduced service quality. 2026-01-30T05:00:16.000Z yes A/V Geeks 16mm Films no 1272 gasoline pricesprice effectcustomer demandgas pricesMarket Streetfuel costseconomic impactgasolineprice controlsSupply and Demandprice elasticityfuel efficiencyautomobileEconomicsDemand https://avgeeks.videonest.co/videos/1573760/av-geeks-16mm-lunch-1-30-2026-loLNjS5Tv6 https://img.videonest.org/gamma/1573760_thumbnail_resized_v2.webp https://gamma.videonest.org/1573760_video_v4_360.mp4 AV Geeks 16mm Lunch 1-30-2026 Farewell you cold cruel January! Looking forward to watching 16mm in February! #avgeeks #16mmfilms 2026-01-30T17:59:32.000Z yes A/V Geeks 16mm Films no 4170 AV Geeks16mm filmJapanese Folk TaleThe WavePersuasionPublic SpeakingJohn F KennedyWinston ChurchillWashington D.C.Alaskan WalrusesArcticwildlifemarine lifeconservationEskimo https://avgeeks.videonest.co/videos/1573879/cakes-basic-techniques-1981-SPcr4Ipdmz https://img.videonest.org/gamma/1573879_thumbnail_resized_v2.webp https://gamma.videonest.org/1573879_video_v4.mp4 Cakes: Basic Techniques (1981) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film outlines basic cake-making techniques, including historical context, ingredient ratios, mixing methods, and types of cakes. It details the processes for both shortened cakes (like chocolate layer cake) and fat-free cakes (like angel food cake), emphasizing the importance of ingredient temperature, mixing techniques, and baking times. Additionally, it covers frosting types and decorating tips, highlighting the significance of texture and flavor in cake quality. 2026-01-31T05:00:10.000Z yes A/V Geeks 16mm Films no 1111 cake recipesbaking techniquescake batterchocolate layer cakecooking cakecake mixturescake ingredientbaking tipspan sizeone bowl spice cakeangel food cakespray coatingswax papermeringue preparationdessert recipes https://avgeeks.videonest.co/videos/1574091/putting-scientific-information-to-work-1974-mY7x_CH3az https://img.videonest.org/gamma/1574091_thumbnail_resized_v2.webp https://gamma.videonest.org/1574091_video_v4.mp4 Putting Scientific Information To Work (1974) The film discusses the evolution of scientific information exchange is traced from face-to-face interactions to the rise of scientific journals. The Institute for Scientific Information enhances access to literature through innovative tools like the Science Citation Index and offers tailored services to meet diverse research needs, ensuring efficient information retrieval. 2026-01-31T17:00:00.000Z yes A/V Geeks 16mm Films no 1283 scientific journalscitation indexingscientific literatureISIinformation exchangeScience Citation IndexInstitute for Scientific Informationscientific informationinformation disseminationCurrent Contentsresearch publicationsISI servicesInformation RetrievalScientific Researchindexing techniques https://avgeeks.videonest.co/videos/1574295/incredible-iceland-1967-3AcBIIZ-JG https://img.videonest.org/gamma/1574295_thumbnail_resized_v2.webp https://gamma.videonest.org/1574295_video_v4.mp4 Incredible Iceland (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses Iceland's unique geography, history, and culture. Located just south of the Arctic Circle, Iceland experiences relatively mild winters due to warm Gulf Stream winds. The country has a rich history dating back to the 800s with Norse settlers, and it is known for its volcanic activity, geysers, and glaciers. Iceland's economy relies heavily on fishing, with a significant portion of exports coming from fish products. The population enjoys a high standard of living, with no unemployment or poverty, and values education and individual responsibility. Cultural activities and natural beauty are emphasized, making Iceland a desirable destination for visitors. Keywords: Iceland, geography, history, Norse settlers, volcanic activity, fishing, economy, education, culture, natural beauty, Arctic Circle, glaciers, geysers, exports, standard of living, tourism. 2026-02-01T05:00:00.000Z yes A/V Geeks 16mm Films no 1100 IcelandIceland historyIcelandic republicvolcanic eruptionsbasaltic formationsglaciersfishing industryIceland exportsgeothermal energyhot springscultural activitiesIcelandic languagethermal areasLake MývatnIcelandic Birds https://avgeeks.videonest.co/videos/1574321/orthographic-projection-1947-V7_v3MsUJo https://img.videonest.org/gamma/1574321_thumbnail_resized_v2.webp https://gamma.videonest.org/1574321_video_v4.mp4 Orthographic Projection (1947) The film explains orthographic projection, a method used in engineering drawing to represent three-dimensional objects through two-dimensional views. It describes how different perspectives (front, top, side) reveal various dimensions and features of an object, including hidden aspects represented by dotted lines. The importance of understanding the relationships between these views is emphasized, as well as the process of creating accurate drawings that can guide construction. 2026-02-01T05:01:01.000Z yes A/V Geeks 16mm Films no 1103 orthographic projectionengineering drawingtechnical drawingfront viewtop viewside viewdrawing diagramsvisualization techniquespicture planemanufacturing processorthographic viewhidden featuresblueprintconstructiondrawing process https://avgeeks.videonest.co/videos/1574879/breath-of-life-1964-F5bvbQz1AG https://img.videonest.org/gamma/1574879_thumbnail_resized_v2.webp https://gamma.videonest.org/1574879_video_v4.mp4 Breath Of Life (1964) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film discusses the importance of air as the "breath of life" and emphasizes the critical steps of mouth-to-mouth resuscitation in emergency situations. It details the techniques for opening air passages, performing artificial respiration, and the specific methods for both adults and infants. The urgency of acting quickly in life-threatening situations is highlighted, as well as the necessity of seeking medical help promptly. Narrated by Art Linklater. 2026-02-02T05:00:55.000Z yes A/V Geeks 16mm Films no 1001 https://avgeeks.videonest.co/videos/1575241/av-geeks-16mm-lunch-2-2-2026-XXgIEz7--W https://img.videonest.org/gamma/1575241_thumbnail_resized_v2.webp https://gamma.videonest.org/1575241_video_v4_converted.mp4 AV Geeks 16mm Lunch 2-2-2026 It snowed here. What about you? #avgeeks #16mmfilms 2026-02-02T17:56:01.000Z yes A/V Geeks 16mm Films no 4111 16mm filmvintage filmsnowwintersnow removalwinter drivingskiingchildren playingfarmsnow plowswinter activitiessafe drivingvintage footageroad maintenancepsychological https://avgeeks.videonest.co/videos/1576851/what-are-letters-for-initial-consonants-1973-g26hGhNfT_ https://img.videonest.org/gamma/1576851_thumbnail_resized_v2.webp https://gamma.videonest.org/1576851_video_v4.mp4 What Are Letters For Initial Consonants (1973) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film teaches children about the alphabet, specifically focusing on consonant sounds. It includes the ABC song and demonstrates how letters represent sounds in spoken language. The film highlights various consonant sounds by associating them with words and encourages children to listen and identify these sounds in different examples. 2026-02-03T05:00:57.000Z yes A/V Geeks 16mm Films no 712 https://avgeeks.videonest.co/videos/1577239/a-v-geeks-16mm-lunch-2-3-2026-nKajVrt21a https://img.videonest.org/gamma/1577239_thumbnail_resized_v2.webp https://gamma.videonest.org/1577239_video_v5_360.mp4 A/V Geeks 16mm Lunch 2-3-2026 Back at the archive, threading up 16mm films for your joy and horror! It's what we do! #avgeeks #16mmfilms Fabric Dying: An Art Adventure. Beyond Our Solar System The Hare and The Tortoise Chainsaw Safety 2026-02-03T17:52:33.000Z yes A/V Geeks 16mm Films no 4043 https://avgeeks.videonest.co/videos/1582606/draftsmen-of-dreams-1947-yWL9Fh_xy6 https://img.videonest.org/gamma/1582606_thumbnail_resized_v2.webp https://gamma.videonest.org/1582606_video_v4.mp4 Draftsmen Of Dreams (1947) The film discusses the significance of the United States Patent Office in Washington, D.C., as a repository of dreams and inventions since 1790. It highlights key inventors like Christopher Latham Scholes, who patented the typewriter, and George Eastman, who made photography accessible to the masses. The narrative emphasizes the evolution of inventions and their impact on daily life, showcasing various devices that have transformed industries and leisure activities. Ultimately, it celebrates the spirit of innovation and the ongoing contributions of inventors who continue to shape the modern world. 2026-02-04T05:00:02.000Z yes A/V Geeks 16mm Films no 944 https://avgeeks.videonest.co/videos/1583050/a-v-geeks-16mm-lunch-2-4-2026-6dEXr0EAmU https://i.ytimg.com/vi/d2R6eP23jrA/maxresdefault_live.jpg https://gamma.videonest.org/1583050_video_v4.mp4 A/V Geeks 16mm Lunch 2-4-2026 Time to put on your thinking caps and watch some thought-provoking films! #16mmfilms #avgeeks 2026-02-04T17:56:25.000Z yes A/V Geeks 16mm Films no 4585 https://avgeeks.videonest.co/videos/1583184/on-the-level-daddy-s-girl-1980-edsuEpZZt2 https://img.videonest.org/gamma/1583184_thumbnail_resized_v2.webp https://gamma.videonest.org/1583184_video_v4.mp4 On The Level: Daddy's Girl (1980) The film discusses themes of trust, responsibility, and family dynamics. The father expresses concern over his daughter's behavior, including disobedience and drinking, leading to a confrontation about trust and consequences. The dialogue showcases typical familial tensions and the struggles of growing up. 2026-02-05T05:00:27.000Z yes A/V Geeks 16mm Films no 892 https://avgeeks.videonest.co/videos/1584874/a-v-geeks-16mm-lunch-2-5-2026-fUTlCwkBDw https://img.videonest.org/gamma/1584874_thumbnail_resized_v2.webp https://gamma.videonest.org/1584874_video_v4.mp4 A/V Geeks 16mm Lunch 2-5-2026 It's a wonderful day to think about all the 16mm films you haven't seen yet. Watch today and you can take a couple off your list.. 2026-02-05T18:00:16.000Z yes A/V Geeks 16mm Films no 3654 16mm filmhome moviesvintageairportart adventureauto maintenancecar safetyChristmasbakingDIY craftsLaGuardia Airportcake recipeautomotive careflat tirevegetables https://avgeeks.videonest.co/videos/1587370/lascaux-cradle-of-man-s-art-1952-X-sXY-PdsE https://img.videonest.org/gamma/1587370_thumbnail_resized_v2.webp https://gamma.videonest.org/1587370_video_v4.mp4 Lascaux : Cradle of Man's Art (1952) The film discusses the significance of the Viza River valley in France, where evidence of prehistoric human life has been found, including the famous Lascaux cave paintings. Discovered in 1940 by two boys, these paintings depict various animals and symbols, showcasing early human artistic expression and possibly their beliefs about hunting and fertility. The artwork dates back 12,000 to 30,000 years, marking a crucial moment in understanding the origins of human art, religion, and communication. 2026-02-06T05:00:45.000Z yes A/V Geeks 16mm Films no 1019 https://avgeeks.videonest.co/videos/1588170/av-geeks-16mm-lunch-2-6-2026-VSwaBtYovD https://img.videonest.org/gamma/1588170_thumbnail_resized_v2.webp https://gamma.videonest.org/1588170_video_v5.mp4 AV Geeks 16mm Lunch 2-6-2026 It's film watching time! Yes it is! #avgeeks #16mmfilms 2026-02-06T17:57:46.000Z yes A/V Geeks 16mm Films no 4182 https://avgeeks.videonest.co/videos/1593708/trucks-in-our-neighborhood-1967-8rAjExB5J1 https://img.videonest.org/gamma/1593708_thumbnail_resized_v2.webp https://gamma.videonest.org/1593708_video_v4.mp4 Trucks In Our Neighborhood (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Pictures the various trucks that might come to the neighborhood. Shows the trucks and the workers who drive them as they provide services, make deliveries and repairs and do the general work needed to keep a neighborhood running smoothly. 2026-02-07T05:00:00.000Z yes A/V Geeks 16mm Films no 672 https://avgeeks.videonest.co/videos/1594245/music-of-roses-1970-pXHU6KfAmc https://img.videonest.org/gamma/1594245_thumbnail_resized_v2.webp https://gamma.videonest.org/1594245_video_v4.mp4 Music Of Roses (1970) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film explores the deep emotional and symbolic connections people have with roses, associating them with significant life events such as weddings, anniversaries, and celebrations. It highlights how roses serve as witnesses to human experiences and emotions, embodying love and beauty. The narrative includes a description of a wedding ceremony under a historic oak tree in Texas, emphasizing the tradition and community surrounding such events. Additionally, it touches on the care and arrangement of roses, illustrating their importance in various settings, from homes to hospitals, and their ability to enhance the atmosphere with their presence. Overall, roses are portrayed as a powerful symbol of life's precious moments and human connection. 2026-02-08T05:00:00.000Z yes A/V Geeks 16mm Films no 1184 https://avgeeks.videonest.co/videos/1595928/tornadoes-1968-zy66IwpLKn https://img.videonest.org/gamma/1595928_thumbnail_resized_v2.webp https://gamma.videonest.org/1595928_video_v4.mp4 Tornadoes (1968?) Discusses the challenges and strategies involved in tornado prediction and warning systems, emphasizing the increasing risk of tornadoes in urban areas due to population density. It highlights the role of the National Severe Storms Forecast Center in Kansas City, which monitors weather conditions to forecast severe thunderstorms and potential tornadoes. The process includes gathering data on temperature, pressure, and humidity, and issuing tornado watches and warnings to alert communities. The importance of public awareness and preparedness is underscored, as timely warnings can significantly reduce injuries and fatalities during tornado events. The narrative concludes with a reminder of the critical role of meteorologists in providing advance notice to help protect lives and property. 2026-02-09T05:00:00.000Z yes A/V Geeks 16mm Films no 845 https://avgeeks.videonest.co/videos/1596635/a-v-geeks-16mm-lunch-2-9-2026-Hvy8pybeUP https://img.videonest.org/gamma/1596635_thumbnail_resized_v2.webp https://gamma.videonest.org/1596635_video_v4_converted.mp4 A/V Geeks 16mm Lunch 2-9-2026 Mondayyyyyyy! Time to watch some old 16mm films! #avgeeks #16mmfilms 2026-02-09T18:00:31.000Z yes A/V Geeks 16mm Films no 4136 https://avgeeks.videonest.co/videos/1596813/chainsaw-safety-1982-Papj3Anq9u https://img.videonest.org/gamma/1596813_thumbnail_resized_v2.webp https://gamma.videonest.org/1596813_video_v4.mp4 Chainsaw Safety (1982) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Film shows chainsaws are powerful tools that require careful handling and safety awareness to prevent accidents, particularly kickback, which can occur when the tip of the chain contacts an object. Key safety features to consider when purchasing a chainsaw include chain brakes, handguards, and proper weight for ease of use. Operators should wear protective gear, including hard hats, goggles, gloves, and non-slip shoes, and should always read the owner's manual for operational guidance. When felling trees, it is crucial to assess the environment for hazards, choose a safe cutting path, and maintain a safe distance from others. Proper techniques for cutting, trimming, and bucking are essential, as is the importance of keeping the chainsaw well-maintained. Operators should also be aware of fire safety when handling fuel and ensure that first aid supplies are on hand, although the goal is to avoid injuries through adherence to safety protocols. 2026-02-10T05:00:00.000Z yes A/V Geeks 16mm Films no 1110 https://avgeeks.videonest.co/videos/1597255/a-v-geeks-16mm-lunch-2-10-2026-3pEK1GtFTV https://img.videonest.org/gamma/1597255_thumbnail_resized_v2.webp https://gamma.videonest.org/1597255_video_v4.mp4 A/V Geeks 16mm Lunch 2-10-2026 We are not alone! We have a guest at the archive who'll be watching and picking films for us to watch! #avgeeks #16mmfilms 2026-02-10T17:59:14.000Z yes A/V Geeks 16mm Films no 3783 16mm filmeducational filmstreet safetypedestrian safetytraffic safetybusiness trainingemployee trainingmanagement trainingAnti-Smoking Campaignsmokinghealthbicycle safetyreading skillswriting skillscommunication https://avgeeks.videonest.co/videos/1597427/magic-weapons-for-healthy-teeth-1978-0UclYrrb20 https://img.videonest.org/gamma/1597427_thumbnail_resized_v2.webp https://gamma.videonest.org/1597427_video_v4.mp4 Magic Weapons For Healthy Teeth (1978) Dr. Dawn explains the importance of dental hygiene, emphasizing the presence of bacteria, or "bugs," in the mouth that form plaque and can lead to tooth decay if not properly managed. He demonstrates the proper techniques for brushing and flossing, highlighting the significance of fluoride in toothpaste and the need to avoid sugary foods that feed the plaque. The discussion also touches on the importance of regular dental check-ups and protective measures during sports. Overall, the interaction aims to educate Louis on maintaining healthy teeth and gums through good dental practices. 2026-02-11T05:00:00.000Z yes A/V Geeks 16mm Films no 904 https://avgeeks.videonest.co/videos/1598026/av-geeks-16mm-lunch-2-11-2026-klWXiuu9lY https://img.videonest.org/gamma/1598026_thumbnail_resized_v2.webp https://gamma.videonest.org/1598026_video_v4.mp4 AV Geeks 16mm Lunch 2-11-2026 What? Another guest? AND 16mm films? #avgeeks #16mmfilms 2026-02-11T18:00:24.000Z yes A/V Geeks 16mm Films no 3589 AV Geeks16mm FilmheatwaveAustriaorgan musicreversed visionexperimental psychologyPSAKufsteinhigh temperatureVisual PerceptionAustrian filmsEdgar Rubinfilm collection1970s https://avgeeks.videonest.co/videos/1598222/putting-the-rules-together-1972-NnwhPeTI4M https://img.videonest.org/gamma/1598222_thumbnail_resized_v2.webp https://gamma.videonest.org/1598222_video_v4.mp4 Putting the Rules Together (1972) The film discusses the pronunciation of vowel sounds in English, focusing on the distinction between long and short vowel sounds based on the consonants that follow them. It explains that a single vowel typically has a long sound when it precedes a simple consonant or a vowel, while it has a short sound when followed by complex consonant spellings, such as consonant clusters or twin consonants. The film also highlights the importance of vowel stress in longer words, noting that unstressed vowels often take on a reduced sound. It encourages readers to apply these rules when encountering new words to improve their pronunciation skills. 2026-02-12T05:00:00.000Z yes A/V Geeks 16mm Films no 846 https://avgeeks.videonest.co/videos/1598728/a-v-geeks-16mm-lunch-2-12-2026-NGlNVIb-yz https://img.videonest.org/gamma/1598728_thumbnail_resized_v2.webp https://gamma.videonest.org/1598728_video_v4.mp4 A/V Geeks 16mm Lunch 2-12-2026 So many films to move, so many films to watch! When can we find the time to do both? #avgeeks #16mmfilms 2026-02-12T17:57:28.000Z yes A/V Geeks 16mm Films no 3695 AV Geeks16mm FilmEducationSafety rulesBus safetyPolitical candidateSkip ElsheimerPrefixesCommunication skillsListening skillsFilm archiveStorage unitMoving filmsWord WiseSchool bus https://avgeeks.videonest.co/videos/1598865/the-mark-of-quality-1967-6MbuzvS9ln https://img.videonest.org/gamma/1598865_thumbnail_resized_v2.webp https://gamma.videonest.org/1598865_video_v4_360.mp4 The Mark Of Quality (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film discusses the importance of meat grading, which is regulated by the United States Department of Agriculture (USDA). It explains how grading symbols indicate the quality of meat, including factors like flavor, juiciness, and tenderness, serving as a guide for both consumers and producers. The narrative follows a shopper, Mrs. Scott, as she learns about the differences between meat grades, such as USDA choice and USDA good, and how these grades affect pricing and quality. The grading process involves trained USDA inspectors who evaluate carcasses based on specific criteria, ensuring a standardized language for the meat industry. Ultimately, the film emphasizes that understanding meat grades helps consumers make informed purchasing decisions, impacting the broader market and production practices. 2026-02-13T05:00:00.000Z yes A/V Geeks 16mm Films no 831 https://avgeeks.videonest.co/videos/1599366/a-v-geeks-16mm-lunch-2-13-2026-UcwVY0YOJO https://img.videonest.org/gamma/1599366_thumbnail_resized_v2.webp https://gamma.videonest.org/1599366_video_v4_360.mp4 A/V Geeks 16mm Lunch 2-13-2026 oops.. Watch this stream please! #avgeeks #16mmfilms 2026-02-13T18:00:24.000Z yes A/V Geeks 16mm Films no 3924 AV Geeks16mm filmvintage commercialsCrest toothpasteTexacoMaxwell HouseCharminPampers diapersHardee's hamburgerFlorida Orangesdog foodHoneycomb cerealIvory SnowadvertisingPost https://avgeeks.videonest.co/videos/1599496/take-a-look-at-yourself-1970-eagkZNO7i6 https://img.videonest.org/gamma/1599496_thumbnail_resized_v2.webp https://gamma.videonest.org/1599496_video_v4_360.mp4 Take A Look At Yourself (1970) The film revolves around a young boy named Bill, who struggles with feelings of rejection and resentment towards authority figures, particularly police. His interactions with a coach, Mr. Johnson, highlight Bill's defiance and his belief that he doesn't need protection or help from anyone. After an incident where Bill's bike is stolen, Mr. Johnson steps in to assist him, emphasizing the importance of community and respect for others. The conversation reveals Bill's internal conflict regarding trust and authority, ultimately suggesting that understanding and cooperation could lead to a better environment where police might not be necessary. The narrative underscores themes of personal growth, the impact of parental absence, and the need for empathy in relationships. 2026-02-14T05:00:00.000Z yes A/V Geeks 16mm Films no 876 https://avgeeks.videonest.co/videos/1599497/self-incorporated-trying-times-1975-G4X09exvhs https://img.videonest.org/gamma/1599497_thumbnail_resized_v2.webp https://gamma.videonest.org/1599497_video_v4_360.mp4 Self Incorporated: Trying Times (1975) Meg reunites with her family in the city while navigating peer pressure around smoking and drinking. As friends influence each other, Frank tries smoking for the first time, and Julie faces pressure to drink alcohol. The group's secretive outings highlight the challenges of adolescence and the impact of social dynamics 2026-02-14T05:00:00.000Z yes A/V Geeks 16mm Films no 885 https://avgeeks.videonest.co/videos/1603819/the-job-interview-pro-bowl-1979-uRmLcJczPH https://img.videonest.org/gamma/1603819_thumbnail_resized_v2.webp https://gamma.videonest.org/1603819_video_v4.mp4 The Job Interview Pro Bowl (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film depicts a job interview framed as a competitive sporting event, the "Job Interview Pro Bowl." It follows the preparation and execution of an interview between a rookie applicant, Elellanena Gimble, and an interviewer, George Miller. The narrative emphasizes the skills and strategies both parties employ, with the interviewer assessing the applicant on various criteria like communication, enthusiasm, and preparation, while the applicant aims to impress and gather information. The segment highlights the importance of thorough preparation, honesty, and self-presentation in securing employment. 2026-02-15T05:00:00.000Z yes A/V Geeks 16mm Films no 1221 job interviewinterview skillstraining filmcareer adviceretro16mm filma/v geeks1979 https://avgeeks.videonest.co/videos/1604166/weight-training-for-every-body-1974-ALKZKG2Rpc https://img.videonest.org/gamma/1604166_thumbnail_resized_v2.webp https://gamma.videonest.org/1604166_video_v4.mp4 Weight Training For Every Body (1974) This film highlights the importance and benefits of weight training for overall physical fitness and health, suitable for all ages and genders. It demonstrates various exercises targeting different muscle groups, emphasizing proper form, warm-up routines, and gradual progression. The narrative also touches upon injury prevention, improved posture, and the positive impact on self-esteem and confidence. 2026-02-16T05:00:00.000Z yes A/V Geeks 16mm Films no 1032 weight trainingphysical fitnessexercisebodybuildingstrength training1970svintage fitness https://avgeeks.videonest.co/videos/1604587/a-v-geeks-16mm-lunch-2-16-2026-zr47qeLfeb https://img.videonest.org/gamma/1604587_thumbnail_resized_v2.webp https://gamma.videonest.org/1604587_video_v4.mp4 A/V Geeks 16mm Lunch 2-16-2026 A start of the work week should start with a lunchtime of 16mm films! 2026-02-16T18:00:15.000Z yes A/V Geeks 16mm Films no 3804 16mm FilmEducational FilmStudy SkillsConsumer CreditWord WiseCompound WordsOrganizationFinanceCredit CardsAnimationDebtEconomicsConsumerismRaftingNature https://avgeeks.videonest.co/videos/1605561/why-people-have-laws-shiver-gobble-snore-1970-f1L_-VgfVL https://img.videonest.org/gamma/1605561_thumbnail_resized_v2.webp https://gamma.videonest.org/1605561_video_v4.mp4 Why People Have Laws - Shiver, Gobble & Snore (1970) Three friends, tired of a king's excessive rules, flee to a land without any regulations, seeking freedom. However, their unchecked actions quickly lead to conflict and unhappiness. They discover that a complete absence of rules is also problematic and decide to create a few sensible laws for themselves, realizing that some rules are necessary for peaceful coexistence. Keywords: rules, freedom, conflict, laws, coexistence, king, friends, land without rules 2026-02-17T05:00:00.000Z yes A/V Geeks 16mm Films no 394 ruleslawsfreedomanimation1970schildreneducationsocial skillsconflictcoexistence https://avgeeks.videonest.co/videos/1605924/a-v-geeks-16mm-lunch-2-17-2026-v9k7X5Jzb8 https://img.videonest.org/gamma/1605924_thumbnail_resized_v2.webp https://gamma.videonest.org/1605924_video_v4.mp4 A/V Geeks 16mm Lunch 2-17-2026 It's not just every Tuesday that we watch 16mm films during our lunch.. uh, wait. IT IS every Tuesday that we watch 16mm films! #avgeeks #16mmfilms 2026-02-17T17:54:30.000Z yes A/V Geeks 16mm Films no 3939 16mm filmEducational Filmconsumer economicsWhy People Have Lawsdog adoptionfamily filmpuppyJesse Jacksonanimal carefilm projectoreconomic principlesMary Joblack historyself improvementrules https://avgeeks.videonest.co/videos/1606084/decision-for-mike-1974-gBj9aRW8rw https://img.videonest.org/gamma/1606084_thumbnail_resized_v2.webp https://gamma.videonest.org/1606084_video_v4.mp4 Decision For Mike (1974) This film is a cautionary tale about the dangers of smoking, presented through a series of vignettes and a narrative following a young boy named Mike. It explores the social pressures and perceived glamour associated with smoking, contrasting it with the stark health consequences, such as increased risk of lung cancer, emphysema, and heart disease. The film highlights how smoking can impact personal choices, relationships, and even physical development, ultimately urging viewers to avoid starting or to quit while they still can. Keywords: Smoking, health risks, lung cancer, emphysema, heart disease, social pressure, addiction, choice, consequences, prevention. 2026-02-18T05:00:00.000Z yes A/V Geeks 16mm Films no 848 smokinghealth risksteenagerspeer pressurelung canceraddiction1974vintage16mm film https://avgeeks.videonest.co/videos/1606892/a-v-geeks-16mm-lunch-2-18-2026-gyHDIROtXP https://img.videonest.org/gamma/1606892_thumbnail_resized_v2.webp https://gamma.videonest.org/1606892_video_v5.mp4 A/V Geeks 16mm Lunch 2-18-2026 What? another lunch show!? #avgeeks #16mmfilms 2026-02-18T18:00:04.000Z yes A/V Geeks 16mm Films no 4069 https://avgeeks.videonest.co/videos/1606893/a-v-geeks-bonus-early-lunch-streaming-show-2-18-20-EoesH_FFiu https://img.videonest.org/gamma/1606893_thumbnail_resized_v2.webp https://gamma.videonest.org/1606893_video_v4_converted.mp4 A/V Geeks Bonus Early Lunch Streaming Show 2-18-2026 We are doing a bonus show on this day to talk about the stock footage we have available from Bridgeman Images. 2026-02-10T17:44:03.000Z yes A/V Geeks 16mm Films no 7232 16mm filmeducational filmschool lunchmannersBridgeman ImagesCentron Filmsstock footagearchival footageschool cafeterialunchroom manners https://avgeeks.videonest.co/videos/1650605/consumer-power-credit-1973-pohTIxRnBt https://img.videonest.org/gamma/1650605_thumbnail_resized_v2.webp https://gamma.videonest.org/1650605_video_v4.mp4 Consumer Power: Credit (1973) Consumer advocate Ralph Nadar, psychoanalyst Dr. Isadore Ziferstein, and bank executive J. Hynes present three differing points of view about Americans' use of credit. Defines the benefits and dangers of credit buying in interviews with these authorities, and in interviews with consumers. Keywords: consumer credit, credit cards, debt, instant gratification, overspending, financial bondage, addiction, exploitation, economy, psychological impact 2026-02-19T05:00:00.000Z yes A/V Geeks 16mm Films no 1229 consumer creditcredit cardsdebtinstant gratificationoverspendingfinancial bondageralph nader https://avgeeks.videonest.co/videos/1651110/a-v-geeks-16mm-lunch-2-19-2026-mFBHLrrr-Y https://img.videonest.org/gamma/1651110_thumbnail_resized_v2.webp https://gamma.videonest.org/1651110_video_v4.mp4 A/V Geeks 16mm Lunch 2-19-2026 16mm films? What is that? Why should I care? Tune in and find out! #avgeeks #16mmfilms 2026-02-19T17:58:25.000Z yes A/V Geeks 16mm Films no 3459 16mm filmnounscredit cardsconsumer economicseducational film https://avgeeks.videonest.co/videos/1651465/buddhism-in-japan-part-2-shin-and-zen-1968-6_KVmDv_Dh https://img.videonest.org/gamma/1651465_thumbnail_resized_v2.webp https://gamma.videonest.org/1651465_video_v4.mp4 Buddhism In Japan, Part 2, Shin and Zen (1968) This film explores the adaptation of Buddhism as it spread from tropical India to colder climates like Japan, highlighting how it evolved from a metaphysical doctrine into a more accessible religion for the common person. It details the emphasis on faith, particularly in Amida Buddha and figures like Kannon, the concept of bodhisattvas, and practices such as prayer, meditation, and rituals. The film also touches upon fundamental Buddhist beliefs like tolerance, non-creation of the universe by God, reincarnation, and the ultimate goal of Nirvana, while contrasting the practices of different sects like Shin and Zen, and their influence on Japanese culture, art, and the spirit of its people. Keywords: Buddhism, Japan, Amida Buddha, Kannon, Bodhisattvas, Nirvana, Reincarnation, Zen, Shin sect, Meditation, Faith, Tolerance, Rituals, Saints, Cultural influence 2026-02-20T05:00:00.000Z yes A/V Geeks 16mm Films no 870 buddhismjapanshin sectzenamida buddhakannonreincarnationnirvanareligious ritualscultural influence https://avgeeks.videonest.co/videos/1651884/a-v-geeks-16mm-lunch-2-20-2026-SGLXlE-fHI https://img.videonest.org/gamma/1651884_thumbnail_resized_v2.webp https://gamma.videonest.org/1651884_video_v4_360.mp4 A/V Geeks 16mm Lunch 2-20-2026 Another day of moving heavy 16mm films which means another round of TV commerical roulette. #avgeeks #16mmfilms 2026-02-20T17:00:01.000Z yes A/V Geeks 16mm Films no 10341 vintage commercials1960s commercials1970s commercialsCrest toothpastePampers diapersMaxwell House coffeeScope mouthwashHardee'sPost cerealGillette razorAmerican MotorsVicks VapoRubTexacoCharmin toilet paperNyQuil https://avgeeks.videonest.co/videos/1652034/punctuation-mischievous-marks-s-1977-7TYEkfWT16 https://img.videonest.org/gamma/1652034_thumbnail_resized_v2.webp https://gamma.videonest.org/1652034_video_v4.mp4 Punctuation: Mischievous Marks -- ( )'S (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film shows an educational game show segment that teaches viewers about punctuation. It starts with a contestant failing to answer questions about punctuation marks, leading to an explanation of dashes and parentheses for insertions and asides within sentences. The show then delves into the uses of apostrophes, explaining their function in contractions (indicating missing letters) and in forming possessives for both singular and plural nouns, with special attention given to nouns ending in "s" sounds. The segment concludes with a contestant correctly identifying how to form possessives. Keywords: punctuation, dashes, parentheses, apostrophe, contractions, possessive, singular, plural, game show, education 2026-02-21T05:00:00.000Z yes A/V Geeks 16mm Films no 924 punctuationapostrophecontractionspossessivegrammareducation https://avgeeks.videonest.co/videos/1652618/etiquette-1988-XIMR5WBZCU https://img.videonest.org/gamma/1652618_thumbnail_resized_v2.webp https://gamma.videonest.org/1652618_video_v4.mp4 Etiquette (1988) This film features Cuba Gooding Jr in a fake game show hosted by Roger Murray and a panel of three students: Priscilla, Walden, and Nick. The show explores the concept of etiquette, starting with Nick's humorous misunderstanding of the term. Through examples like dining customs, telephone calls, and introductions, the program aims to teach the panel and the audience that etiquette is about proper manners, consideration for others, and making social interactions more pleasant, emphasizing that these principles apply to everyone regardless of age or gender. Keywords: etiquette, manners, politeness, consideration, social graces, dining, utensils, table setting, telephone etiquette, introductions, handshaking, kindness, respect. 2026-02-22T05:00:00.000Z yes A/V Geeks 16mm Films no 924 etiquettemannerssocial gracescuba gooding jr1980sgameshow https://avgeeks.videonest.co/videos/1653038/word-wise-compound-words-IPfaCdrAQ6 https://img.videonest.org/gamma/1653038_thumbnail_resized_v2.webp https://gamma.videonest.org/1653038_video_v4.mp4 Word Wise: Compound Words Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film follows Captain Wordwise and his National Word Watchers Expedition down the "river of compound words." To survive treacherous rapids and escape the giant "Big Word," the team must identify and collect as many compound words as possible. They learn that compound words are formed by joining two or more shorter words, each with its own meaning, to create a new word with a distinct meaning. Throughout their journey, the expedition members successfully spot numerous compound words related to their surroundings, supplies, and activities, which ultimately helps them navigate the dangerous river and evade capture. Keywords: compound words, Wordwise, expedition, Big Word, river, rafts, adventure, word watchers, supplies, rapids, bed roll, waterproof, flashlight, shoreline, hikers, backpack, fisherman, wildflower, stairway, upstairs, outdoors, outside, blackberries, radio, hillside, mountaintop, waterfall, exhausted, lunchtime, silverware, jack knife, nap time, pigtails, rubber band, suntan, sunburn, sunshine, sunlight, sunset, Professor Compound, birthday, popcorn, campfire, bedtime, good night, morning, breakfast, camp stove, pancake, dish pan, dish cloth, Great Rapids. 2026-02-23T05:00:00.000Z yes A/V Geeks 16mm Films no 645 compound wordswordwisegrammarlanguageeducationriver adventure https://avgeeks.videonest.co/videos/1653041/vorn-silent-1940s-pSrm6Cjjsl https://img.videonest.org/gamma/1653041_thumbnail_resized_v2.webp https://gamma.videonest.org/1653041_video_v4.mp4 Vorn! (silent, 1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This black-and-white German archival film documents the industrial manufacturing, packaging, storage, and logistics of food and feed supplies, primarily from the mid-20th century. It begins by showcasing large-scale machinery and factory workers producing preserved horse feed, then transitions to detailed scenes of packaging various food products such as chocolate, dried vegetables, canned goods, and rations. The footage highlights extensive warehouse storage methods, including proper stacking and ventilation of grain, flour, and sacks, as well as inspection and maintenance procedures to ensure food quality. The film also covers industrial logistics, featuring rail and water transport connections, loading docks, conveyor systems, and manual labor involved in handling and moving goods. Throughout, the importance of careful storage, protection from spoilage, and efficient supply chain management is emphasized. 2026-02-23T05:00:00.000Z yes A/V Geeks 16mm Films no 590 food productionfood packagingfood storageindustrial logisticsgerman archive1940svintage filmhorse feedcanned goodssupply chain https://avgeeks.videonest.co/videos/1653517/a-v-geeks-16mm-lunch-2-23-2026-PkLcRsi2YB https://img.videonest.org/gamma/1653517_thumbnail_resized_v2.webp https://gamma.videonest.org/1653517_video_v4.mp4 A/V Geeks 16mm Lunch 2-23-2026 It's a new work week and already we are itching to watch some old 16mm films. Join us! #avgeeks #16mmfilms 2026-02-23T17:58:04.000Z yes A/V Geeks 16mm Films no 3993 16mm filmclassical musicorchestraVienna Philharmoniccartoonreadingeducationroot wordsprefixessuffixeswildlife conservationNorth Carolinavintage filmAV Geeksfilm digitization https://avgeeks.videonest.co/videos/1653767/basic-reading-and-writing-skills-1977-v6i4XCCeDC https://img.videonest.org/gamma/1653767_thumbnail_resized_v2.webp https://gamma.videonest.org/1653767_video_v4.mp4 Basic Reading And Writing Skills (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film emphasizes the crucial role of communication, particularly reading and writing, in navigating daily life. It illustrates how poor spelling, punctuation, organization, word choice, and penmanship can lead to misunderstandings and missed opportunities. The narrative highlights that literacy is essential for obtaining information, enjoying leisure activities, and succeeding in personal and professional endeavors, using various characters and scenarios to demonstrate the consequences of lacking these fundamental skills. Keywords: Communication, reading, writing, spelling, punctuation, organization, word choice, penmanship, literacy, information, understanding, opportunities, life skills 2026-02-24T05:00:00.000Z yes A/V Geeks 16mm Films no 955 readingwritingcommunicationliteracyeducationlife skillsspellingpenmanshiporganizationword choice https://avgeeks.videonest.co/videos/1653768/i-ll-fix-anthony-1991-bL61wLXU4A https://img.videonest.org/gamma/1653768_thumbnail_resized_v2.webp https://gamma.videonest.org/1653768_video_v4.mp4 I'll Fix Anthony (1991) This film is about a young child who feels overshadowed and teased by their older brother, Anthony. The child, who is currently younger than six, fantasizes about all the things they will be able to do when they turn six, imagining a future where they will be superior to Anthony in every way. These fantasies range from athletic achievements and academic prowess to social popularity and even physical dominance. Ultimately, the child anticipates a time when they will finally "fix" their older brother and assert their own importance. Keywords: sibling rivalry, childhood, fantasy, imagination, superiority, resentment, future, coming of age, aging, dreams 2026-02-24T05:00:00.000Z yes A/V Geeks 16mm Films no 774 sibling rivalrychildhooddreamsbrothersisterfamily16mm film https://avgeeks.videonest.co/videos/1654993/a-v-geeks-16mm-lunch-2-24-2026-d7_TnM645h https://img.videonest.org/gamma/1654993_thumbnail_resized_v2.webp https://gamma.videonest.org/1654993_video_v4_converted.mp4 A/V Geeks 16mm Lunch 2-24-2026 Some of you are snowed in, so please be warmed by the glow of old 16mm films! #avgeeks #16mmfilms 2026-02-24T17:59:19.000Z yes A/V Geeks 16mm Films no 4104 16mm filmAV Geeksschool safetyplayground safetyBuddhismJapanelectionsgovernmentanimationschool bus safetystudent safetyeducational filmvintagechildrendemocracy https://avgeeks.videonest.co/videos/1656775/the-unforgiving-debtor-1942-TL6TTBxc5B https://img.videonest.org/gamma/1656775_thumbnail_resized_v2.webp https://gamma.videonest.org/1656775_video_v4.mp4 The Unforgiving Debtor (1942) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film tells the story of Levi, a struggling father and basket weaver who is deeply in debt to a merchant named Ahaz. Facing an impossible deadline to repay his loan, Levi and his daughter resort to a desperate plan: they pretend to be destitute and plead for mercy from Ahaz. Ahaz, moved by their apparent poverty, not only forgives the debt but also gives them a substantial sum. However, the daughter, eager for personal gain, reveals their deception to her mother, highlighting the corrupting influence of greed. When Levi's original creditor arrives, unaware of Ahaz's generosity, he confronts Levi, leading to a dramatic encounter where Ahaz intervenes, exposing Levi's deceit and ultimately ensuring justice is served by imprisoning Levi for his dishonesty. The film concludes with a moral lesson about forgiveness and the consequences of greed. Keywords: Debt, deception, poverty, mercy, greed, justice, forgiveness, father, daughter, merchant 2026-02-25T05:00:00.000Z yes A/V Geeks 16mm Films no 741 debtforgivenessparablemercyjusticegreeddeceptionfather daughter https://avgeeks.videonest.co/videos/1656776/school-lunchroom-manners-1979-ltbiBjpgTv https://img.videonest.org/gamma/1656776_thumbnail_resized_v2.webp https://gamma.videonest.org/1656776_video_v4.mp4 School Lunchroom Manners (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film emphasizes the importance of good manners and considerate behavior in the school cafeteria. It uses hypothetical scenarios and direct advice to illustrate how students can make lunchtime a more pleasant and relaxing experience for themselves, their classmates, and the staff. The video covers a range of behaviors, from entering the cafeteria quietly and patiently waiting in line, to being mindful of others when carrying food, cleaning up spills, and engaging in polite conversation. It concludes by highlighting that good manners create a better atmosphere for everyone. Keywords: school cafeteria, good manners, behavior, consideration, respect, students, teachers, lunch period, polite, thoughtful, considerate, spills, line, serving, eating, conversation 2026-02-25T05:00:00.000Z yes A/V Geeks 16mm Films no 613 school cafeteriagood mannerslunch etiquettestudents1979 https://avgeeks.videonest.co/videos/1657327/a-v-geeks-16mm-lunch-2-25-2026-y20B5wVugm https://img.videonest.org/gamma/1657327_thumbnail_resized_v2.webp https://gamma.videonest.org/1657327_video_v4.mp4 A/V Geeks 16mm Lunch 2-25-2026 Why is it sometimes "AV Geeks" and other times "A/V Geeks"? I dunno. Too busy picking films to watch to know.. #avgeeks #16mmfilms 2026-02-25T17:59:53.000Z yes A/V Geeks 16mm Films no 4127 16mm filmeconomicscomputer termsvintage animationeducational filmmanagementleadershipemployee relationsvintage psamotivationbarteringtradecomputer historyretro computingav geeks https://avgeeks.videonest.co/videos/1657664/consumer-economics-banking-1977-bQVN6NiaoJ https://img.videonest.org/gamma/1657664_thumbnail_resized_v2.webp https://gamma.videonest.org/1657664_video_v4.mp4 Consumer Economics: Banking (1977) This film is a humorous educational piece explaining the basics of checking and savings accounts. It follows April, a character who initially uses a plant as a hiding place for her money, as she learns about the benefits and proper usage of banking services from various characters. The narrative highlights the importance of protection, convenience, credit building, and earning interest, while also demonstrating how to write checks, balance a checkbook, and understand bank statements. The film contrasts commercial banks with savings and loan associations, emphasizing the advantages of each for different financial needs. Keywords: Checking account, savings account, bank, money, rent, fertilizer, protection, convenience, checks, mail, proof of purchase, credit record, paychecks, plant, deposit, signature, endorse, checks, service charge, monthly charge, balance book, voided check, stop payment, bank statement, canceled checks, overdrawing, interest, savings and loan association, passbook, deposit slip, withdrawal slip, vehicle. 2026-02-26T05:00:00.000Z yes A/V Geeks 16mm Films no 1248 checking accountsavings accountbankmoneycreditinterestbank statementpassbookservice charge1977 https://avgeeks.videonest.co/videos/1658208/a-v-geeks-16mm-lunch-2-26-2026-TEbvT8BZHg https://img.videonest.org/gamma/1658208_thumbnail_resized_v2.webp https://gamma.videonest.org/1658208_video_v4_converted.mp4 A/V Geeks 16mm Lunch - 2-26-2026 Meh, it's Thursday. Watch some 16mm films with us! #avgeeks #16mmfilms 2026-02-26T18:00:16.000Z yes A/V Geeks 16mm Films no 4558 16mm filmav geeksanimationblack musicJazzslaveryNina Simone1950svintage filmfamily dynamicsparentingreligionschoolB.B. KingAmerican history https://avgeeks.videonest.co/videos/1658416/what-mary-jo-wanted-1982-FlKV8r8h1C https://img.videonest.org/gamma/1658416_thumbnail_resized_v2.webp https://gamma.videonest.org/1658416_video_v4.mp4 What Mary Jo Wanted (1982) This film follows Mary Joe, a young black girl with an immense passion for dogs. After persistently expressing her desire for a dog, her parents eventually relent and allow her to get a puppy. Mary Joe names him Teddy, and while she is excited to care for him, she soon discovers the significant challenges and sleepless nights that come with raising a puppy, particularly his nighttime crying. After trying various methods to soothe Teddy, she eventually brings him into her own room, where he finally settles down. The experience teaches Mary Joe about responsibility and leads to a heartwarming bond with her new pet, even helping her develop a new sense of helpfulness around the house. Keywords: dog, puppy, desire, responsibility, challenges, sleepless nights, training, bonding, patience, pet care 2026-02-27T05:00:00.000Z yes A/V Geeks 16mm Films no 878 dogpuppypet careresponsibilityfamily film16mm filmchildhoodpet adoptionafrican american https://avgeeks.videonest.co/videos/1659317/a-v-geeks-16mm-lunch-2-27-2026-xFY3pnCnCx https://i.ytimg.com/vi/wEg3VMaUBPI/maxresdefault_live.jpg https://gamma.videonest.org/1659317_video_v4_360.mp4 A/V Geeks 16mm Lunch - 2-27-2026 It's another day we will be moving 16mm films at our storage units! #avgeeks #16mmfilms 2026-02-27T17:53:36.000Z yes A/V Geeks 16mm Films no 10546 https://avgeeks.videonest.co/videos/1659871/the-wave-a-japanese-folktale-1968-zivozSGI4I https://i.ytimg.com/vi/ETNVNTFs3rM/sddefault.jpg https://gamma.videonest.org/1659871_video_v4.mp4 The Wave: A Japanese Folktale (1968) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film tells the story of Oji San, a wise old man in Japan, and his grandson Tada. During the rice harvest, Oji San unexpectedly burns the entire crop. The villagers are angered and confused until Oji San reveals that he saw a tsunami approaching and sacrificed the harvest to signal the villagers to flee to higher ground, saving their lives. The villagers rebuild and erect a bell in honor of Oji San and Tada, to warn of future tsunamis. Keywords: Japan, village, bell, Oji San, Tada, rice harvest, festival, tsunami, sacrifice, wisdom, saving lives, warning bell 2026-02-28T05:00:00.000Z yes A/V Geeks 16mm Films no 527 https://avgeeks.videonest.co/videos/1661960/memo-motion-laundry-silent-1950s-9tamalKEtk https://img.videonest.org/gamma/1661960_thumbnail_resized_v2.webp https://gamma.videonest.org/1661960_video_v4_360.mp4 Memo Motion Laundry (silent, 1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:00:44 The scene depicts a busy laundry facility with several workers attending to large industrial washing machines, engaged in tasks like sorting and processing laundry items within an organized, efficient workflow. 00:02:04 Workers are operating in an industrial laundry facility, surrounded by large machinery and piles of clothes, suggesting a focus on large-scale laundry processing in an early to mid-20th-century setting. 00:02:16 Workers are engaged in tasks within a laundry facility, operating large industrial washing machines and possibly sorting and handling textiles, characteristic of an early 20th-century industrial environment with manual labor processes. 00:03:45 Workers are operating machinery in an industrial laundry setting, handling large pieces of equipment and textiles, with the black-and-white footage providing a historical perspective on these operations. 00:04:12 Workers are engaged in various tasks within a busy laundry facility, handling laundry, operating machines, and organizing textiles. 00:04:21 Individuals are depicted engaged in laundry-related activities, possibly operating machinery, in an industrial setting with dim lighting and vintage equipment. 00:05:22 A vintage scene in a laundry facility shows two individuals in work attire engaged with industrial laundry equipment, with large machines and stacks of fabric. 2026-03-01T05:00:00.000Z yes A/V Geeks 16mm Films no 352 laundrytextilefactoryvintagehistoric https://avgeeks.videonest.co/videos/1661961/word-wise-word-families-1976-0hm6goguhg https://img.videonest.org/gamma/1661961_thumbnail_resized_v2.webp https://gamma.videonest.org/1661961_video_v4_360.mp4 Word Wise: Word Families (1976) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film, "Word Families," by Norman and Marjorie Bean, uses a train journey as a metaphor to teach children about word families. The characters learn that words belong to the same family if they share the same ending letters, exemplified through various word groups like "back, track, black" and "ride, side, wide, hide." The film also addresses the nuance of words that sound alike but don't share spelling, and those that sound different but share spellings, reinforcing the core concept of shared letter endings as the defining characteristic of a word family. Keywords: word families, rhyming, phonics, spelling, education, children's learning, train, vocabulary, word endings 2026-03-01T05:00:00.000Z yes A/V Geeks 16mm Films no 574 word familiesrhymingphonicsspellingchildren's learningtrainvocabularyword endings https://avgeeks.videonest.co/videos/1664084/washington-city-of-the-world-1965-e0BKgOh-43 https://img.videonest.org/gamma/1664084_thumbnail_resized_v2.webp https://gamma.videonest.org/1664084_video_v4_360.mp4 Washington - City of the World (1965) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film celebrates Washington D.C. as the symbolic center of the world and the embodiment of American ideals and heritage. It highlights iconic landmarks such as the Washington Monument, the National Archives housing the Declaration of Independence and Constitution, the White House, and the Capitol Building, showcasing their historical and governmental significance. The documentary also explores cultural institutions like the National Gallery of Art, the Library of Congress, and the Folger Library, alongside scientific and civic institutions like the U.S. Naval Observatory and the FBI. Finally, it touches upon places of remembrance and international representation, including Arlington National Cemetery, foreign embassies, and religious sites, culminating in a reflection on Washington D.C. as a testament to American history, democracy, and freedom. Keywords: Washington D.C., monument, National Archives, Declaration of Independence, Constitution, White House, Capitol Building, democracy, American heritage, freedom, government, history, culture, national landmarks, patriotism 2026-03-02T05:00:00.000Z yes A/V Geeks 16mm Films no 787 https://avgeeks.videonest.co/videos/1665724/a-v-geeks-16mm-lunch-3-2-2026-7WXpSLdo1i https://img.videonest.org/gamma/1665724_thumbnail_resized_v2.webp https://gamma.videonest.org/1665724_video_v4_360.mp4 A/V Geeks 16mm Lunch 3-2-2026 It's a harsh Monday but we're still gonna watch old 16mm films. #avgeeks #16mmfilms 2026-03-02T18:04:21.000Z yes A/V Geeks 16mm Films no 3624 https://avgeeks.videonest.co/videos/1666298/the-magic-pipes-1976-wy5jodx51o https://img.videonest.org/gamma/1666298_thumbnail_resized_v2.webp https://gamma.videonest.org/1666298_video_v4.mp4 The Magic Pipes (1976) This film tells the story of Herm, the organ master of Kubstein, a charming Austrian town that values tradition. The town's identity is deeply tied to the majestic organ in its castle, which plays at specific times to signal that all is well. Two children, Ysef and Elizabeth, ask Herm a hypothetical question about what would happen if the organ didn't play. This thought troubles Herm, and he experiences a strange dream or vision where a "What if?" button appears on the organ console, causing the music to play uncontrollably fast and then backward, disrupting the town. He is ultimately woken by the children, relieved to find that the organ is playing normally and the "What if?" button is gone, allowing the town to continue in its traditional harmony. Keywords: Organ, tradition, music, Austria, Kubstein, children, expectation, disruption, harmony, dream. 2026-03-03T05:00:00.000Z yes A/V Geeks 16mm Films no 858 organtraditionAustriaKubsteincastle https://avgeeks.videonest.co/videos/1668444/a-v-geeks-16mm-lunch-3-3-2026-r17gDXbOiT https://img.videonest.org/gamma/1668444_thumbnail_resized_v2.webp https://gamma.videonest.org/1668444_video_v4_converted.mp4 A/V Geeks 16mm Lunch 3-3-2026 We watch 16mm films for lunch, what do you do? #avgeeks #16mmfilms 2026-03-03T18:03:27.000Z yes A/V Geeks 16mm Films no 4059 https://avgeeks.videonest.co/videos/1669498/junior-missile-men-in-action-1968-6zqcrXvMtT https://img.videonest.org/gamma/1669498_thumbnail_resized_v2.webp https://gamma.videonest.org/1669498_video_v4.mp4 Junior Missile Men In Action (1968) This film segment celebrates the pioneering work of Dr. Robert Hutchings Goddard, the father of the space age, highlighting his early rocket launches in the 1920s and 1930s, which laid the groundwork for modern rocketry and space exploration. It contrasts the initial lack of recognition for his achievements in America with their adoption by other nations, emphasizing his lasting legacy through patents and the growing interest in model rocketry among youth, exemplified by the West Covina Model Rocket Society. The narrative connects the passion and scientific principles learned by young hobbyists to Goddard's own early dreams and persistent vision. Keywords: Robert Hutchings Goddard, rocketry, space age, liquid propellant rocket, V2 rocket, model rocketry, West Covina Model Rocket Society, science education, innovation, legacy 2026-03-04T05:00:00.000Z yes A/V Geeks 16mm Films no 936 Robert Goddardrocketryspace explorationmodel rocketsscience education https://avgeeks.videonest.co/videos/1670234/av-geeks-16mm-lunch-3-4-2026-fLWLAAeuPa https://img.videonest.org/gamma/1670234_thumbnail_resized_v2.webp https://gamma.videonest.org/1670234_video_v4.mp4 AV Geeks 16mm Lunch 3-4-2026 16mm is so small but can contain a whole galaxy of information! #avgeeks #16mmfilms 2026-03-04T17:54:11.000Z yes A/V Geeks 16mm Films no 3795 https://avgeeks.videonest.co/videos/1672266/body-talking-1983-4BJgsE_Fec https://img.videonest.org/gamma/1672266_thumbnail_resized_v2.webp https://gamma.videonest.org/1672266_video_v4.mp4 Body Talking (1983) This song is about the non-verbal communication that our bodies convey, even without us speaking a word. It highlights how gestures, expressions, and posture can reveal our emotions, intentions, and even hidden feelings, and how this "body language" is a universal form of communication that everyone understands. Keywords: body language, non-verbal communication, gestures, expressions, emotions, talking without words, universal language, feelings, hidden feelings, signaling 2026-03-05T05:00:00.000Z yes A/V Geeks 16mm Films no 381 body languagenonverbal communicationexpressionsgesturesemotionssocial skills16mm filmvintage filmeducational filmcommunication https://avgeeks.videonest.co/videos/1674756/a-v-geeks-16mm-lunch-3-5-2026--JWy7Kl30d https://img.videonest.org/gamma/1674756_thumbnail_resized_v2.webp https://gamma.videonest.org/1674756_video_v4.mp4 A/V Geeks 16mm Lunch 3-5-2026 Going to show old 16mm today provide the power doesn't go out again.. Oof, what a pain! #avgeeks #16mmfilms Roofer's Pitch (continued from yesterday) Rhinoceros Are Drugs the Answer? American Maker 2026-03-06T07:25:27.000Z yes A/V Geeks 16mm Films no 4217 16mm filmvintage filmroofing safetyrhinocerosdrug useeducational filmamerican makermass productionassembly lineChevroletamerican madecraftsmanshipwildlifeafrican wildlifeteamwork https://avgeeks.videonest.co/videos/1674763/a-sense-of-touch-1983-Nw3owO7TW3 https://img.videonest.org/gamma/1674763_thumbnail_resized_v2.webp https://gamma.videonest.org/1674763_video_v4.mp4 A Sense Of Touch (1983) Presents a visual exploration of the sense of touch as experienced by children. Shows how to use powers of observation to identify and compare a variety of textures, and in doing so learn to touch, smell and taste using the eyes and ears. Explains that if we stretch the use of our senses, we can gain more information. 2026-03-06T05:00:00.000Z yes A/V Geeks 16mm Films no 429 https://avgeeks.videonest.co/videos/1693111/a-v-geeks-16mm-lunch-3-6-2026-yElMSE9Rz8 https://img.videonest.org/gamma/1693111_thumbnail_resized_v2.webp https://gamma.videonest.org/1693111_video_v4.mp4 A/V Geeks 16mm Lunch 3-6-2026 Moving more films! So here's a random smattering of movie trailers #avgeeks #16mmfilms 2026-03-06T18:00:12.000Z yes A/V Geeks 16mm Films no 3918 16mm filmmovie trailervintage filmexploitation filmhorror filmcomedy film https://avgeeks.videonest.co/videos/1693112/griffith-labs-silent-T11hW0oLFL https://img.videonest.org/gamma/1693112_thumbnail_resized_v2.webp https://gamma.videonest.org/1693112_video_v4.mp4 Griffith Labs (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This vintage instructional footag provides a detailed overview of traditional and industrial meat processing methods, focusing primarily on pork. Beginning with scenes of livestock on a farm, it transitions into the slaughtering, scalding, and hair removal processes in a small factory setting. The film then demonstrates precise butchery techniques, emphasizing careful handling of arteries during meat preparation. It highlights the use of specialized equipment for arterial injection of curing brine, temperature monitoring, and quality control to produce high-quality cured hams and shoulders. Throughout, the video combines practical demonstrations with technical explanations, showcasing both manual craftsmanship and mechanized processes in mid-20th century meat packing. 2026-03-06T17:00:00.000Z yes A/V Geeks 16mm Films no 719 pork processingmeat packingbutcheryvintage film16mm filminstructional filmmeat industrycured hamlivestockslaughtering https://avgeeks.videonest.co/videos/1696450/modern-communications-raw-footage-silent-izvn0mIWR6 https://img.videonest.org/gamma/1696450_thumbnail_resized_v2.webp https://gamma.videonest.org/1696450_video_v4.mp4 Modern Communications (raw footage, silent) This collection of 1950s scenes captures the rhythm of daily life in a bustling mid-century city. From entertainment and communication to transportation and law enforcement, the footage portrays a society shaped by evolving technology and urban routines. Women purchase movie tickets while families gather around television sets, reflecting the growing influence of home entertainment. Office work is highlighted through scenes of paperwork, fabric swatches, and telegrams, while mail carriers and newsstands keep the flow of information constant. The city streets teem with activity—pedestrians window shop, taxis navigate intersections, and police officers direct traffic. Meanwhile, the infrastructure of transportation is evident as propeller planes take off, trains pass through crossings at night, and officers patrol on motorcycles. These moments encapsulate the era’s interconnectedness, where business, leisure, and daily tasks intertwine in the fabric of 1950s urban life. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-03-07T17:00:00.000Z yes A/V Geeks 16mm Films no 789 1950surban lifecity scenesvintagecommunicationtransportationmailtelegramstelevisionpropeller planes https://avgeeks.videonest.co/videos/1696452/why-we-tell-the-truth-no-more-squareburgers-in-str-CcVCp5qaLl https://img.videonest.org/gamma/1696452_thumbnail_resized_v2.webp https://gamma.videonest.org/1696452_video_v4.mp4 Why We Tell The Truth: No More Squareburgers In Straightalk (1978) This film tells the story of a town called Straight Talk, where everyone always tells the truth, and everything is done in a straight manner. Their orderly lives are disrupted when an alien named the Jester arrives, who thrives on lies and manipulation. He tricks the townspeople into lying to get what they want, causing chaos and distrust. Ultimately, the townspeople realize the harm of lying and reaffirm their commitment to telling the truth, which breaks the Jester's spell and restores order. Keywords: Straight Talk, truth, lies, Jester, alien, manipulation, order, chaos, trust, town, spaceship, square burgers, consequences 2026-03-07T05:00:00.000Z yes A/V Geeks 16mm Films no 732 truthliesalienjestersquareburgersstraight talkhonesty1970svintage cartoon16mm filmmanipulation https://avgeeks.videonest.co/videos/1697245/word-wise-prefixes-1976-n-YZJLsL10 https://img.videonest.org/gamma/1697245_thumbnail_resized_v2.webp https://gamma.videonest.org/1697245_video_v4.mp4 Word Wise: Prefixes (1976) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. In a secret mission to Snow Peak village, a secret agent must find fellow agent Joe Conrad. Armed only with the knowledge that Conrad will be dressed for the snow and that the agent must deliver a secret code word, the protagonist struggles to identify Conrad among the similarly dressed villagers. After a series of failed attempts to communicate the secret prefix, including a daring broadcast over the village loudspeaker, the agent is discovered and must flee. In a final, unexpected twist, the agent finds Conrad disguised as a snowman and successfully rescues him by deducing the secret prefix was "in," meaning "not" or "opposite," as in "invisible." Keywords: secret agent, mission, Snow Peak village, winter festival, Joe Conrad, secret code word, prefix, language, disguise, snowman, invisible, rescue, headquarters 2026-03-08T05:00:00.000Z yes A/V Geeks 16mm Films no 695 secret agentprefixgrammarlanguageeducationwinter festivalsnowmanrescue mission https://avgeeks.videonest.co/videos/1699295/rrmt-mtt-1147-m-silent-pl0T-xLitX https://img.videonest.org/gamma/1699295_thumbnail_resized_v2.webp https://gamma.videonest.org/1699295_video_v4.mp4 RRMT MTT 1147 M (silent) RRMT MTT 1147 M (silent) Overview The footage presents a diverse array of scenes highlighting various aspects of professional environments. It opens with employees engaged in office work and technical drafting, showcasing their collaboration on design projects and administrative tasks. The focus then shifts to a bustling switchboard station, where a group of female telephone operators skillfully manage calls, utilizing mid-20th-century telecommunications technology with plugs and cords. The final segment features a formal meeting room where men in uniforms and business attire participate in a briefing, demonstrating attentive engagement in a professional discussion surrounded by documents. Together, these scenes capture the essence of workplace dynamics and the evolution of communication technology. #Office Work #Telecommunications #Vintage Technology #Professional Meeting #Workplace Dynamics Timeline 00:00:00 - 00:04:00 Office Work and Drafting 00:00:00 Men and women are diligently working at their desks in a bustling office, with one woman distributing documents. 00:00:51 Employees in a mid-20th century office are focused on individual tasks, including a woman using a typewriter, in an organized workplace. 00:02:34 Two men discuss blueprints over drafting tables, collaborating on a design project in an architectural or engineering office. 00:02:51 An individual is engaged in technical drawing with a pencil and ruler, focusing on precise measurements for design work. 00:04:00 - 00:07:59 Vintage Telephone Switchboard Operations 00:04:29 Female telephone operators efficiently handle numerous calls at a busy switchboard, connecting calls via plugs and cords. 00:04:40 The women operate a manual telephone switchboard, connecting calls by plugging and unplugging cables while wearing headsets. 00:04:54 A group of women actively manages connections on a large, vintage telephone switchboard in a busy office, highlighting manual communication processes. 00:07:59 - 00:09:30 Formal Meeting and Briefing 00:07:59 Men in uniforms and business attire are gathered around a table in a formal meeting room, attentively watching or listening to a briefing or discussion. 00:08:01 A group of men in formal and military-style attire are seated around a table, possibly in a meeting or training session, discussing or analyzing a particular topic. 00:08:10 Several men in military uniforms and formal attire are seated around a conference table, suggesting a formal briefing or meeting in an office setting where they are attentively listening to a presentation or discussion. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-03-08T16:00:00.000Z yes A/V Geeks 16mm Films no 570 office worktelephone switchboardvintage technologyprofessional meetingworkplace dynamicstelecommunications1950s1940smilitary briefing https://avgeeks.videonest.co/videos/1700513/through-grandpa-s-eyes-1987-dsPRS7N46Y https://img.videonest.org/gamma/1700513_thumbnail_resized_v2.webp https://gamma.videonest.org/1700513_video_v4.mp4 Through Grandpa's Eyes (1987) This film is about a young boy named Johnny who visits his blind grandfather. Through their interactions, Johnny learns to appreciate the world not just through sight, but also through other senses, like touch, smell, and hearing. His grandfather, despite his blindness, has a rich inner world and a unique way of experiencing life, which he shares with Johnny. They engage in various activities together, from fishing and music to storytelling and describing colors through sensory experiences, deepening their bond and Johnny's understanding of empathy and perception. Keywords: Blindness, Grandfather, Grandson, Senses, Perception, Empathy, Love, Family, Music, Storytelling, Friendship, Learning, Acceptance, Sensory experience, Colors 2026-03-09T04:00:00.000Z yes A/V Geeks 16mm Films no 1185 BlindnessGrandfatherGrandsonSensesFamilyEmpathyFriendship16mm film https://avgeeks.videonest.co/videos/1701390/the-magic-foot-silent-IU73k3Ai5P https://img.videonest.org/gamma/1701390_thumbnail_resized_v2.webp https://gamma.videonest.org/1701390_video_v4.mp4 The Magic Foot (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This vintage instructional film showcases 'The Magic Foot,' a specialized sewing machine attachment designed for decorative embroidery, appliques, and monogramming. The video features detailed demonstrations of various sewing and embroidery techniques using the attachment, including free-motion embroidery, zigzag stitching, and the application of decorative trims on garments. Throughout, a male narrator provides clear, informative guidance over the rhythmic sounds of a vintage sewing machine. The film concludes by highlighting the Magic Foot kit's versatility with different sizes of monogram initials and decorative patterns, emphasizing its precision and creative potential for sewing projects. 2026-03-09T16:00:00.000Z yes A/V Geeks 16mm Films no 364 magic footsewing machineembroideryappliquemonogrammingvintage sewingdecorative sewingsewing techniquessewing attachment https://avgeeks.videonest.co/videos/1703299/a-v-geeks-16mm-lunch-3-9-2026-YARuUa1BP0 https://img.videonest.org/gamma/1703299_thumbnail_resized_v2.webp https://gamma.videonest.org/1703299_video_v4.mp4 A/V Geeks 16mm Lunch 3-9-2026 Daylight Savings Time has me all off.. #16mmfilms #avgeeks 2026-03-10T06:11:11.000Z yes A/V Geeks 16mm Films no 3321 16mm filmchild safetyMcGruff the Crime DogCell WarsFuture Farmers of Americaeducational filmfarmingagricultureFFApersonal safetygermsimmune systemrural lifevintage filmantibody https://avgeeks.videonest.co/videos/1703300/i-ll-fix-anthony-1991-8wcQRTpxWX https://img.videonest.org/gamma/1703300_thumbnail_resized_v2.webp https://gamma.videonest.org/1703300_video_v4.mp4 I'll Fix Anthony (1991) This film is a poignant portrayal of sibling rivalry and the longing for maturity, as a younger child fantasizes about the day they turn six. On their sixth birthday, they imagine themselves possessing all the skills and advantages their older brother, Anthony, currently holds over them. This fantasy includes being stronger, smarter, braver, and more popular, finally allowing them to assert dominance and "fix" their older sibling. The film captures the universal childhood desire to grow up quickly to overcome perceived injustices and gain independence. Keywords: Sibling rivalry, childhood fantasy, growing up, maturity, age six, older brother, younger sibling, dominance, wish fulfillment, imagination 2026-03-10T04:00:00.000Z yes A/V Geeks 16mm Films no 774 sibling rivalrychildhood fantasygrowing upolder brotheryounger siblingwish fulfillment https://avgeeks.videonest.co/videos/1704308/rp-henry-charles-us-trip-1953-partii-silent-XvhyKc82Iq https://img.videonest.org/gamma/1704308_thumbnail_resized_v2.webp https://gamma.videonest.org/1704308_video_v4.mp4 RP Henry Charles US Trip 1953 PartII (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This extensive vintage travel film from the 1950s offers a nostalgic journey across iconic American landscapes and cities, beginning with scenic views of Waterton-Glacier International Peace Park and continuing through national parks such as Mount Rainier, Crater Lake, Lassen Volcanic, Great Smoky Mountains, and Yosemite. The footage captures serene natural beauty, wildlife encounters, and historic landmarks, interspersed with scenes of coastal ferry rides, bustling mid-century urban settings including San Francisco and New Orleans, and leisurely beach and resort activities. The film also highlights seasonal changes, cultural sites like The Alamo, and rural Americana with classic cars and small-town life, all presented with minimal narration and evocative ambient sounds, culminating in a rich visual tapestry of mid-century American travel and leisure. 2026-03-10T16:00:00.000Z yes A/V Geeks 16mm Films no 3007 https://avgeeks.videonest.co/videos/1706265/av-geeks-16mm-lunch-3-10-2026-y4WXn7aB2F https://img.videonest.org/gamma/1706265_thumbnail_resized_v2.webp https://gamma.videonest.org/1706265_video_v4.mp4 AV Geeks 16mm Lunch 3-10-2026 Plumbers are visiting. Not at the archive today. #avgeeks #16mmfilms 2026-03-11T06:09:17.000Z yes A/V Geeks 16mm Films no 3885 https://avgeeks.videonest.co/videos/1706266/study-skills-organize-it-1985-bn0LdCBcNL https://img.videonest.org/gamma/1706266_thumbnail_resized_v2.webp https://gamma.videonest.org/1706266_video_v4.mp4 Study Skills: Organize It (1985) This film suffers from color breathing - where the film's color has unevenly faded in the middle of the frame. This educational film explains the importance of organization in various aspects of life, from managing personal belongings and schoolwork to undertaking group projects and even scientific research. It highlights two key methods of organization: classification, which involves grouping similar items or information into categories, and sequencing, which pertains to arranging things in the correct order. The film demonstrates how these principles help simplify tasks, improve efficiency, and lead to more successful outcomes by using relatable examples like finding items, studying for tests, telling stories, managing time, and completing collaborative projects. Keywords: Organization, classification, categories, grouping, sequencing, order, time management, planning, group projects, studying, information, efficiency 2026-03-11T04:00:00.000Z yes A/V Geeks 16mm Films no 1015 https://avgeeks.videonest.co/videos/1708180/a-v-geeks-16mm-lunch-3-11-2026-gHXatBIlci https://i.ytimg.com/vi/AxsgVR00VBk/maxresdefault_live.jpg https://gamma.videonest.org/1708180_video_v4_converted.mp4 A/V Geeks 16mm Lunch 3-11-2026 It's a great time to be watching old 16mm films! Join us! #avgeeks #16mmfilms 2026-03-11T16:55:51.000Z yes A/V Geeks 16mm Films no 4251 https://avgeeks.videonest.co/videos/1708181/city-in-the-snow-silent-raw-footage-1940s-YB6GxdecLJ https://img.videonest.org/gamma/1708181_thumbnail_resized_v2.webp https://gamma.videonest.org/1708181_video_v4.mp4 City In The Snow (silent raw footage, 1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A Snowy Cityscape and Mysterious Hallway 00:00:08 A person in a trench coat and hat is seen in an indoor hallway, creating a vintage ambiance. 00:01:15 A snow-covered cityscape unfolds, showing tranquil urban scenes blanketed in white. 00:01:42 A classic convertible car drives past a small building in a snowy environment, suggesting a mid-20th-century timeframe. 00:03:15 A person in a trench coat and hat walks down a dimly lit hallway, evoking a classic film noir setting. 00:03:53 - 00:08:06 A Snowy Cityscape 00:03:53 Vintage cars line a snowy street in a bustling city, highlighting a historical winter ambiance. 00:05:12 A cityscape enveloped in snow creates a serene and silent winter scene, transforming the urban environment into a tranquil landscape. 00:05:47 A bicycle wheel rests on a snowy surface, emphasizing the interaction between the object and the cold, winter environment. 00:07:01 Snow blankets a quiet, wooded area with leafless trees, capturing the serene beauty and stillness of nature in winter. 2026-03-11T16:00:00.000Z yes A/V Geeks 16mm Films no 487 1940scityscapevintage carstrench coatsilent film16mm film https://avgeeks.videonest.co/videos/1709753/smokeless-tobacco-it-can-snuff-you-1986-i9N4s9X7Pi https://img.videonest.org/gamma/1709753_thumbnail_resized_v2.webp https://gamma.videonest.org/1709753_video_v4.mp4 Smokeless Tobacco: It Can Snuff You (1986) This print suffers from "color breathing" where the center of the frame's color is fading but the edges are not.. This documentary explores the dangers of smokeless tobacco, debunking the myth that it's a safer alternative to cigarettes. It highlights how the tobacco industry, through clever advertising and celebrity endorsements, targets young people with products like snuff and chewing tobacco. The film presents medical evidence linking smokeless tobacco use to severe oral health issues, including gum and teeth damage, and a significantly increased risk of oral cancer. A tragic case study of Shawn Marcy, who died of oral cancer at 19 after using smokeless tobacco since age 12, underscores the devastating consequences. The documentary emphasizes the addictive nature of these products and urges viewers to consider the health experts' warnings over industry propaganda. Keywords: smokeless tobacco, snuff, chewing tobacco, oral cancer, nitrosamines, addiction, advertising, celebrities, athletes, health risks, precancerous conditions, leukoplakia, gum disease, tooth decay, oral health, tobacco industry, health warnings 2026-03-12T04:00:00.000Z yes A/V Geeks 16mm Films no 782 smokeless tobaccochewing tobaccooral cancertobacco addictionhealth risks https://avgeeks.videonest.co/videos/1713108/a-v-geeks-16mm-lunch-3-12-2026-S6Q5cN6JeK https://img.videonest.org/gamma/1713108_thumbnail_resized_v2.webp https://gamma.videonest.org/1713108_video_v4.mp4 A/V Geeks 16mm Lunch 3-12-2026 There's a cold front coming through and the wind might bring down the power. We'll watch 16mm films until we can't.. #avgeeks #16mmfilms 2026-03-13T06:45:17.000Z yes A/V Geeks 16mm Films no 3835 16mm filmWWIID-Daytime zonesTokyowitchhalloweendesert trekhikingsurvivalvintage cartoonnaval maneuversWorld War IIanimationdesert https://avgeeks.videonest.co/videos/1713109/life-story-of-the-hummingbird-1963-jaqhdm0R5w https://img.videonest.org/gamma/1713109_thumbnail_resized_v2.webp https://gamma.videonest.org/1713109_video_v4.mp4 Life Story Of The Hummingbird (1963) This documentary explores the fascinating life cycle of hummingbirds, highlighting their unique physical characteristics and behaviors. It details their incredibly fast wing movements, their ability to fly in any direction, and the iridescent nature of their plumage, which is caused by light reflection rather than pigment. The film also focuses on the intricate process of nest building, egg-laying, incubation, and the care of their young, emphasizing the constant need for food for both the mother and chicks due to their high metabolism. The courtship rituals of the male, including spectacular dives, and the eventual departure of the fledglings are also showcased, concluding with the continuation of the life cycle. Keywords: Hummingbird, smallest bird, high-speed photography, wing movement, iridescence, nest building, egg laying, incubation, chick development, fledglings, courtship, life cycle. 2026-03-13T04:00:00.000Z yes A/V Geeks 16mm Films no 959 hummingbirdsmallest birdhigh-speed photographyiridescencenest buildingchick developmentcourtship https://avgeeks.videonest.co/videos/1713110/one-people-silent-1946-2pVKu_Tkx1 https://img.videonest.org/gamma/1713110_thumbnail_resized_v2.webp https://gamma.videonest.org/1713110_video_v4.mp4 One People (silent, 1946) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. "One People," a silent film from 1946, explores themes of unity and collective identity during the post-war era. The film captures diverse individuals interacting, highlighting the spirit of collaboration and resilience within various communities. It vividly illustrates shared human experiences and the importance of coming together in a time of rebuilding. Notably, a steam locomotive powers through the night, symbolizing progress and the journey toward a more unified future. Through its rich imagery, the film reflects on the strength found in diversity and the enduring hope for togetherness in a changing world. #Unity in Diversity #Post-War Resilience #Silent Film History #Collective Identity #Cultural Collaboration Timeline 00:00:00 - 00:04:00 One People 00:00:00 The segment begins with the title card "One People," setting the stage for a historical or cultural narrative from 1946. 00:02:01 Diverse individuals from various backgrounds are shown standing together, emphasizing harmony and collaboration among different ethnicities and ages. 00:02:24 A group stands before a large globe, symbolizing global unity and international cooperation in the context of post-war recovery efforts. 00:04:00 - 00:08:00 One People (1946) 00:04:18 Individuals of diverse backgrounds are shown interacting, possibly engaging in community activities or discussions, emphasizing unity and collaboration. 00:04:55 A dark frame with a small vertical strip of light on the right suggests an old or damaged film reel, possibly indicating a transitional or introductory segment. 00:05:55 A steam locomotive powers through the night, exuding a sense of speed and momentum with bright headlights cutting through the darkness. 00:07:57 A black screen with white light peeking from the corners suggests a vintage film frame, possibly depicting historical or cultural scenes from 1946. 00:08:00 - 00:10:35 One People (1946) 00:09:03 The silent film from 1946 captures life and interactions among diverse communities, highlighting unity and shared human experiences in the post-war era. 00:10:11 A depiction of the Statue of Liberty against a dramatic sky symbolizes freedom and unity, reflecting themes of post-war optimism and the enduring spirit of unity. 2026-03-12T16:00:00.000Z yes A/V Geeks 16mm Films no 636 post-warunityresiliencecollaborationsilent film1946steam locomotivestatue of libertyhuman experiencecollective identitycultural collaboration https://avgeeks.videonest.co/videos/1718114/work-cities-and-the-march-on-washington-1963-silen-habDSDA8xb https://img.videonest.org/gamma/1718114_thumbnail_resized_v2.webp https://gamma.videonest.org/1718114_video_v4.mp4 [Work, Cities, and the March on Washington. 1963, silent footage] 306 6522 (silent) Overview The footage presents a rich tapestry of scenes showcasing various aspects of mid-20th century life and work. It begins in educational environments where individuals are deeply engaged in collaborative tasks, illustrating the dynamics of learning and material distribution. Transitioning to an elevated railway track, viewers are taken through a vibrant urban landscape filled with a mix of residential and commercial buildings, offering a glimpse into the historical transportation infrastructure and city life of the era. The narrative continues in an industrial setting, where workers skillfully operate a large printing machine, capturing the essence of labor during that time. A poignant moment is highlighted with a person holding flyers for the 1963 March on Washington, linking the footage to significant social movements of the period. Each segment intertwines to reflect the themes of education, industry, and social change. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. #education #urban life #industrial history #social movements #mid-20th century Timeline 00:00:00 - 00:03:12 Focused Activities and Collaborative Learning 00:00:00 A young woman is deeply engrossed in her task within a classroom or workshop, surrounded by others similarly engaged. 00:01:57 Individuals are seen sorting and distributing documents and pamphlets on a table in an indoor gathering space. 00:02:55 A group is engaged in a focused activity, possibly in a classroom, with one individual's face blurred for privacy and another working in the background. 00:03:12 - 00:04:00 Urban Elevated Railway 00:03:12 The video opens with an elevated railway track cutting through a dense urban area, highlighting various architectural styles of residential and commercial buildings. 00:03:16 A train is shown moving along elevated tracks next to an ivy-covered brick building, emphasizing the interplay between urban transport and architecture. 00:03:39 The scene shifts to a railway track running alongside weathered brick buildings, reflecting the city's industrial or residential past. 00:03:50 An elevated perspective reveals black and white urban residential buildings, complete with diverse rooftops and a distant water tower, capturing an older cityscape. 00:04:00 - 00:06:17 Industrial Printing and Historic Flyers 00:05:23 Workers are seen operating and monitoring a large industrial printing machine in a factory, with stacks of paper in the foreground. 00:06:12 A person holds a stack of flyers announcing the historic March on Washington for Jobs and Freedom, scheduled for August 28, 1963. 2026-03-14T16:00:00.000Z yes A/V Geeks 16mm Films no 378 1963March on WashingtonCivil Rightsprinting pressurban lifeelevated railwaymid-20th centuryeducationindustrial historyjobs and freedom https://avgeeks.videonest.co/videos/1718115/av-geeks-16mm-lunch-3-13-2026-rWAnba055U https://img.videonest.org/gamma/1718115_thumbnail_resized_v2.webp https://gamma.videonest.org/1718115_video_v4.mp4 AV Geeks 16mm Lunch 3-13-2026 Here we are! Showing you 16mm films! #avgeeks #16mmfilms 2026-03-14T06:22:45.000Z yes A/V Geeks 16mm Films no 3739 https://avgeeks.videonest.co/videos/1718117/male-and-female-god-created-us-part-1-1982-DjM0gOJHV4 https://img.videonest.org/gamma/1718117_thumbnail_resized_v2.webp https://gamma.videonest.org/1718117_video_v4.mp4 Male And Female: God Created Us, Part 1 (1982) This film explores the societal conditioning of gender roles and expectations for men and women, particularly within marriage. It contrasts traditional views where men hold power and women are subservient with a more egalitarian perspective derived from biblical creation stories. The narrative highlights the personal struggles of a couple who re-evaluate their relationship based on a newfound understanding of mutual partnership and equal value, moving away from the "waiting" and prescribed roles they were taught. Gender roles, societal conditioning, marriage, equality, biblical interpretation, creation story, partnership, mutual respect, challenging expectations, women's liberation, men's roles, traditional views, egalitarianism. 2026-03-14T04:00:00.000Z yes A/V Geeks 16mm Films no 1092 https://avgeeks.videonest.co/videos/1718119/truck-farm-can-1-silent-raw-footage-1950s-crEZ_K0jN5 https://img.videonest.org/gamma/1718119_thumbnail_resized_v2.webp https://gamma.videonest.org/1718119_video_v4.mp4 Truck Farm Can 1 (silent, raw footage, 1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Truck Farm Can 1 (silent, raw footage, 1950s) Overview This segment presents raw, silent footage from the 1950s, offering an authentic glimpse into the vibrant life of a truck farm. Viewers will see scenes of agricultural produce, highlighting freshly harvested vegetables and traditional milking practices that emphasize mid-20th-century farming techniques. The footage also includes the sorting and distribution of tomatoes, capturing the hustle and bustle of market scenes. Alongside these agricultural activities, there are moments showcasing rural life, featuring children engaged in farm tasks and enjoying playful moments against the backdrop of serene farmhouses and fields. Additionally, the footage captures manual labor processes, such as sorting or processing beans, reflecting the hard work involved in food production during this era. #Truck Farm #1950s Farming #Agricultural History #Rural Life #Vintage Footage Timeline 00:00:03 - 00:04:05 Raw Footage of Truck Farm 00:04:05 - 00:05:27 Farm Life and Produce 00:04:05 A market stand displays a variety of fresh vegetables like lettuce, tomatoes, green beans, and corn, emphasizing abundant farm produce. 00:04:52 A farmer in a plaid shirt and cap is shown manually milking a cow in a rural setting with rolling hills in the background. 00:05:27 - 00:06:15 Sorting and Distribution of Tomatoes 00:05:27 Freshly harvested tomatoes are sorted into wooden barrels and cardboard boxes, likely in preparation for distribution or sale. 00:05:30 Workers are seen handling large quantities of tomatoes in a bustling produce distribution setting, organizing them for transport or sale. 00:06:00 Numbered slate boards with 'T-FARM' labels indicate a systematic filming process from the 1950s. 00:06:10 A mid-20th-century market scene shows vintage vehicles, vendors, and shoppers interacting on a busy street, reflecting typical commerce of the era. 00:08:56 - 00:09:44 Rural Life and Children's Activities 00:08:56 Children are shown participating in farm activities, handling tools or seeds on a freshly plowed field with bags nearby. 00:09:06 A serene 1950s rural scene features a farmhouse porch with potted plants and a field under a partly cloudy sky. 00:09:29 Two children are seen playing energetically near a barn on a sunny day in a rural farm environment. 00:09:44 - 00:10:56 Bean Processing in the 1950s 00:10:36 A person is shown overseeing the sorting or processing of beans in a large metal container. 2026-03-13T16:00:00.000Z yes A/V Geeks 16mm Films no 656 truck farm1950s farmingagricultural historyrural lifevintage footagefarm lifeproducetomatoesmarket scenechildren activitiesbean processingfarmhousetractormilking cow https://avgeeks.videonest.co/videos/1721285/how-animals-live-in-winter-silent-raw-footage-choS-6Hqc4 https://img.videonest.org/gamma/1721285_thumbnail_resized_v2.webp https://gamma.videonest.org/1721285_video_v4.mp4 How Animals Live In Winter (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. How Animals Live In Winter (silent, raw footage) Overview The footage showcases the beauty and challenges of winter, featuring children joyfully building and interacting with snowmen in a quiet suburban setting. The serene landscapes highlight bare trees and snow-covered forests, emphasizing the stark beauty of nature during the colder months. Observers take in the tranquil yet demanding environment of a winter forest, suggesting a focus on wildlife and research. The scenes also include individuals dressed warmly as they explore the snow-blanketed terrain, capturing the essence of winter and the resilience of animals living in these conditions. #Winter Wildlife #Snowy Landscapes #Children Playing in Snow #Animal Adaptation #Winter Exploration Timeline 00:00:00 - 00:02:33 Winter Playtime 00:00:43 Children are seen playing in a snow-covered yard, building a snowman, with bare trees and a house in the background. 00:01:36 A close-up of a snow pile, possibly a snowman, is shown in a snowy landscape with bare trees and houses under a clear blue sky. 00:02:03 A person builds and adorns a snowman with a scarf in a snowy landscape, with trees and a building in the background. 00:02:25 A child in winter clothing stands near a snowman adorned with a red hat and scarf, observing the snowy surroundings with bare trees and a house. 00:02:33 - 00:06:05 Winter Forest Scenes 00:03:06 Bare trees against a wintry sky reveal the stark beauty of a forest in colder months, hinting at wildlife survival strategies. 00:06:05 A tranquil snow-covered forest shows animals adapting to the cold season, possibly seeking shelter or foraging for food. 00:06:05 - 00:07:44 Winter Forest Observations 00:06:51 A serene winter forest, blanketed in snow with bare trees, suggests a quiet natural environment where animals adapt to harsh conditions. 00:07:39 Two individuals are observing the tranquil, snow-covered forest, potentially for wildlife observation or research on animal adaptation to winter. 00:07:44 - 00:09:31 Winter Exploration 00:09:18 Two individuals in winter clothing walk through a snow-covered landscape with sparse vegetation. 2026-03-15T16:00:00.000Z yes A/V Geeks 16mm Films no 572 wintersnowwildlifechildrensnowmanforesttreesskunkdeerwinter exploration https://avgeeks.videonest.co/videos/1721286/face-of-the-earth-1975-X1egce0WFy https://img.videonest.org/gamma/1721286_thumbnail_resized_v2.webp https://gamma.videonest.org/1721286_video_v4.mp4 Face Of The Earth (1975) This film explores the dynamic geological processes that shape the Earth's surface, focusing on the immense heat within the planet as the driving force. It explains how convection currents in the mantle cause tectonic plates to move, leading to the formation of mountains through volcanic activity and the buckling of crusts. The video also touches on the erosion of mountains by rain and rivers, the deposition of sediment to form new rock layers, and the continuous cycle of mountain building and destruction. Ultimately, it highlights that the Earth's surface is constantly changing, driven by internal heat and plate tectonics, leaving us with a profound geological mystery. Keywords: Earth's surface, heat, geology, volcanoes, mountains, tectonic plates, mantle, convection currents, erosion, sediment, rock formation, earthquakes, continental drift, San Andreas fault, geological cycle 2026-03-15T04:00:00.000Z yes A/V Geeks 16mm Films no 1034 Earth's surfacegeologyvolcanoesmountainstectonic plateserosionrock formationgeological cycle https://avgeeks.videonest.co/videos/1722954/birth-of-the-savior-1952-fYoLpmazMR https://img.videonest.org/gamma/1722954_thumbnail_resized_v2.webp https://gamma.videonest.org/1722954_video_v4.mp4 Birth Of The Savior (1952) This film tells the story of the birth of Jesus Christ, set in ancient Israel under Roman occupation. Amidst oppression and longing for a prophesied Messiah, Mary is visited by an angel who tells her she will bear God's son. Despite initial turmoil for Joseph, an angel reassures him. Due to a Roman census, Mary and Joseph travel to Bethlehem, where, unable to find lodging, Jesus is born in a stable. His birth is announced by angels to shepherds, who then come to worship the newborn Savior. Keywords: Jesus Christ, Messiah, prophecy, Roman Empire, Mary, Joseph, Bethlehem, shepherds, angels, birth, savior, census, stable, manger. 2026-03-16T04:00:00.000Z yes A/V Geeks 16mm Films no 853 jesus christmessiahnativityroman empiremary and josephbethlehem https://avgeeks.videonest.co/videos/1725483/av-geeks-16mm-lunch-3-16-2026-14VHQlcUx3 https://img.videonest.org/gamma/1725483_thumbnail_resized_v2.webp https://gamma.videonest.org/1725483_video_v4.mp4 AV Geeks 16mm Lunch 3-16-2026 Probably will lose power today during the streaming show timeslot, so we've prerecorded a show about helicopters #avgeeks #16mmfilms 2026-03-16T17:00:06.000Z yes A/V Geeks 16mm Films no 3663 https://avgeeks.videonest.co/videos/1725484/park-avenue-silent-1948-8jVOKzQHwm https://img.videonest.org/gamma/1725484_thumbnail_resized_v2.webp https://gamma.videonest.org/1725484_video_v4_360.mp4 Park Avenue (silent, 1948?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Park Avenue's Architectural Grandeur 00:01:39 A towering skyscraper with intricate designs dominates the cityscape, reflecting the architectural ambition of its era. 00:03:56 A street scene features vintage cars parked along a road lined with classic apartment buildings and trees, illustrating a bygone urban atmosphere. 00:07:45 - 00:12:59 Urban Life Through a Fence 00:07:45 The video opens with a chain-link fence framing silhouetted structures against a bright sky, suggesting an urban environment. 00:08:27 A busy urban scene with vehicles and a wide road lined with trees is seen through a chain-link fence, indicating a bustling city. 00:10:29 The scene shifts to a busy urban street with pedestrians, including women with strollers, and people walking past stores. 00:12:10 Tall brick buildings are depicted behind a chain-link fence, emphasizing the urban architecture and a sense of separation. 2026-03-16T16:00:00.000Z yes A/V Geeks 16mm Films no 779 Park Avenue1940sNew York CityVintage CarsUrban LifeArchitecture16mm FilmNYC HistoryStreet Scenes https://avgeeks.videonest.co/videos/1727752/silk-makers-of-japan-1964-UPj41B-TQ4 https://img.videonest.org/gamma/1727752_thumbnail_resized_v2.webp https://gamma.videonest.org/1727752_video_v4_360.mp4 Silk Makers Of Japan (1964) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film documents the intricate process of silk production, from the feeding of silkworms with mulberry leaves to the transformation of cocoons into fine fabrics. It highlights the historical significance of silk, its journey from China to Europe, and Japan's leading role in its modern production. The Shimatsu family's farm is featured, showcasing their role in cultivating mulberry trees and raising silkworms. The documentary then follows the silk to a factory, detailing the steps of unwinding the threads, twisting them into yarn, and finally weaving the raw silk into exquisite cloth, emphasizing the blend of nature's work and human craftsmanship that makes silk the "queen of fabrics." Keywords: silk, caterpillars, silkworms, mulberry leaves, cocoons, pupa, moths, spinning, weaving, Japan, raw silk, fabrics, history, lifecycle, farm, factory, threads, yarn, craftsmanship 2026-03-17T04:00:00.000Z yes A/V Geeks 16mm Films no 938 https://avgeeks.videonest.co/videos/1731026/a-v-geeks-16mm-lunch-3-17-2026-05wL0IuRxR https://img.videonest.org/gamma/1731026_thumbnail_resized_v2.webp https://gamma.videonest.org/1731026_video_v5.mp4 A/V Geeks 16mm Lunch 3-17-2026 It's sunny outside! let's watch some 16mm films and then you can drink all the green beer you want today.. deal? #avgeeks #16mmfilms 2026-03-18T06:43:17.000Z yes A/V Geeks 16mm Films no 3923 https://avgeeks.videonest.co/videos/1731030/evolu-1974-CD0844LaeQ https://img.videonest.org/gamma/1731030_thumbnail_resized_v2.webp https://gamma.videonest.org/1731030_video_v4_360.mp4 Evolu (1974) "Evolu" explores the auditory tapestry of life through everyday sounds, showcasing abstract artworks and themes of industrialization with striking imagery. It contrasts serene nature with a military drill, highlighting human activities and emotions, culminating in a sense of unity and celebration amidst the diverse experiences of existence. 2026-03-18T04:00:00.000Z yes A/V Geeks 16mm Films no 427 experimental film16mm filmabstract artindustrializationsound designavant-garde1970s filmart filmvisual musicjohn leach https://avgeeks.videonest.co/videos/1733139/a-v-geeks-16mm-lunch-3-18-2026-imQ0lJlmnZ https://img.videonest.org/gamma/1733139_thumbnail_resized_v2.webp https://gamma.videonest.org/1733139_video_v4_360.mp4 A/V Geeks 16mm Lunch 3-18-2026 We're here! #16mmfilms and all! 2026-03-18T17:03:28.000Z yes A/V Geeks 16mm Films no 3369 16mm filmvintage filmreligiousprayerchristiansweet hour of prayerSongbook of the Screen https://avgeeks.videonest.co/videos/1733141/air-to-air-part1-silent-Qkn0VfQ7cg https://img.videonest.org/gamma/1733141_thumbnail_resized_v2.webp https://gamma.videonest.org/1733141_video_v4.mp4 Air to Air, Part1 (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Aerial Maneuvers 00:02:02 Three aircraft fly in formation, leaving distinct contrails against a clear sky, demonstrating coordinated maneuvers. 00:02:46 A high-altitude aircraft leaves distinct contrails, illustrating dynamic flight patterns and the interaction between technology and atmosphere. 00:04:29 A vintage aircraft, marked N332, flies over a mountainous landscape, highlighting its performance and aerodynamic features. 00:05:12 A sleek aircraft, also marked N332, navigates low over rugged terrain, showcasing its agility and speed against a natural backdrop. 00:06:09 - 00:21:46 Air-to-Air Maneuvers and Vintage Flight 00:06:09 The video opens with static and buzzing sounds, setting an atmospheric tone. 00:18:15 Aerial footage shows a military aircraft maneuvering dramatically over a rugged, mountainous landscape, viewed from another aircraft. 00:21:38 A vintage aircraft is then shown flying over a landscape, with the view from behind highlighting its wings and tail, emphasizing early aviation technology. 2026-03-18T16:00:00.000Z yes A/V Geeks 16mm Films no 1787 air showaerial footagevintage aircraftaviation historyflight maneuversvintage planesaircraftbiplanemilitary aircraft https://avgeeks.videonest.co/videos/1734698/effective-persuasion-1968-J3Or95WsDE https://img.videonest.org/gamma/1734698_thumbnail_resized_v2.webp https://gamma.videonest.org/1734698_video_v4.mp4 Effective Persuasion (1968) This film explores the power of persuasion in various aspects of life, from advertising and politics to social movements and everyday communication. It highlights how combining sight and sound, or employing eloquent speeches, can influence behavior and decisions. The documentary showcases historical figures like Winston Churchill, Adlai Stevenson, John F. Kennedy, and Martin Luther King Jr. as examples of masterful oratory, and then contrasts their influence with modern-day public speaking by students advocating for causes and running for office. The film emphasizes that effective persuasion relies on clear communication, strong arguments supported by evidence, and an understanding of the audience's needs and emotions, ultimately arguing that mastery of this art is crucial for gaining acceptance and understanding. Keywords: persuasion, advertising, oratory, public speaking, communication, influence, politics, social movements, historical figures, rhetoric, evidence, audience, clarity, dignity, inspiration. 2026-03-19T04:00:00.000Z yes A/V Geeks 16mm Films no 662 persuasionpublic speakingcommunicationrhetoricoratoryadvertisingpoliticsinfluenceargumentation https://avgeeks.videonest.co/videos/1735193/larynx-and-voice-physiology-of-the-larynx-under-da-OBuyjeREoS https://img.videonest.org/gamma/1735193_thumbnail_resized_v2.webp https://gamma.videonest.org/1735193_video_v4.mp4 Larynx And Voice: Physiology Of The Larynx Under Daily Stress (1958) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational documentary explores the complex mechanics of the human larynx by utilizing ultra-high-speed cinematography, capturing images at 5,000 frames per second to visualize vocal cord vibrations. Through detailed analysis of various vocal activities—ranging from ordinary speech and laughter to vocal fry and strained coughing—the film illustrates how muscle tension, airflow pressure, and structural elasticity interact during sound production. By comparing graphic data with high-speed footage, the researchers present new physiological concepts regarding the vibratory cycle, specifically highlighting how opening and closing phases shift in response to vocal intensity, pitch, and register changes. Ultimately, the study emphasizes that the larynx is a dynamic and delicate instrument subject to significant stress during daily life, and underscores how advanced imaging provides critical insights into both normal phonation and complex acoustic phenomena. Keywords: Larynx, vocal cords, high-speed cinematography, phonation, speech physiology, vocal fry, vocal register, glottal vibration, biomedical research, acoustics 2026-03-19T16:00:00.000Z yes A/V Geeks 16mm Films no 1401 https://avgeeks.videonest.co/videos/1735420/av-geeks-16mm-lunch-3-19-2026-hYQzPJsH37 https://img.videonest.org/gamma/1735420_thumbnail_resized_v2.webp https://gamma.videonest.org/1735420_video_v4_converted.mp4 AV Geeks 16mm Lunch 3-19-2026 No internet at the archive? No problem! #avgeeks #16mmfilms 2026-03-19T16:59:33.000Z yes A/V Geeks 16mm Films no 4084 https://avgeeks.videonest.co/videos/1737126/plankton-1976--NdMWPGimd https://img.videonest.org/gamma/1737126_thumbnail_resized_v2.webp https://gamma.videonest.org/1737126_video_v4.mp4 Plankton (1976) This film explores the world of plankton, the tiny, drifting organisms that form the base of the marine food web. Despite their crucial role, much about plankton remains a mystery. The documentary highlights their diversity, from microscopic plants to larval forms of larger animals, and explains how they are collected and studied. It emphasizes their importance in supporting all sea life, including humans, and concludes by noting the vast amount yet to be discovered about these essential creatures. Keywords: plankton, marine life, food web, ocean, energy, sun, organisms, plants, animals, larvae, jellyfish, diversity, research, mystery, sea, exploration 2026-03-20T04:00:00.000Z yes A/V Geeks 16mm Films no 724 https://avgeeks.videonest.co/videos/1739304/a-v-geeks-16mm-lunch-3-20-2026-xCo2HainKO https://img.videonest.org/gamma/1739304_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1739304/a-v-geeks-16mm-lunch-3-20-2026-xCo2HainKO A/V Geeks 16mm Lunch 3-20-2026 It's a Friday and we've got a lot of films to watch! Join us! #avgeeks #16mmfilms 2026-03-20T16:58:22.000Z yes A/V Geeks 16mm Films no 3769 https://avgeeks.videonest.co/videos/1739306/your-thrift-habits-2nd-1964-QqkESovG3w https://img.videonest.org/gamma/1739306_thumbnail_resized_v2.webp https://gamma.videonest.org/1739306_video_v5.mp4 Your Thrift Habits (2nd, 1964) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. In this educational film, a father mentors his son, Tony, on the principles of financial responsibility after Tony struggles to manage his allowance and loans. The father introduces the concept of "thrift" as the avoidance of waste and guides Tony through a systematic process of setting financial goals, distinguishing between fixed and flexible expenses, and tracking spending. By creating detailed charts and learning to prioritize his needs over impulse purchases, Tony begins to understand how to budget effectively to afford the things he wants. The film emphasizes that developing disciplined money-management habits is the key to achieving financial independence and successfully reaching both short-term and long-term goals. Keywords: budgeting, financial literacy, thrift, personal finance, goal setting, money management, saving, expenses, responsibility, allowance 2026-03-20T16:00:00.000Z yes A/V Geeks 16mm Films no 641 https://avgeeks.videonest.co/videos/1740238/964698 https://gamma.videonest.org/92379f6b-075d-4c95-b425-675e4e945bc8_video_v2.mp4 964698 Uploaded via SFTP ingestion 2026-03-21T15:30:22.254Z yes A/V Geeks 16mm Films no 668 https://avgeeks.videonest.co/videos/1740239/orthographicprojection1 https://gamma.videonest.org/3f0a7987-e595-43fe-891c-714a4bcd0a90_video_v2.mp4 OrthographicProjection_1 Uploaded via SFTP ingestion 2026-03-21T15:47:42.790Z yes A/V Geeks 16mm Films no 49 https://avgeeks.videonest.co/videos/1740246/earlyonemorning1 https://gamma.videonest.org/0f1b12a6-84ff-4454-a146-7be777462122_video_v2.mp4 EarlyOneMorning_1 Uploaded via SFTP ingestion 2026-03-21T15:53:00.787Z yes A/V Geeks 16mm Films no 104 https://avgeeks.videonest.co/videos/1740247/onstage1 https://gamma.videonest.org/9257fd9f-869b-4a37-a6a8-cbd4ff2be3b7_video_v2.mp4 OnStage_1 Uploaded via SFTP ingestion 2026-03-21T15:54:32.015Z yes A/V Geeks 16mm Films no 75 https://avgeeks.videonest.co/videos/1740732/i-m-a-man-1970--iBxwGokr7 https://img.videonest.org/gamma/1740732_thumbnail_resized_v2.webp https://gamma.videonest.org/1740732_video_v5.mp4 I'm A Man (1970) This documentary provides an intimate and provocative portrait of John Barber, a Black militant activist in late 1960s America who navigates the complexities of systemic racism, political struggle, and personal identity. Through candid interviews and observations, the film captures Barber’s confrontational approach to civil rights, including his symbolic use of a spear to challenge white authority and his outspoken advocacy for "pyro power" as a tool for revolutionary change. By weaving together the perspectives of Barber, his family, and the skeptical institutions of law enforcement and psychiatry, the film examines the toll of radical activism, the pursuit of Black liberation, and the deeply entrenched fears and power dynamics within a polarized society. Keywords: Black Power, activism, civil rights movement, systemic racism, radicalism, militant, New Haven, political struggle, identity, revolution 2026-03-21T16:00:00.000Z yes A/V Geeks 16mm Films no 1244 https://avgeeks.videonest.co/videos/1740733/ecomega-1972-87Qm4qLlp2 https://img.videonest.org/gamma/1740733_thumbnail_resized_v2.webp https://gamma.videonest.org/1740733_video_v5.mp4 Ecomega (1972) "Ecomega," presented by ACI Films, Inc., explores ecological themes through creative visuals. It features a magic trick, intricate drawings of a futuristic robot, and animated sketches of a feline and human figure. The film also includes an abstract scene with an intense orange background, suggesting movement and transformation. 2026-03-21T04:00:00.000Z yes A/V Geeks 16mm Films no 99 https://avgeeks.videonest.co/videos/1740939/birthofthesaviour1 https://gamma.videonest.org/17c8b25f-61a3-4f0f-8800-b8d52a0f5db0_video_v2.mp4 BirthOfTheSaviour_1 Uploaded via SFTP ingestion 2026-03-21T16:21:36.592Z yes A/V Geeks 16mm Films no 171 https://avgeeks.videonest.co/videos/1740940/bddietritecolastory1 https://gamma.videonest.org/7a5eb341-9371-4e37-9a28-d6664c6f5033_video_v2.mp4 BDDietRiteColaStory_1 Uploaded via SFTP ingestion 2026-03-21T16:21:50.464Z yes A/V Geeks 16mm Films no 165 https://avgeeks.videonest.co/videos/1740941/breathoflife1 https://gamma.videonest.org/a6bfaa11-9583-4731-ad01-31e2aa3020ce_video_v2.mp4 BreathOfLife_1 Uploaded via SFTP ingestion 2026-03-21T16:21:53.484Z yes A/V Geeks 16mm Films no 200 https://avgeeks.videonest.co/videos/1740942/argentinahorsemanofthepampas1 https://gamma.videonest.org/7de640a7-68a7-4bd8-a263-0533637c676e_video_v2.mp4 ArgentinaHorsemanOfThePampas_1 Uploaded via SFTP ingestion 2026-03-21T16:22:19.636Z yes A/V Geeks 16mm Films no 258 https://avgeeks.videonest.co/videos/1740943/bigsoundiereel1 https://avgeeks.videonest.co/videos/1740943/bigsoundiereel1 BigSoundieReel_1 Uploaded via SFTP ingestion 2026-03-21T16:24:00.002Z yes A/V Geeks 16mm Films no https://avgeeks.videonest.co/videos/1740945/childhoodofjesus1 https://gamma.videonest.org/9ebde7a0-38ab-4e91-9b60-4e3d216b1991_video_v2.mp4 ChildhoodOfJesus_1 Uploaded via SFTP ingestion 2026-03-21T16:25:02.888Z yes A/V Geeks 16mm Films no 161 https://avgeeks.videonest.co/videos/1740946/cakesbasictechniques1 https://gamma.videonest.org/44460c90-1e26-447f-90f9-e96104d39e53_video_v2.mp4 CakesBasicTechniques_1 Uploaded via SFTP ingestion 2026-03-21T16:25:44.893Z yes A/V Geeks 16mm Films no 222 https://avgeeks.videonest.co/videos/1740947/cathedralcity1 https://gamma.videonest.org/3df2feff-c8c3-4090-b11f-7db2be7d8963_video_v2.mp4 CathedralCity_1 Uploaded via SFTP ingestion 2026-03-21T16:27:47.297Z yes A/V Geeks 16mm Films no 165 https://avgeeks.videonest.co/videos/1740948/childrensemotions1 https://gamma.videonest.org/3e220c26-d3ac-4c2d-860c-3b2ed8025ba7_video_v2.mp4 ChildrensEmotions_1 Uploaded via SFTP ingestion 2026-03-21T16:28:59.154Z yes A/V Geeks 16mm Films no 251 https://avgeeks.videonest.co/videos/1740949/drvishniacsmicroscopicworld1 https://gamma.videonest.org/8ac894f1-d7af-4028-8ae6-275b4aece6ca_video_v2.mp4 DrVishniacsMicroscopicWorld_1 Uploaded via SFTP ingestion 2026-03-21T16:30:17.135Z yes A/V Geeks 16mm Films no 165 https://avgeeks.videonest.co/videos/1740950/developmentofsurfaces1 https://gamma.videonest.org/79e959f1-dea8-4ef1-9894-10334e5e8326_video_v2.mp4 DevelopmentOfSurfaces_1 Uploaded via SFTP ingestion 2026-03-21T16:30:32.926Z yes A/V Geeks 16mm Films no 184 https://avgeeks.videonest.co/videos/1740951/engineeringrobotsintelligentmachinesservingmankind1 https://gamma.videonest.org/b9944108-08e7-471d-9ebb-20cc196972e3_video_v2.mp4 EngineeringRobotsIntelligentMachinesServingMankind_1 Uploaded via SFTP ingestion 2026-03-21T16:32:27.525Z yes A/V Geeks 16mm Films no 170 https://avgeeks.videonest.co/videos/1740952/conservationofenergy1 https://gamma.videonest.org/37f7b985-63f5-454c-a0d7-2b2a236f6c33_video_v2.mp4 ConservationOfEnergy_1 Uploaded via SFTP ingestion 2026-03-21T16:32:54.440Z yes A/V Geeks 16mm Films no 320 https://avgeeks.videonest.co/videos/1740953/explosion1 https://gamma.videonest.org/a54733c6-b795-421b-b295-2813bb4930a0_video_v2.mp4 Explosion_1 Uploaded via SFTP ingestion 2026-03-21T16:35:30.514Z yes A/V Geeks 16mm Films no 232 https://avgeeks.videonest.co/videos/1740955/fishersofmen1 https://gamma.videonest.org/b062e944-0d45-4217-a6aa-2a7e3aebc248_video_v2.mp4 FishersOfMen_1 Uploaded via SFTP ingestion 2026-03-21T16:36:51.694Z yes A/V Geeks 16mm Films no 245 https://avgeeks.videonest.co/videos/1740956/godschristmasgift1 https://gamma.videonest.org/d415f7f8-6e4e-4b03-a9bd-659a7f083c64_video_v2.mp4 GodsChristmasGift_1 Uploaded via SFTP ingestion 2026-03-21T16:36:57.837Z yes A/V Geeks 16mm Films no 163 https://avgeeks.videonest.co/videos/1740957/farmersofindia1 https://gamma.videonest.org/20487913-73f6-4540-b927-015b4b4c6442_video_v2.mp4 FarmersOfIndia_1 Uploaded via SFTP ingestion 2026-03-21T16:37:04.939Z yes A/V Geeks 16mm Films no 245 https://avgeeks.videonest.co/videos/1740958/guidingthegrowthofchildren1 https://gamma.videonest.org/5c0ce8d6-8901-4275-bfc7-a1d0338bb514_video_v2.mp4 GuidingTheGrowthOfChildren_1 Uploaded via SFTP ingestion 2026-03-21T16:39:08.604Z yes A/V Geeks 16mm Films no 208 https://avgeeks.videonest.co/videos/1740960/howtheeyesfunction1 https://gamma.videonest.org/47b6606c-6a87-4ed7-af51-0968e8cf9511_video_v2.mp4 HowTheEyesFunction_1 Uploaded via SFTP ingestion 2026-03-21T16:39:42.623Z yes A/V Geeks 16mm Films no 132 https://avgeeks.videonest.co/videos/1740961/howtowitness1 https://gamma.videonest.org/d08bd341-e4c8-4187-841e-28bfd9b4ca52_video_v2.mp4 HowToWitness_1 Uploaded via SFTP ingestion 2026-03-21T16:42:51.543Z yes A/V Geeks 16mm Films no 210 https://avgeeks.videonest.co/videos/1740962/humangrowth1 https://gamma.videonest.org/fe596670-8ba5-4962-89fa-58d22a450cbf_video_v2.mp4 HumanGrowth_1 Uploaded via SFTP ingestion 2026-03-21T16:43:05.664Z yes A/V Geeks 16mm Films no 216 https://avgeeks.videonest.co/videos/1740963/inspectionofpleasurecraft1 https://gamma.videonest.org/80d7db73-8e42-4cf8-9f57-207667b581d8_video_v2.mp4 InspectionOfPleasurecraft_1 Uploaded via SFTP ingestion 2026-03-21T16:43:40.676Z yes A/V Geeks 16mm Films no 153 https://avgeeks.videonest.co/videos/1740964/ifthemailstopped1 https://gamma.videonest.org/d20eaf04-2625-47ab-9ae7-3da0ba8decfe_video_v2.mp4 IfTheMailStopped_1 Uploaded via SFTP ingestion 2026-03-21T16:43:50.101Z yes A/V Geeks 16mm Films no 160 https://avgeeks.videonest.co/videos/1740965/iceland1 https://gamma.videonest.org/2c3383d1-0bc0-4134-a6e7-59b837500d40_video_v2.mp4 Iceland_1 Uploaded via SFTP ingestion 2026-03-21T16:43:59.620Z yes A/V Geeks 16mm Films no 221 https://avgeeks.videonest.co/videos/1740966/jesusatnazarethandcapernaum1 https://gamma.videonest.org/1e7d6c54-9d1b-4837-8f7a-32087f25dccd_video_v2.mp4 JesusAtNazarethAndCapernaum_1 Uploaded via SFTP ingestion 2026-03-21T16:46:42.512Z yes A/V Geeks 16mm Films no 131 https://avgeeks.videonest.co/videos/1740967/keystothelibrary1 https://gamma.videonest.org/f5f0c227-e2a6-4f60-8885-b8d1509f2e4d_video_v2.mp4 KeysToTheLibrary_1 Uploaded via SFTP ingestion 2026-03-21T16:48:18.830Z yes A/V Geeks 16mm Films no 168 https://avgeeks.videonest.co/videos/1740968/itsherfuture1 https://gamma.videonest.org/61ea4277-5e82-4838-a348-b097a87fce7a_video_v2.mp4 ItsHerFuture_1 Uploaded via SFTP ingestion 2026-03-21T16:48:41.693Z yes A/V Geeks 16mm Films no 219 https://avgeeks.videonest.co/videos/1740969/lascauxcradleofmansart1 https://gamma.videonest.org/c7626f7b-f81e-4500-bc73-e004444f39b7_video_v2.mp4 LascauxCradleofMansArt_1 Uploaded via SFTP ingestion 2026-03-21T16:49:21.699Z yes A/V Geeks 16mm Films no 205 https://avgeeks.videonest.co/videos/1740970/liveandlearn1 https://gamma.videonest.org/ecc8c512-87de-4a3a-9ff7-378a3064b79a_video_v2.mp4 LiveAndLearn_1 Uploaded via SFTP ingestion 2026-03-21T16:50:59.857Z yes A/V Geeks 16mm Films no 150 https://avgeeks.videonest.co/videos/1740971/kyotostory1 https://gamma.videonest.org/397492c1-9261-4f88-b8cb-76085bd7b14b_video_v2.mp4 KyotoStory_1 Uploaded via SFTP ingestion 2026-03-21T16:51:15.665Z yes A/V Geeks 16mm Films no 283 https://avgeeks.videonest.co/videos/1740972/lordisrisenthe1 https://gamma.videonest.org/15166cde-1707-4244-8fc5-11520e30ab94_video_v2.mp4 LordIsRisenThe_1 Uploaded via SFTP ingestion 2026-03-21T16:52:21.954Z yes A/V Geeks 16mm Films no 144 https://avgeeks.videonest.co/videos/1740974/microorganismsbeneficialactivities1 https://gamma.videonest.org/617d6ceb-df83-437b-9c22-6698a4c1ad8a_video_v2.mp4 MicroOrganismsBeneficialActivities_1 Uploaded via SFTP ingestion 2026-03-21T16:53:56.855Z yes A/V Geeks 16mm Films no 173 https://avgeeks.videonest.co/videos/1740975/manyroads1 https://gamma.videonest.org/feb59dbf-b67b-4840-a2d8-ff2570e1e453_video_v2.mp4 ManyRoads_1 Uploaded via SFTP ingestion 2026-03-21T16:54:18.677Z yes A/V Geeks 16mm Films no 210 https://avgeeks.videonest.co/videos/1740991/moderndancetechniqueinsequentialform1 https://gamma.videonest.org/7336c159-c5ca-4f47-9372-be986bc0c7d6_video_v2.mp4 ModernDanceTechniqueInSequentialForm_1 Uploaded via SFTP ingestion 2026-03-21T16:55:15.618Z yes A/V Geeks 16mm Films no 141 https://avgeeks.videonest.co/videos/1740993/norironbarsacage1 https://gamma.videonest.org/6a594021-1ad8-41fe-8785-612f3d1a0313_video_v2.mp4 NorIronBarsACage_1 Uploaded via SFTP ingestion 2026-03-21T16:55:24.615Z yes A/V Geeks 16mm Films no 92 https://avgeeks.videonest.co/videos/1740994/mountainfarmersswitzerland1 https://gamma.videonest.org/816083b3-4bb7-41d4-a423-07b8f928af81_video_v2.mp4 MountainFarmersSwitzerland_1 Uploaded via SFTP ingestion 2026-03-21T16:56:33.889Z yes A/V Geeks 16mm Films no 174 https://avgeeks.videonest.co/videos/1740995/portraitofsanta1 https://gamma.videonest.org/0217a0e5-d67a-430a-b9d1-7071dadada51_video_v2.mp4 PortraitOfSanta_1 Uploaded via SFTP ingestion 2026-03-21T16:56:44.138Z yes A/V Geeks 16mm Films no 83 https://avgeeks.videonest.co/videos/1743485/analyzingsportswithfilmuhd1 https://gamma.videonest.org/f16c865c-76a9-47b8-a726-dcb986c2f8f6_video_v2.mp4 AnalyzingSportsWithFilmUHD_1 Uploaded via SFTP ingestion 2026-03-22T12:59:31.969Z yes A/V Geeks 16mm Films no 142 https://avgeeks.videonest.co/videos/1745171/negro-colleges-in-war-time-1943-3mYEL7uj46 https://img.videonest.org/gamma/1745171_thumbnail_resized_v2.webp https://gamma.videonest.org/1745171_video_v5_360.mp4 NEGRO COLLEGES IN WAR TIME(1943) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Showcases how American colleges are adapting their educational programs to support the war effort. Tuskegee Institute is highlighted for its commitment to training specialists and contributing to scientific advancements crucial for wartime needs. Prairie View, a Texas state college, is actively preparing students for technical roles in industrial and military service, focusing on practical skills necessary for both agriculture and manufacturing sectors. Howard University in Washington D.C. has expanded its curriculum by adding new war training courses while emphasizing existing ones to equip students for war-related jobs. Similarly, Hampton Institute in Virginia plays a vital role by training hundreds of war workers and foreign students through specialized programs. Students at Hampton Institute are engaged in skilled mechanical training and production of war materials. The agriculture department has introduced a farm management course for women and is conducting research on soybean nutrition to aid wartime conservation efforts. Additionally, Hampton contributes to the war effort through radio programs and specialized training for military personnel, while the armed forces utilize its facilities, further solidifying the college's role in supporting the nation's needs during this critical time. #WarEffort #Education #TuskegeeInstitute #HamptonInstitute #TechnicalTraining 2026-03-22T16:00:00.000Z yes A/V Geeks 16mm Films no 515 HBCUTuskegee InstitutePrairie ViewHoward UniversityHampton InstituteWorld War IIWar EffortAfrican American EducationTechnical Training1940s16mm film https://avgeeks.videonest.co/videos/1745173/why-we-use-money-the-fisherman-who-needed-a-knife-rA10QU9qpM https://img.videonest.org/gamma/1745173_thumbnail_resized_v2.webp https://gamma.videonest.org/1745173_video_v5_360.mp4 Why We Use Money: The Fisherman Who Needed A Knife (1970) This story tells the tale of a fisherman who needs a new knife to cut himself free, but has no money. He attempts to trade his freshly caught fish for a knife from the knife maker, who instead wants a hat. This leads the fisherman on a circular journey of trades: a fish for a hat from the hat maker, who wants bread; bread from the baker, who wants a pot; and finally a pot from the potter. After a series of exchanges, the fisherman obtains the pot, trades it for bread, the bread for a hat, and the hat for the knife. This experience sparks a conversation with the knife maker, leading them to propose the idea of a universal medium of exchange – coins – to simplify trade for everyone in the village, which eventually evolves into the modern monetary system. Keywords: fisherman, trade, fish, knife, hat, bread, pot, coins, money, barter, village, exchange, value 2026-03-22T04:00:00.000Z yes A/V Geeks 16mm Films no 460 bartertrademoneycoinsfishermanknifemakerhatmakerpotterexchange1970sanimation https://avgeeks.videonest.co/videos/1745174/roy-wilkins-the-right-to-dignity-Zy-zv9xGxP https://img.videonest.org/gamma/1745174_thumbnail_resized_v2.webp https://gamma.videonest.org/1745174_video_v5_360.mp4 Roy Wilkins: The Right To Dignity This film chronicles the significant role of the National Association for the Advancement of Colored People (NAACP) and its long-time leader, Roy Wilkins, in the American Civil Rights Movement. It highlights the NAACP's founding principles of racial integration and its sustained efforts through legal challenges, public demonstrations, and legislative advocacy to dismantle segregation and discrimination. The narrative emphasizes key victories, such as the landmark Brown v. Board of Education decision, and the impact of events like the March on Washington, underscoring the organization's commitment to achieving full equality for African Americans. Keywords: NAACP, Roy Wilkins, Civil Rights Movement, segregation, integration, racial equality, discrimination, Brown v. Board of Education, March on Washington, legislative advocacy, legal challenges, human rights, United States, African Americans. 2026-03-22T04:00:00.000Z yes A/V Geeks 16mm Films no 1250 Roy WilkinsNAACPCivil Rights Movementracial equalitysegregationBrown v Board https://avgeeks.videonest.co/videos/1747019/a-v-geeks-16mm-lunch-3-23-2026-N2l-0PE3nR https://img.videonest.org/gamma/1747019_thumbnail_resized_v2.webp https://gamma.videonest.org/1747019_video_v5_360.mp4 A/V Geeks 16mm Lunch 3-23-2026 There's 16mm films to be watched! #avgeeks #16mmfilms 2026-03-23T17:00:05.000Z yes A/V Geeks 16mm Films no 3759 https://avgeeks.videonest.co/videos/1747021/the-end-of-one-1970-bXF4Fb8aFQ https://img.videonest.org/gamma/1747021_thumbnail_resized_v2.webp https://gamma.videonest.org/1747021_video_v5_360.mp4 The End of One (1970) The film explores the delicate balance of life through the lens of birds in various environments, from vibrant urban scenes to serene beaches. It juxtaposes the beauty of their interactions with the stark reality of loss, as seen in a lifeless bird on the shore, highlighting environmental concerns and the fragility of existence. 2026-03-23T04:00:00.000Z yes A/V Geeks 16mm Films no 390 birdsenvironment16mm filmnatureurbanbeachfragility of lifeenvironmental concernslosssea birds https://avgeeks.videonest.co/videos/1748761/dr-vishniac-s-microscopic-world-1950s-cHCc1KMp1X https://img.videonest.org/gamma/1748761_thumbnail_resized_v2.webp https://gamma.videonest.org/1748761_video_v5_360.mp4 [Dr Vishniac's Microscopic World, 1950s] This documentary follows Dr. Roman Vishnak, a scientist and philosopher renowned for his photography of the microscopic world. Through specialized equipment and intricate lighting, Dr. Vishnak captures the beauty and complexity of life in a single drop of water, from ancient flagellates to intricate shrimp and hydra, emphasizing the importance of observing living creatures in their natural state. He explores both freshwater and marine environments, revealing the hidden lives of organisms like mollusks, cyclops, and bristle worms, all while advocating for their respectful treatment and return to their habitats. Keywords: Microscopic life, photography, Dr. Roman Vishnak, zoology, marine biology, pond water, ocean organisms, magnification, living specimens, scientific exploration 2026-03-24T04:00:00.000Z yes A/V Geeks 16mm Films no 848 https://avgeeks.videonest.co/videos/1751782/a-v-geeks-16mm-lunch-3-24-2026-GZBJH-e8j0 https://img.videonest.org/gamma/1751782_thumbnail_resized_v2.webp https://gamma.videonest.org/1751782_video_v5_360.mp4 A/V Geeks 16mm Lunch 3-24-2026 Skip's feeling poorly today. Enjoy these TV commercials! #avgeeks #16mmfilms 2026-03-24T16:00:21.000Z yes A/V Geeks 16mm Films no 8159 vintage commercialsTV adsTexacoCrest toothpasteCharminSara LeePampers diapersMaxwell House CoffeeGravy Train dog foodContinental AirlinesParliament cigarettesPost cereal1960s1970sdog food https://avgeeks.videonest.co/videos/1753771/kundah-dam-1950s-Q7fnHzZX_S https://img.videonest.org/gamma/1753771_thumbnail_resized_v2.webp https://gamma.videonest.org/1753771_video_v5.mp4 Kundah Dam (1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This archival film documents the extensive construction and industrial operations involved in large-scale hydroelectric and pipeline projects set in rugged mountainous terrain. It begins with views of the Kundah hydroelectric dam and power station, followed by detailed scenes of transporting and installing massive industrial pipes and equipment using heavy machinery, cranes, and rail systems. The footage captures the challenging logistics of moving oversized components through winding mountain roads and snowy conditions, as well as the skilled manual labor and precision welding required to assemble the infrastructure. The film concludes with sweeping views of the completed pipeline installations and a corporate logo, highlighting the scale and complexity of mid-20th century industrial engineering projects. 2026-03-25T04:00:00.000Z yes A/V Geeks 16mm Films no 580 https://avgeeks.videonest.co/videos/1758092/a-v-geek-16mm-lunch-3-26-2026-5yWpe94Dv7 https://img.videonest.org/gamma/1758092_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1758092/a-v-geek-16mm-lunch-3-26-2026-5yWpe94Dv7 A/V Geek 16mm Lunch 3-26-2026 It's another day of glorious 16mm films! #avgeeks #16mmfilms 2026-03-26T16:59:41.000Z yes A/V Geeks 16mm Films no 3787 16mm filmAV GeeksSkip Elsheimervandalismeducational filmNepalese tea workerHimalayastea harvestnutritionfoodmicrophone techniquespublic speakinghealthy eatingbalanced dietvintage film https://avgeeks.videonest.co/videos/1758095/black-music-in-america-from-then-till-now-1973-jEox9WdnTg https://img.videonest.org/gamma/1758095_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1758095/black-music-in-america-from-then-till-now-1973-jEox9WdnTg Black Music In America - From Then Till Now (1973) This documentary explores the historical evolution and profound cultural impact of Black music in America, tracing its origins from African rhythms and the traumatic experience of the plantation system to its emergence as a cornerstone of American identity. Through the lens of various genres—including spirituals, blues, ragtime, jazz, swing, and R&B—the film illustrates how Black artists transformed pain, struggle, and resilience into a powerful artistic legacy. Featuring influential figures such as Louis Armstrong, Mahalia Jackson, Bessie Smith, Duke Ellington, and Nina Simone, the narrative highlights how this music served as both a refuge from systemic oppression and a bridge toward social change, ultimately evolving from a suppressed cultural expression into the dominant influence on the American musical landscape. Keywords: Black music, African American history, Jazz, Blues, Spirituals, Cultural identity, Slavery, Music history, Civil rights, American culture, Musical innovation 2026-03-26T16:00:00.000Z yes A/V Geeks 16mm Films no 1704 https://avgeeks.videonest.co/videos/1758098/screen-news-digest-struggle-of-women-s-rights-1972-kZixt-eu7F https://img.videonest.org/gamma/1758098_thumbnail_resized_v2.webp https://gamma.videonest.org/1758098_video_v5_360.mp4 Screen News Digest: Struggle Of Women's Rights (1972) This educational film documents the history of the women’s rights movement in the United States, tracing the journey from the early suffrage efforts led by figures like Susan B. Anthony to the contemporary women’s liberation movement of the 1970s. It highlights key milestones, including the ratification of the 19th Amendment, the entry of women into the workforce during World War II, and the breaking of gender barriers in politics, sports, and aviation. Alongside archival footage of pioneers and activists, the film captures the evolving public sentiment toward gender equality, contrasting traditional domestic roles with the growing demand for social, economic, and political parity. Keywords: Women’s Suffrage, Women’s Liberation, 19th Amendment, Gender Equality, Feminism, American History, Politics, Civil Rights, Workplace Equality, Screen News Digest 2026-03-26T16:00:00.000Z yes A/V Geeks 16mm Films no 839 https://avgeeks.videonest.co/videos/1758101/a-v-geeks-16mm-lunch-3-25-2026-h3beDS1FJx https://img.videonest.org/gamma/1758101_thumbnail_resized_v2.webp https://gamma.videonest.org/1758101_video_v5.mp4 A/V Geeks 16mm Lunch 3-25-2026 We're back and showing films! Now on steroids! #avgeeks #16mmfilms 2026-03-26T06:18:35.000Z yes A/V Geeks 16mm Films no 3737 https://avgeeks.videonest.co/videos/1758104/how-to-be-a-friend-1977-hE-fnfx09C https://img.videonest.org/gamma/1758104_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1758104/how-to-be-a-friend-1977-hE-fnfx09C How To Be A Friend (1977) This film explores the multifaceted nature of friendship, emphasizing that it is built on sharing, trust, and mutual respect. It highlights the importance of making the first move to form new connections, being understanding of differences, and offering support. The film also delves into the effort required to maintain friendships, whether through staying in touch with distant friends, respecting privacy, or understanding when to let go. Ultimately, it defines friendship as an active, growing process that involves being truthful, patient, and sensitive, and that requires continuous effort to nurture. Keywords: friendship, sharing, trust, respect, making friends, keeping friends, understanding, support, communication, honesty, patience, growth, connection 2026-03-26T04:00:00.000Z yes A/V Geeks 16mm Films no 712 friendshipmaking friendssocial skillstrustrespectsharingvintage education https://avgeeks.videonest.co/videos/1767084/theater-in-shakespeare-s-time-1973-0083R7R3wW https://img.videonest.org/gamma/1767084_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1767084/theater-in-shakespeare-s-time-1973-0083R7R3wW Theater In Shakespeare's Time (1973) This film explores the vibrant and evolving Elizabethan theater scene, from the itinerant acting troupes of the 1560s performing morality plays to the grander playhouses of London like The Globe. It highlights the simple staging, the direct audience engagement, and the shift towards historical and mythological dramas penned by playwrights like Shakespeare and Marlowe, while also touching upon the challenges faced from Puritan authorities and the ultimate appeal of these performances for both commoners and nobility. Keywords: Elizabethan theater, acting troupes, morality plays, Shakespeare, Marlowe, portable stage, audience participation, Puritanism, public theaters, The Globe, Macbeth, Dr. Faustus, historical drama, spectacle, exuberance. 2026-03-27T04:00:00.000Z yes A/V Geeks 16mm Films no 870 https://avgeeks.videonest.co/videos/1768092/a-v-geeks-16mm-lunch-3-27-2026-kJ_Bni75mm https://img.videonest.org/gamma/1768092_thumbnail_resized_v2.webp https://gamma.videonest.org/1768092_video_v5_360.mp4 A/V Geeks 16mm Lunch 3-27-2026 Getting that tingling feeling that it's time to watch some classic 16mm films! Or is that my pinched nerve? #avgeeks #16mmfilms 2026-03-27T16:54:12.000Z yes A/V Geeks 16mm Films no 4088 https://avgeeks.videonest.co/videos/1768093/community-helpers-school-workers-1980-kPnmL4VgfE https://img.videonest.org/gamma/1768093_thumbnail_resized_v2.webp https://gamma.videonest.org/1768093_video_v5_360.mp4 Community Helpers: School Workers (1980) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film explores the interconnected roles within a community and the foundational importance of schooling. Through a thought experiment where children teach adults, the narrative illustrates that while adults possess diverse skills necessary for society to function—such as medicine, engineering, and trade—these skills are built upon the fundamental education received during childhood. The film highlights how teachers and school staff (including principals, nurses, and custodians) dedicate their careers to fostering an environment where children can develop the essential literacy, mathematics, and critical thinking skills required to pursue any future profession. Ultimately, it emphasizes that education is a reciprocal social contract that prepares the next generation to contribute to the community's continued growth and success. Education, Community, Career, Teachers, School Staff, Future Aspirations, Learning, Social Roles, Development, Public Schools 2026-03-27T16:00:00.000Z yes A/V Geeks 16mm Films no 722 school workersteacherseducation1980scommunity helpersschool staffclassroom https://avgeeks.videonest.co/videos/1771603/unlock-true-friendship-secrets-hopes-and-doubts-re-6dfAW4Ups5 https://img.videonest.org/gamma/1771603_thumbnail_resized_v2.webp https://gamma.videonest.org/1771603_video_v5_360.mp4 Unlock True Friendship: Secrets, Hopes, and Doubts Revealed #shorts Friendship opens doors to new perspectives and knowledge. Don't let excuses limit your connections. Be open to meeting new people – you might be surprised by the friends you make and what you learn. #Friendship #NewConnections #PersonalGrowth #Learning 2026-03-28T17:20:02.000Z yes A/V Geeks 16mm Films no 148 friendshipmaking friendspersonal growthnew connectionssocial skillsrelationships https://avgeeks.videonest.co/videos/1771604/teacher-can-t-teach-this-kid-has-the-answer-shorts-S2O7Q3j778 https://img.videonest.org/gamma/1771604_thumbnail_resized_v2.webp https://gamma.videonest.org/1771604_video_v5_360.mp4 Teacher Can't Teach?! This Kid Has the Answer! #shorts A teacher feels unqualified, but a young student reminds her it's just a game. "Let the adults go!" he exclaims, showing that sometimes, a child's perspective is all you need. #TeacherLife #StudentWisdom #LearningMoments #Perspective #Classroom 2026-03-28T16:49:44.000Z yes A/V Geeks 16mm Films no 18 https://avgeeks.videonest.co/videos/1771605/school-nurse-the-unsung-hero-of-student-health-sho-qAon_41SRz https://img.videonest.org/gamma/1771605_thumbnail_resized_v2.webp https://gamma.videonest.org/1771605_video_v5_360.mp4 School Nurse: The Unsung Hero of Student Health! #shorts From scraped knees to serious concerns, your school nurse is the first line of defense for student well-being. They're vital for keeping kids healthy and safe at school. #SchoolNurse #StudentHealth #HealthcareHeroes #Education 2026-03-28T16:47:26.000Z yes A/V Geeks 16mm Films no 19 https://avgeeks.videonest.co/videos/1771606/what-time-is-it-in-tokyo-1971-lP8MOnDaFe https://img.videonest.org/gamma/1771606_thumbnail_resized_v2.webp https://gamma.videonest.org/1771606_video_v5_360.mp4 What Time Is It In Tokyo? (1971) This film provides an educational explanation of how time zones and the International Date Line function, using the contrast between Tokyo and North America to illustrate the impact of the Earth's rotation on our daily schedules. By examining the history of timekeeping—from the primitive observation of the sun to the implementation of 24 standardized time zones—the narrator demonstrates why clocks must be adjusted when traveling. The film further explores the complexities of calendar dates, explaining how crossing the International Date Line necessitates adjusting days to keep global time synchronized, ultimately concluding that adhering to the sun's position remains the most practical method for organizing human activity. Time zones, International Date Line, Earth’s rotation, timekeeping, longitude, global synchronization, education, geography, sun cycles, calendars 2026-03-28T16:00:00.000Z yes A/V Geeks 16mm Films no 788 time zonesinternational date lineearth rotationtimekeepinglongitudegeography educationsun cycles1970s https://avgeeks.videonest.co/videos/1771607/where-we-get-our-goods-and-services-1967-QMn72YU-h6 https://img.videonest.org/gamma/1771607_thumbnail_resized_v2.webp https://gamma.videonest.org/1771607_video_v5_360.mp4 Where We Get Our Goods And Services (1967) This film follows Susie and her family as they move into a new neighborhood and explore the various goods and services available to them. They discover that essential utilities like gas, electricity, and telephone service are brought directly to their home by specialized companies. For their daily needs, they visit a local shopping center with various privately owned businesses, including a supermarket where they purchase food. The film highlights how these businesses operate, emphasizing the concept of profit, which is the difference between their expenses and their revenue. It also touches upon specialized services, like carpet cleaning, and concludes by suggesting that a city can provide not only material needs but also opportunities for new friendships. Keywords: goods and services, neighborhood, utilities, gas, electricity, telephone, mail, shopping center, private businesses, profit, supermarket, food, wages, expenses, revenue, specialized services, community, city. 2026-03-28T04:00:00.000Z yes A/V Geeks 16mm Films no 497 https://avgeeks.videonest.co/videos/1775320/new-north-africa-1964-DHmWcCmE-E https://img.videonest.org/gamma/1775320_thumbnail_resized_v2.webp https://gamma.videonest.org/1775320_video_v5_360.mp4 New North Africa (1964) This documentary explores the dual identity of North Africa, focusing on Tunisia as a case study of a nation transitioning from its ancient colonial roots to a modern, self-governing state. It highlights the stark contrasts between the region's historical influences—including Roman architecture, agricultural foundations, and the spread of Islam—and its contemporary push toward democratic governance, education for women, and economic development. Through the leadership of figures like President Habib Bourguiba, Tunisia serves as an example of a developing country balancing its rich heritage of nomadic traditions and religious customs with the urgent needs of a young, growing population and the modernization of its mining and agricultural industries. North Africa, Tunisia, Morocco, Algeria, independence, history, Islam, modernization, agriculture, Roman Empire, government, Habib Bourguiba, education, culture, development. 2026-03-29T16:00:00.000Z yes A/V Geeks 16mm Films no 922 TunisiaNorth AfricaIslamRoman EmpireHabib Bourguibadocumentary https://avgeeks.videonest.co/videos/1775323/ishi-in-two-worlds-1967-sjjxSq2nkI https://img.videonest.org/gamma/1775323_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1775323/ishi-in-two-worlds-1967-sjjxSq2nkI Ishi In Two Worlds (1967) The film "Ishi In Two Worlds" chronicles the life of Ishi, the last known member of the Yahi tribe, who emerged from hiding in 1911 after his people were nearly wiped out by gold prospectors and settlers. Fleeing persecution, Ishi's band lived in seclusion for decades until he was discovered alone and destitute. He was brought to the University of California, where he lived out his days at the Museum of Anthropology, sharing his culture and skills with the outside world while grappling with the loss of his people and the profound changes in society. Keywords: Ishi, Yahi Indians, Northern California, Mount Lassen, prospectors, massacre, assimilation, anthropology, museum, culture, last survivor, Native American history 2026-03-29T04:00:00.000Z yes A/V Geeks 16mm Films no 1110 IshiYahi IndiansNative AmericanCaliforniaAnthropologyCultural HistoryMount LassenMuseum https://avgeeks.videonest.co/videos/1775324/friendship-the-power-of-trust-and-respect-shorts-8tPPAwxr_N https://img.videonest.org/gamma/1775324_thumbnail_resized_v2.webp https://gamma.videonest.org/1775324_video_v5_360.mp4 Friendship: The Power of Trust and Respect #shorts Friendship thrives on trust and respect. One person shares their composition, seeking honest feedback, highlighting the mutual support that deepens bonds. #Friendship #Trust #Respect #PersonalGrowth 2026-03-28T23:21:48.000Z yes A/V Geeks 16mm Films no 47 friendshiptrustrespectpersonal growthfeedbackcommunicationhonest opinion https://avgeeks.videonest.co/videos/1778109/it-s-her-future-1978-HuYb5zT-Am https://img.videonest.org/gamma/1778109_thumbnail_resized_v2.webp https://gamma.videonest.org/1778109_video_v5_360.mp4 It's Her Future (1978) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary highlights the growing participation of women in vocational and technical education, challenging traditional gender roles in the workforce. It showcases young women pursuing diverse careers such as plumbing, welding, auto mechanics, and engineering, supported by their families and educational institutions. The film emphasizes that vocational training equips students with practical skills and knowledge, preparing them for fulfilling careers and personal independence, while also demonstrating the increasing demand for female workers in non-traditional fields. Keywords: vocational education, women in trades, technical schools, career choices, gender roles, workforce, independence, skill development, non-traditional careers, female students. 2026-03-30T04:00:00.000Z yes A/V Geeks 16mm Films no 1096 vocational educationwomen in tradestechnical schoolscareer choicesgender rolesworkforcefemale studentswomen workers https://avgeeks.videonest.co/videos/1778593/desert-trek-1976-nzhvAqBKDI https://img.videonest.org/gamma/1778593_thumbnail_resized_v2.webp https://gamma.videonest.org/1778593_video_v5_360.mp4 Desert Trek (1976) This film follows a group of children led by an adult named Mr. Oke (William Christopher from M.A.S.H.) on a desert field trip meant to be an educational science project. The excursion takes a harrowing turn when Mr. Oke becomes incapacitated, potentially due to a medical emergency, leaving the children lost and disoriented in the harsh desert heat. As tensions rise and resources—specifically candy bars needed for a diabetic member of the group—disappear, the children struggle with panic, blame, and the burden of leadership. The narrative captures their chaotic attempt to navigate the dunes using an unreliable compass while grappling with the realization that they must act quickly to save their mentor and themselves before the extreme environment becomes fatal. Keywords: Desert, survival, field trip, crisis, leadership, navigation, medical emergency, youth, dunes, uncertainty 2026-03-30T16:00:00.000Z yes A/V Geeks 16mm Films no 1069 desertsurvivalfield tripyouthcrisis https://avgeeks.videonest.co/videos/1779796/av-geeks-16mm-lunch-3-30-2026-Vh4_eOmXZM https://img.videonest.org/gamma/1779796_thumbnail_resized_v2.webp https://gamma.videonest.org/1779796_video_v5_360.mp4 AV Geeks 16mm Lunch 3 30 2026 It's lunchtime, there's 16mm films to be watched! Join us! #avgeeks #16mmfilms 2026-03-30T16:00:06.000Z yes A/V Geeks 16mm Films no 3409 https://avgeeks.videonest.co/videos/1780518/tropical-lowland-brazil-amazon-lowland-EuoWmxfb83 https://img.videonest.org/gamma/1780518_thumbnail_resized_v2.webp https://gamma.videonest.org/1780518_video_v5_360.mp4 Tropical Lowland: Brazil, Amazon Lowland Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the Amazon River, its vast tropical rainforest, and the lives of the people who inhabit this region. It details the river's immense scale, the challenges of the environment such as constant humidity and seasonal flooding, and the unique ways locals have adapted to survive. The documentary highlights various natural resources like Brazil nuts, rubber, and jute, and the traditional methods of harvesting and processing them. It also portrays the importance of the river as a transportation highway and the daily lives of families, including their fishing, farming of crops like manioc, and use of natural materials for tools and clothing, ultimately showcasing the resilience and resourcefulness of Amazonian communities. Keywords: Amazon River, rainforest, South America, tropical lowland, Atlantic Ocean, tributaries, Brazil, width, islands, network of rivers, impenetrable, hot, humid, dry season, rainy season, floods, vegetation, minerals, topsoil, rainforest plants, long roots, short roots, food crops, green desert, travel by water, canoe, streams, jungle, sunlight, trees, Rosewood, perfume, vines, Brazil nut trees, valuable crop, rubber trees, latex, crude rubber, rubber shoes, Joot, cash crop, manok, cassava, cacao trees, plantations, chocolate factories, highway, scattered settlements, market towns, launches, canoes, monkeys, pets, damp climate, rest, shelters, homes, raised on posts, flooded fields, descendants, South American Indians, Portugal, Europe, Africa, Amarodas family, hammocks, boardwalks, cookhouse, stove, coffee, fishing trip, Amazon cod, salted fish, beef, milk, meat, cattle, grazing, higher land, household utensils, gourds, drinking water, cooking, manok meal, flour, peeled roots, shredded, kneaded, trough, hollow tree, tapioca, fermented, braided tube, poisonous juices, purified, food value, wood fire, roasted, rice, beans, bread, potatoes, fishing nets, sewing machines, trading post, cotton cloth, dresses, iron, charcoal, firewood, fuel, trading posts, stockpiles, steamboats, cargo, flour, salt, cloth, guns, ammunition, alligator skins, Amazon basin, floating docks, stationary peers, Manau, shipping port, frontier trading post, prosperity, rubber plantations, Malaya, Dutch East Indies, busy port, collected, shipped away, tropical woods, rope, brooms, freight, ships, overhead cables, piers, river level, hardships, transportation, unhealthy climate, northern Brazil. 2026-03-31T04:00:00.000Z yes A/V Geeks 16mm Films no 1223 https://avgeeks.videonest.co/videos/1780519/caller-1976-Qm8U7SrGwJ https://img.videonest.org/gamma/1780519_thumbnail_resized_v2.webp https://gamma.videonest.org/1780519_video_v5_360.mp4 Caller (1976) The film describes a square dancing event, detailing various calls and figures performed by participants. It also includes a personal anecdote from a caller about how they began their career, observations on the social inclusivity of square dancing, and its historical roots. The session features traditional fiddle tunes and aims to provide a fun, leisure activity for people of all backgrounds. Keywords: Square dancing, caller, figures, calls, partners, corners, promenade, swing, do-si-do, Virginia reel, folk dance, fiddle tune, Soldiers Joy, history, leisure activity, inclusivity 2026-03-31T04:00:00.000Z yes A/V Geeks 16mm Films no 1058 square dancingcallerfolk dancefiddle tuneVirginia reel1976leisure activityinclusive https://avgeeks.videonest.co/videos/1783046/a-v-geeks-16mm-lunch-3-31-2026-2Zoti9lAPq https://img.videonest.org/gamma/1783046_thumbnail_resized_v2.webp https://gamma.videonest.org/1783046_video_v5_360.mp4 A/V Geeks 16mm Lunch 3-31-2026 16mm films delivered hot and fresh to your home and office! #avgeeks #16mmfilms 2026-03-31T16:00:06.000Z yes A/V Geeks 16mm Films no 3755 https://avgeeks.videonest.co/videos/1783047/jerusalem-middle-eastern-women-KJtc6JXR8g https://img.videonest.org/gamma/1783047_thumbnail_resized_v2.webp https://gamma.videonest.org/1783047_video_v5_360.mp4 [Jerusalem Middle Eastern Women] A segment from vintage black-and-white documentary or educational film, likely from the 1950s–60s, depicting life in Jerusalem and the surrounding region. The footage has the characteristic grain and contrast of 16mm film stock. Visual breakdown by timestamp: ~0:03 — Gray/grainy film leader, typical of old 16mm reels being transferred to video. ~0:10 — A sweeping elevated or aerial-style wide shot of a Middle Eastern cityscape. Low white stone buildings stretch across a hillside under a dramatic cloudy sky. Circular ornamental gardens/fountains are visible in a courtyard below, and the surrounding landscape is arid and hilly. ~0:20 — Ground-level shot of a rough, dry-stone wall in the foreground with simple white stone structures behind it — a quiet, sparse neighborhood or village scene. ~0:32 — Camera looking through a large stone archway/tunnel into a lively, crowded marketplace (souk). Figures in traditional dress — women in headscarves, children — mill about in the bright alleyway framed by the dark arch. ~0:45 — Extreme close-up of ancient carved text or inscription chiseled into rough stone — possibly Hebrew, Arabic, or Aramaic script. A wall relief or historical marker of some kind. ~0:57 — A close portrait shot of a woman in a traditional white head covering, bent forward tending to crops in a field. Agricultural labor, shot with dramatic overhead lighting. ~1:08 — A narrow stone alleyway in an ancient city (almost certainly Jerusalem's Old City). Overhanging structures of pale stone line both sides; several women in traditional dress walk away from the camera down the lane. ~1:16 — A man's hands in close-up, working on some form of traditional craft or trade — appears to be leatherwork or carpentry, bent over a low workbench. 2026-03-31T16:00:00.000Z yes A/V Geeks 16mm Films no 79 JerusalemMiddle East16mm filmvintageold footagedocumentaryIsraelOld Citywomensoukmarket https://avgeeks.videonest.co/videos/1785591/this-1950s-bike-safety-film-eliminated-its-entire-T3TV3KYjsm https://img.videonest.org/gamma/1785591_thumbnail_resized_v2.webp https://gamma.videonest.org/1785591_video_v5_360.mp4 This 1950s Bike Safety Film Eliminated Its Entire Cast One by One Ten friends. Ten bikes. Ten completely avoidable disasters. This vintage cycling safety film takes a delightfully ruthless approach to public safety education: introduce a cast of characters, give each one a specific, infuriating bad habit, and then systematically let the consequences find them. No signals. Red lights ignored. Wrong side of the road. Brakes that haven't been looked at since Eisenhower. One by one, they drop off. What makes this film so watchable — and so weirdly satisfying — is how fair it is. Nobody gets taken out by bad luck or an unforeseen circumstance. Every single mishap is earned. Completely, entirely, 100% deserved. And somewhere at the end of a long road, one very smug friend sits alone at a picnic, having signaled every turn and maintained their bicycle properly, silently victorious over the wreckage of their social life. 🚲 Be the picnic friend. 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T12:00:00.000Z yes A/V Geeks 16mm Films no 920 https://avgeeks.videonest.co/videos/1785592/a-little-girl-won-t-eat-breakfast-the-reason-why-w-3z8Bsx_-xt https://img.videonest.org/gamma/1785592_thumbnail_resized_v2.webp https://gamma.videonest.org/1785592_video_v5_360.mp4 A Little Girl Won't Eat Breakfast. The Reason Why Will Break Your Heart. It starts as a simple question: why won't Cathy eat breakfast? Maybe she doesn't like the food. Maybe she's not hungry. Simple enough, right? But the more the interviewer digs — into her food preferences, her home life, her mother's early work schedule, the siblings she doesn't have — the more you realize this was never really about breakfast. And the more Cathy retreats, the more the camera catches something the filmmakers may not have fully intended: a little girl carrying a weight that nobody has quite found the right words for yet. This vintage child psychology film is a fascinating and quietly devastating time capsule — a window into how adults of the era tried to understand children's emotional lives, armed with the best tools they had, which weren't always quite enough. Cathy never really answers the question. But by the end, you understand it completely. 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T10:00:00.000Z yes A/V Geeks 16mm Films no 267 https://avgeeks.videonest.co/videos/1785593/the-spark-you-can-t-see-is-the-one-that-blows-ever-8yzzJkyhYD https://img.videonest.org/gamma/1785593_thumbnail_resized_v2.webp https://gamma.videonest.org/1785593_video_v5_360.mp4 The Spark You Can't See Is the One That Blows Everything Up You've felt it a thousand times. A little zap. A shock from a doorknob. Static cling on your sweater. Harmless, right? Wrong. Embarrassingly, dangerously wrong. This vintage scientific film takes what you've dismissed your entire life as a minor annoyance and methodically reveals it for what it actually is: an invisible ignition source capable of turning an ordinary room into a fireball, given the right conditions. And the conditions are more common than you think. Falling liquids generate it. Solids rubbing together generate it. The air itself generates it. And all it takes is the right concentration of fuel and oxygen — which, by the way, surrounds you constantly — and that little spark becomes the heat source in the fire triangle. Through remarkable laboratory demonstrations, this film shows static discharge, induced charges, and the terrifying ease with which sparks jump from seemingly nothing. It covers thunderstorms, lightning, industrial accidents, and the simple, unglamorous solutions — bonding, grounding, subsurface filling — that stand between a normal day and a catastrophic one. The spark doesn't care that you didn't mean it. ⚡ 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T06:00:00.000Z yes A/V Geeks 16mm Films no 1284 https://avgeeks.videonest.co/videos/1785594/they-ran-experiments-on-this-squirrel-big-mistake-INjBMmfYKC https://img.videonest.org/gamma/1785594_thumbnail_resized_v2.webp https://gamma.videonest.org/1785594_video_v5_360.mp4 They Ran Experiments on This Squirrel. Big Mistake. He Won Every Single One. His name is Squeak. He is a golden-mantled ground squirrel. And he is absolutely, humiliatingly smarter than you think he is. This remarkable vintage documentary follows Squeak through his daily life — foraging, socializing, and generally being a squirrel. But then the scientists showed up with their little puzzles and their little strings and their little experiments, and Squeak proceeded to make them look like they were the ones being studied. Pull the string. Solve the puzzle. Find the nut. Use the tool. Squeak did it all. What starts as a charming nature film quietly becomes one of the most compelling documents of animal intelligence you've ever seen — and the subject is a creature most people shoo off their bird feeders. Never underestimate Squeak. 🐿️ 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T04:00:00.000Z yes A/V Geeks 16mm Films no 636 https://avgeeks.videonest.co/videos/1787130/this-1970s-film-was-ahead-of-its-time-and-they-kne-H01j4Nm1My https://img.videonest.org/gamma/1787130_thumbnail_resized_v2.webp https://gamma.videonest.org/1787130_video_v5_360.mp4 This 1970s Film Was AHEAD of Its Time (And They Knew It) At a time when nobody was talking about it, someone made this film anyway. This rare vintage educational film tackled sexual health head-on — delivering a message that was radical for its era: this information belongs to everyone. No matter who you are, where you come from, or what your circumstances are, you deserve access to accurate health information and the freedom to ask questions without shame. Inclusive, direct, and surprisingly modern in its thinking, this film is a fascinating window into how public health education was trying to reach people who had historically been left out of the conversation entirely. A piece of history worth preserving. Worth watching. Worth sharing. 📽️ Scanned and preserved from the original film. Like and subscribe to support our ongoing archival work. 2026-04-01T20:00:00.000Z yes A/V Geeks 16mm Films no 106 1970seducational filmsexual healthpublic healthvintage filmarchival footageVDsexual education https://avgeeks.videonest.co/videos/1787134/a-v-geeks-16mm-lunch-4-1-2026-4zZeFhT7px https://img.videonest.org/gamma/1787134_thumbnail_resized_v2.webp https://gamma.videonest.org/1787134_video_v5_converted.mp4 A/V Geeks 16mm Lunch 4-1-2026 Goodbye March. We've got some changes coming regarding our channel! #avgeeks #16mmfilms 2026-04-01T16:56:44.000Z yes A/V Geeks 16mm Films no 3931 https://avgeeks.videonest.co/videos/1787136/they-filmed-these-accidents-so-you-wouldn-t-have-t-j47am45sgq https://img.videonest.org/gamma/1787136_thumbnail_resized_v2.webp https://gamma.videonest.org/1787136_video_v5_360.mp4 They Filmed These Accidents So You Wouldn't Have to Be in One It's never the first time that gets you. It's the five hundredth time — when you stop thinking about it. When it feels routine. When you're in a hurry and the shortcut seems harmless and you've done it a hundred times without anything going wrong. That's when the machine wins. This unsparing vintage safety film doesn't lecture. It doesn't traffic in vague warnings. It shows you — in uncomfortable, specific detail — exactly what happens when workers around heavy machinery get complacent, get distracted, or decide that proper procedure is someone else's problem today. The injuries are real. The near-misses are real. And the brutal throughline connecting every single scenario is the same: somebody thought it would be fine. Watch this. Share it with your crew. Put it on in the break room. ⚙️ The machine doesn't know it's having a bad day. But you will. 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T18:00:00.000Z yes A/V Geeks 16mm Films no 1394 https://avgeeks.videonest.co/videos/1787139/they-built-a-whole-playground-out-of-garbage-and-i-o4Iy4r1yAp https://img.videonest.org/gamma/1787139_thumbnail_resized_v2.webp https://gamma.videonest.org/1787139_video_v5_360.mp4 They Built a Whole Playground Out of GARBAGE (And It's Better Than Yours) Before there were makerspaces. Before there were Pinterest boards. Before "upcycling" became a lifestyle brand — there was Uncle Smiley and a bunch of kids with a junkyard and a vision. Watch as a neglected lot full of discarded materials gets transformed, piece by piece, into something genuinely magical: a "spin thing," a "swing thing," a racing car, and a garden — all built from stuff most people threw away. This vintage film is part DIY tutorial, part community love story, and part reminder that the best playground you ever had probably wasn't built by a corporation. Uncle Smiley understood the assignment. The kids understood the assignment. The junk understood the assignment. 🛞🌻 Like. Subscribe. Go find some junk. 2026-04-01T16:00:00.000Z yes A/V Geeks 16mm Films no 785 https://avgeeks.videonest.co/videos/1787142/soviet-classroom-caught-on-film-what-they-taught-k-Oq2-CrB8OC https://img.videonest.org/gamma/1787142_thumbnail_resized_v2.webp https://gamma.videonest.org/1787142_video_v5_360.mp4 Soviet Classroom Caught on Film — What They Taught Kids Will Surprise You We slowed this down so you can understand the English being spoken. What does "duty" mean to a child in the Soviet Union? This rare classroom film has the answer — and it's a lot more human than you might expect. Watch as real students and their teacher clash, defend themselves, point fingers, and ultimately arrive somewhere surprisingly genuine: a conversation about why education matters, who built their school, and what they owe each other as a community. It starts as a lesson about classroom readiness. It turns into something much more interesting. This is a fascinating time capsule of Soviet-era education — not propaganda posters, not marching children, but actual messy classroom dynamics that feel strangely familiar no matter where you grew up. The film ends with students making sentences about their school... and then everyone sings a song. Because of course they do. 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-01T14:00:00.000Z yes A/V Geeks 16mm Films no 792 https://avgeeks.videonest.co/videos/1790330/this-film-was-gone-forever-until-now-lost-16mm-foo-bTeO2e8KcS https://img.videonest.org/gamma/1790330_thumbnail_resized_v2.webp https://gamma.videonest.org/1790330_video_v5_360.mp4 This Film Was GONE FOREVER… Until Now | Lost 16mm Footage FOUND For years, we thought it was gone. Lost to time. Vanished without a trace. But after an incredible discovery, we can finally share with you what so many believed would never be seen again — Part 3, preserved on 16mm film and now scanned in its entirety for the very first time. We are beyond thrilled to finally bring this to you. This footage has been carefully scanned and restored so a new generation can experience it. Whether you've been waiting for this or are discovering it for the first time, you're in for something special. Don't forget to LIKE, SUBSCRIBE, and hit the 🔔 bell so you never miss another rare find — because we're just getting started. 2026-04-02T00:00:00.000Z yes A/V Geeks 16mm Films no 1262 16mm filmarchival filmus navycountdownfilm restorationvintage film https://avgeeks.videonest.co/videos/1790331/forgotten-film-reveals-the-one-art-trick-that-chan-8Fym-Ua7s_ https://img.videonest.org/gamma/1790331_thumbnail_resized_v2.webp https://gamma.videonest.org/1790331_video_v5_360.mp4 Forgotten Film Reveals the ONE Art Trick That Changes Everything What if the most powerful tool an artist has isn't a brush, a color, or a technique — but simply light and dark? This rare vintage educational film breaks down the fundamental building blocks of visual art in a way that feels almost radical in its simplicity. Through the interplay of contrast, shades, and tints, you'll see how objects leap off the surface or disappear entirely — and how you control all of it. Crayon. Chalk. Paint. It doesn't matter what's in your hand. What matters is understanding how light and dark shape everything the eye perceives. Whether you're an artist, a designer, a filmmaker, or just someone who's ever looked at something beautiful and wondered why it works — this one is for you. 🎨 Like. Subscribe. See differently. 2026-04-01T22:00:00.000Z yes A/V Geeks 16mm Films no 340 https://avgeeks.videonest.co/videos/1791162/facial-changes-silent-1938-_9Zq3JAWz_ https://img.videonest.org/gamma/1791162_thumbnail_resized_v2.webp https://gamma.videonest.org/1791162_video_v5_360.mp4 Facial Changes (silent, 1938) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:01:33 The film introduces the concept of facial changes, noting that the upper two-thirds of the face remain unaltered. 00:02:01 An anatomical model is shown, highlighting detailed features like the ear and skeletal structure, suggesting a focus on human anatomy. 00:02:09 The discussion shifts to the shortening of the distance from nose to chin due to gum resorption, which negatively impacts denture wearers. 00:03:00 The text explains how the lower gum recedes, affecting the lower denture's position and causing the lip to fall inward. 00:04:24 - 00:06:42 Facial Changes Study 00:04:24 The image displays a historical photograph, possibly focusing on a person's head and shoulders, with a blurred face, suggesting a study on facial changes. 00:05:23 The blurred black-and-white photo features an indistinct figure, with details obscured by the blurring effect. 00:05:59 Accompanying text lists physical changes, specifically "neck lengthened" and "fullness under the chin is missing," indicating observations about facial feature alterations. 00:06:42 - 00:11:29 Facial Changes and Dental Prosthetics 00:10:56 The segment begins with a close-up of a mechanical model head, showcasing the process of adjusting or fitting removable dentures. 2026-04-02T04:00:00.000Z yes A/V Geeks 16mm Films no 689 https://avgeeks.videonest.co/videos/1791163/the-internet-will-be-angry-we-uploaded-this-but-yo-Px4UjrhA2O https://img.videonest.org/gamma/1791163_thumbnail_resized_v2.webp https://gamma.videonest.org/1791163_video_v5_360.mp4 The Internet Will Be ANGRY We Uploaded This… But You Deserve to See It Yes, we posted it. No, we're not sorry. What you're about to watch is a genuine Kentucky Fried Chicken commercial on 16mm film — except it's barely a film anymore. Years of vinegar syndrome have shrunk and warped this reel so severely that our scanner couldn't even hold a stable image. The result is something that looks more like a fever dream than an advertisement for fried chicken. Is it unwatchable? Some will say yes. Will some of you tell us we should have just thrown it away? Absolutely. Will others demand we take it down? Probably. But we believe damaged history is still history. This is what film death looks like — and we think you should see it. Watch at your own risk. 🍗📽️ 2026-04-02T02:00:00.000Z yes A/V Geeks 16mm Films no 57 16mm filmKFC commercialvinegar syndromefilm damageKentucky Fried Chickenvintage commercialfilm preservationA/V Geeksfilm decay https://avgeeks.videonest.co/videos/1791593/av-geeks-16mm-lunch-4-2-2026-nKCKPao5CW https://img.videonest.org/gamma/1791593_thumbnail_resized_v2.webp https://gamma.videonest.org/1791593_video_v5_360.mp4 AV Geeks 16mm Lunch 4 2 2026 More films for you! Less April Fools pranks! #avgeeks #16mmfilms 2026-04-02T17:00:06.000Z yes A/V Geeks 16mm Films no 3762 https://avgeeks.videonest.co/videos/1791595/listening-speaking-and-nonverbal-language-skills-1-XfmsbSXfPq https://img.videonest.org/gamma/1791595_thumbnail_resized_v2.webp https://gamma.videonest.org/1791595_video_v5_360.mp4 Listening Speaking And Nonverbal Language Skills (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the multifaceted nature of communication, emphasizing the importance of effective listening, clear speaking, and conscious nonverbal cues. It highlights common pitfalls in communication, such as not paying attention, having prejudices, interrupting, speaking in a disorganized manner, talking excessively, using the wrong tone or language, and misinterpreting body language. Ultimately, the film stresses that good communication requires mindful effort in both sending and receiving messages, leading to stronger relationships and understanding. 2026-04-02T16:00:00.000Z yes A/V Geeks 16mm Films no 939 https://avgeeks.videonest.co/videos/1792348/fue-por-lana-went-for-wool-1953-spanish-LfneUVw07j https://img.videonest.org/gamma/1792348_thumbnail_resized_v2.webp https://gamma.videonest.org/1792348_video_v5_360.mp4 Fue Por Lana (Went For Wool) 1953, Spanish An animated story about a distressed rancher whose last lamb is lonely and dying. He seeks to enlighten a flock of sheep who are unaware of their plight. The narrative unfolds with themes of liberation and exploitation, as the characters rally for change against a corrupt system. The film combines humor and social commentary, culminating in a wedding celebration that symbolizes hope and unity. Keywords lamb, rancher, loneliness, sheep, enlightenment, liberation, exploitation, corrupt system, wedding, hope Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-03T04:00:00.000Z yes A/V Geeks 16mm Films no 371 lambranchersheepliberationexploitationcorrupt systemweddinghope16mmcartoon https://avgeeks.videonest.co/videos/1792349/lawrence-welk-show-excerpt-1950s-HMfF2ngp9- https://img.videonest.org/gamma/1792349_thumbnail_resized_v2.webp https://gamma.videonest.org/1792349_video_v5_360.mp4 [Lawrence Welk Show, Excerpt, 1950s] This TV excerpt captures a segment of the Lawrence Welk variety show featuring musical performances, comedic bits, and audience interaction. It opens with a romantic song, followed by instrumental performances on the trombone and trumpet. A segment includes an actor and a comedian, who then perform a duet. The show also features a special presentation to the host from the Greater North Dakota Association, acknowledging his work. The performances continue with medleys and accordion music before the show concludes with farewells and advertisements for Dodge vehicles and other television programs. Keywords: Variety show, music, performance, trombone, trumpet, comedy, duet, special presentation, advertisement, television. 2026-04-03T04:00:00.000Z yes A/V Geeks 16mm Films no 969 Lawrence WelkVariety show1950sBig bandTromboneTrumpetAccordionComedyMusical performance https://avgeeks.videonest.co/videos/1792718/av-geeks-16mm-lunch-4-3-2026-Znxw_ZVtgi https://img.videonest.org/gamma/1792718_thumbnail_resized_v2.webp https://gamma.videonest.org/1792718_video_v5_360.mp4 AV Geeks 16mm Lunch 4 3 2026 Ick.. still have the spring cold crud. Here's some new 16mm films for you! #avgeeks #16mmfilms 2026-04-03T17:00:06.000Z yes A/V Geeks 16mm Films no 3519 16mm filmav geekscentroneducational filmvintage filmarchival footagefilm scanningelectronic musicdrinking drivermakeuptitration https://avgeeks.videonest.co/videos/1793614/golden-deer-the-1974-E_UBFfK653 https://img.videonest.org/gamma/1793614_thumbnail_resized_v2.webp https://gamma.videonest.org/1793614_video_v5_360.mp4 Golden Deer, The (1974) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. After an Indian princess dreams of a singing golden deer, her father, the king, issues a proclamation offering a reward to anyone who can find the elusive creature. A young boy, seeking adventure and guided by his grandfather’s stories, sets out on a perilous journey across seven mountains to locate it. Upon finding the deer in a forest by a lake, the boy realizes the animal’s fear of hunters and decides to show kindness rather than capture it. Moved by the boy's empathy, the deer offers him a tuft of golden hair as a gift; when the boy presents this to the palace, it emanates the deer's magical, beautiful song, bringing joy and happiness to the entire kingdom. Keywords: India, princess, golden deer, singing, adventure, kindness, folktale, reward, magic, empathy 2026-04-05T04:00:00.000Z yes A/V Geeks 16mm Films no 612 golden deerindian folktaleanimated filmkindnessadventure https://avgeeks.videonest.co/videos/1793615/visit-to-epcot-center-1983-j6ZT3zzhGl https://img.videonest.org/gamma/1793615_thumbnail_resized_v2.webp https://gamma.videonest.org/1793615_video_v5_360.mp4 Visit To Epcot Center (1983) Epcot Center, envisioned by Walt Disney, is a unique theme park within Walt Disney World dedicated to innovation, technology, and global culture. It is divided into Future World, showcasing new ideas and imagination, and World Showcase, a vibrant community of nations celebrating diverse cultures and landmarks. Through immersive attractions, films, and interactive exhibits, Epcot aims to entertain, inform, and inspire visitors, encouraging a belief in humanity's potential to shape a hopeful future. Keywords: Epcot Center, Walt Disney, Future World, World Showcase, Spaceship Earth, Communicore, Universe of Energy, Horizons, World of Motion, Journey into Imagination, The Land, Symbiosis, American Adventure, Italy, Germany, China, Mexico, Canada, United Kingdom, France, Japan, technology, culture, innovation, inspiration 2026-04-04T16:00:00.000Z yes A/V Geeks 16mm Films no 1255 https://avgeeks.videonest.co/videos/1793616/square-dancing-okc-silent-1950s-DlikVL0rLc https://img.videonest.org/gamma/1793616_thumbnail_resized_v2.webp https://gamma.videonest.org/1793616_video_v5_360.mp4 [Square Dancing OKC, silent, 1950s] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:00:03 Musicians perform on stage with a violinist, banjo player, and pianist, as couples dance in the foreground, creating a lively atmosphere. 00:00:59 A lively musical performance unfolds indoors with a group of musicians, including a violinist and pianist, creating a festive atmosphere while people dance. 00:02:12 Couples square dance in a decorated hall with a live band, dressed in mid-20th century attire, enjoying the festive setting with streamers and flowers. 00:03:46 A group of people square dance in a decorated indoor setting, forming a circle and holding hands, with chairs and festive streamers enhancing the ambiance. 00:04:46 A person speaks into a vintage microphone on a decorated stage, with others partially visible and streamers hanging above. 00:10:48 A group of people in casual attire gathers in a spacious room, forming a circle and appearing to prepare for square dancing. 00:11:34 Young individuals are engaged in square dancing, following steps in a room with a piano and chairs lining the walls. 2026-04-04T04:00:00.000Z yes A/V Geeks 16mm Films no 719 square dance1950svintage footageOklahomasocial gatheringlive musicdance hallmid-century16mm filmfolk dance https://avgeeks.videonest.co/videos/1793617/i-am-the-way-the-hours-of-trial-part-2-1931-WHoqQrS96J https://img.videonest.org/gamma/1793617_thumbnail_resized_v2.webp https://gamma.videonest.org/1793617_video_v5_360.mp4 I Am the Way: The Hours of Trial, Part 2 (1931) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This is a 1931 silent film produced and distributed by the **Religious Motion Picture Foundation** of New York City, presented as "a pictorial study of Jesus' life and ministry in Holy Land settings." As the title suggests, this is Part 2 of a series, focusing specifically on the trial and passion narrative. The film opens at **the Hall of Judgement**, where a large crowd has already assembled by early dawn. The central dramatic tension is Pilate's moral dilemma: he recognizes Jesus as innocent but is afraid to act against the pressure of the mob. In an attempt to avoid condemning Jesus outright, **Pilate orders Jesus to be scourged**, hoping this will satisfy the crowd. This fails. In a further desperate effort, **Pilate calls Jesus before the people again**, apparently hoping that the sight of a beaten man will inspire mercy. The crowd, however, is stirred up by the chief priests, and they **demand Barabbas** — a chained prisoner — be released instead. Pilate appeals to the crowd a second time, asking what should be done with Jesus. The mob's answer is unambiguous, and finally, **yielding to their clamor, Pilate orders Jesus to be crucified.** The film then depicts the subsequent events visually: Jesus carrying the cross through the streets, mourning women, the procession to Golgotha, and ultimately the **crucifixion** itself, shown as three figures on crosses against a dark, stormy sky. The film is a straightforward, reverent dramatization of the Gospel passion narrative, shot in what appear to be elaborate studio sets designed to evoke Holy Land architecture and atmosphere. 2026-04-04T04:00:00.000Z yes A/V Geeks 16mm Films no 659 https://avgeeks.videonest.co/videos/1794039/the-very-first-easter-1972-7GnLgZqrXo https://img.videonest.org/gamma/1794039_thumbnail_resized_v2.webp https://gamma.videonest.org/1794039_video_v5_360.mp4 The Very First Easter (1972) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This animated film is a children’s educational narrative that explains the theological significance of Easter through the story of Jesus Christ. Framed as a gentle conversation between a narrator and a pet dog named Sniffy, the film recounts Jesus’s arrival in Jerusalem, his teachings, his conflict with authorities, his crucifixion, and his ultimate resurrection. By contrasting secular traditions like candy and rabbits with the spiritual message of divine love and sacrifice, the story aims to teach young viewers about the historical and religious foundations of the holiday, emphasizing the importance of faith, compassion, and the promise of eternal life. Keywords: Easter, Jesus Christ, Christianity, resurrection, disciples, biblical story, faith, religion, Sunday school, theology 2026-04-05T16:00:00.000Z yes A/V Geeks 16mm Films no 651 EasterJesus ChristChristianityResurrectionBiblical StorySunday School https://avgeeks.videonest.co/videos/1794040/sweet-hour-of-prayer-1940s-qIoC0XP43q https://img.videonest.org/gamma/1794040_thumbnail_resized_v2.webp https://gamma.videonest.org/1794040_video_v5_360.mp4 Sweet Hour of Prayer (1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A singalong to a hymn with scenes of churches. 2026-04-05T16:00:00.000Z yes A/V Geeks 16mm Films no 165 Sweet Hour of PrayerHymnChurch1940sReligionVintage16mmSingalongReligious MusicChristian Music https://avgeeks.videonest.co/videos/1794709/mexico-in-the-70s-a-city-family-1970s-fHJKVZ9-mn https://img.videonest.org/gamma/1794709_thumbnail_resized_v2.webp https://gamma.videonest.org/1794709_video_v5_360.mp4 Mexico In The 70s: A City Family (1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film provides an intimate portrait of Gildardo Montalongo, a computer technician living in a rapidly modernizing Mexico City, as he balances the demands of contemporary professional life with deep-rooted family values. Through the perspectives of various family members, the narrative explores the generational transition from humble beginnings in crowded tenements to a more stable, middle-class existence characterized by technological progress, educational opportunities, and changing gender roles. Ultimately, the story celebrates the resilience of the family unit, highlighting how traditional bonds persist even as the urban landscape transforms and living standards continue to rise. Mexico City, modernization, family values, socioeconomic progress, urban life, education, generational shift, technology, traditions, daily routines 2026-04-06T04:00:00.000Z yes A/V Geeks 16mm Films no 1056 Mexico City1970sfamily valuesurban lifemodernization https://avgeeks.videonest.co/videos/1795641/south-pacific-underwater-coral-silent-1960s-5s6ig-rylK https://img.videonest.org/gamma/1795641_thumbnail_resized_v2.webp https://gamma.videonest.org/1795641_video_v5_360.mp4 [South Pacific Underwater Coral, silent, 1960s] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 00:00:00 Underwater scenes from the South Pacific reveal vibrant coral reefs teeming with diverse marine life, highlighting the intricate beauty and rich biodiversity of the ocean's ecosystem. 00:00:04 An underwater scene in the South Pacific displays a vibrant coral formation with long, tubular coral structures swaying gracefully, reflecting the rich biodiversity and stunning beauty of marine ecosystems. 00:00:07 Underwater footage captures the gentle sway of long, slender coral structures in the South Pacific, showcasing the intricate beauty of marine life as corals move rhythmically with ocean currents. 00:00:09 A vibrant underwater environment in the South Pacific showcases intricate coral formations gently swaying with ocean currents, providing a glimpse into the dynamic ecosystem and highlighting the diversity and complexity of marine life in coral reefs. 00:00:09 - 00:01:57 South Pacific Underwater Coral 00:00:15 An underwater scene in the South Pacific showcases intricate coral formations, capturing the vibrant marine life and unique swirling shapes of the corals. 00:00:17 Underwater footage highlights the vibrant marine life and diverse coral formations in the South Pacific, showing intricate shapes and movements of soft corals amidst a tranquil ocean backdrop. 00:00:42 An underwater scene showcases vibrant coral formations in the South Pacific, featuring a prominent orange tube-shaped coral amidst various marine life and rocky structures. 00:01:03 The scene depicts an underwater environment in the South Pacific, showcasing various marine life and coral structures with clear blue water providing a backdrop for the vibrant diversity of the ocean ecosystem. 2026-04-07T04:00:00.000Z yes A/V Geeks 16mm Films no 118 https://avgeeks.videonest.co/videos/1795642/an-island-nation-japan-1950-TMtriP1Wm2 https://img.videonest.org/gamma/1795642_thumbnail_resized_v2.webp https://gamma.videonest.org/1795642_video_v5_360.mp4 An island nation: Japan (1950) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary film provides an educational overview of mid-20th-century Japan, contrasting the rapid industrialization and modernization of urban centers like Tokyo with the traditional, labor-intensive lifestyle of rural farmers. It highlights Japan’s transition into a major commercial power that relies heavily on foreign trade, while simultaneously showcasing deep-seated cultural customs such as the ceremonial nature of visiting a home, the importance of education, and the popularity of adopted sports like baseball. Through the lens of a visit to the rural Sugimoto farm, the film illustrates the challenges of Japan’s mountainous geography, the meticulous terrace farming techniques used to maximize limited fertile land, and the communal efforts required to sustain the nation’s food supply. Keywords: Japan, Tokyo, modernization, industrialization, agriculture, rice farming, Japanese culture, traditions, geography, foreign trade, rural life, education. 2026-04-07T04:00:00.000Z yes A/V Geeks 16mm Films no 1137 JapanTokyoJapanese culturerice farmingrural lifemodernizationforeign trade1950s https://avgeeks.videonest.co/videos/1795643/sign-language-the-language-of-life-1981-6exekYgw8h https://img.videonest.org/gamma/1795643_thumbnail_resized_v2.webp https://gamma.videonest.org/1795643_video_v5_360.mp4 Sign Language: The Language Of Life (1981) This film documents the historical evolution of sign language as a vital tool for the education and empowerment of the deaf and hearing-impaired community. It traces the journey from early finger-spelling methods in 16th-century Spain to the transformative pedagogical work of Abbé de l'Épée in 18th-century France, which laid the foundation for modern conceptual sign language. Through the collaborative efforts of figures like Thomas Hopkins Gallaudet and Laurent Clerc, these methods were brought to the United States, eventually evolving into American Sign Language (ASL). The documentary highlights how contemporary educational practices, which integrate signing, lip-reading, and technology, allow deaf students to realize their full potential, artistic expression, and intellectual growth, ultimately fostering a more inclusive society where sign language is recognized as a profound and essential mode of human communication. Keywords: Sign language, Deaf education, History of ASL, Gallaudet, Communication, Inclusion, Abbé de l'Épée, Finger spelling, Hearing impaired, Language development 2026-04-07T04:00:00.000Z yes A/V Geeks 16mm Films no 1021 https://avgeeks.videonest.co/videos/1795644/av-geeks-16mm-lunch-4-6-2026-zV9GVrOp3r https://img.videonest.org/gamma/1795644_thumbnail_resized_v2.webp https://gamma.videonest.org/1795644_video_v5_360.mp4 AV Geeks 16mm Lunch 4-6-2026 16mm films on a Monday are a great way to start the week! #avgeeks #16mmfilms 2026-04-06T17:00:06.000Z yes A/V Geeks 16mm Films no 3618 https://avgeeks.videonest.co/videos/1795903/how-great-a-flame-1940s-8UxgVh1bqI https://img.videonest.org/gamma/1795903_thumbnail_resized_v2.webp https://gamma.videonest.org/1795903_video_v5_360.mp4 How Great a Flame (1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary follows an American Methodist preacher-in-training as he explores the origins of Methodism at the "New Room" in Bristol, England, the oldest Methodist chapel in the world. Through a reflective tour of the historic site—including the pulpit, study, and simple living quarters used by John Wesley—the narrator contemplates the profound legacy of the 18th-century evangelical revival. The film culminates in a spiritual dialogue between the narrator and a manifestation of John Wesley, who urges modern believers to remain steadfast in their commitment to salvation, practical compassion, and holiness despite the changing nature of the world. Keywords: Methodism, John Wesley, New Room Bristol, Religious History, Evangelicalism, Christian Heritage, Faith, Spirituality, Social Reform, Missionaries 2026-04-07T16:00:00.000Z yes A/V Geeks 16mm Films no 529 MethodismJohn WesleyNew Room BristolReligious HistoryEvangelicalismChristian Heritage https://avgeeks.videonest.co/videos/1796103/a-v-geeks-16mm-lunch-4-7-2026-8Q31dVIhdj https://img.videonest.org/gamma/1796103_thumbnail_resized_v2.webp https://gamma.videonest.org/1796103_video_v5_360.mp4 A/V Geeks 16mm Lunch 4-7-2026 Hello 16mm films! What do you have for us today? #avgeeks #16mmfilms 2026-04-07T16:59:09.000Z yes A/V Geeks 16mm Films no 3834 16mm filmAV GeeksLeo BeuermandisabilityJapanrural lifeJapanese cultureartlakeperchfishingresilienceanimated filmfarmingart education https://avgeeks.videonest.co/videos/1796362/teacher-s-role-8th-grade-mathematics-spanish-1960s-cX1CaPqyJ4 https://img.videonest.org/gamma/1796362_thumbnail_resized_v2.webp https://gamma.videonest.org/1796362_video_v5_360.mp4 Teacher's Role: 8th Grade Mathematics (Spanish, 1960s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film series explores various methods teachers use to integrate programmed instruction into their curriculum, emphasizing comparison of approaches rather than prescribing a single method. It showcases three different teachers: Mrs. Kaplan, who uses programmed vocabulary instruction with gifted fourth graders and supplements it with creative activities and individual counseling; Miss Langden, who employs programmed science lessons with third graders, using small heterogeneous groups for experiments and collaborative learning; and Miss Shed, who implements an independent reading program for kindergarteners with behavioral challenges, fostering self-reliance and self-evaluation. Keywords: programmed instruction, teaching methods, curriculum, gifted students, vocabulary, science, independent work, group work, experimentation, reading program, behavioral challenges, self-reliance, self-evaluation, comparison 2026-04-08T04:00:00.000Z yes A/V Geeks 16mm Films no 2613 programmed instructionteaching methodsalgebra1960smathematics8th grade https://avgeeks.videonest.co/videos/1796363/police-silent-1960s-D68PcNumyC https://img.videonest.org/gamma/1796363_thumbnail_resized_v2.webp https://gamma.videonest.org/1796363_video_v5_360.mp4 Police (silent ,1960s) Police (silent ,1960s) This footage offers a fascinating glimpse into life in the 1960s, showcasing a variety of scenes that reflect both daily activities and the urban environment of the time. The clips feature police officers on duty, capturing moments such as traffic stops and patrols through city streets, allowing viewers to observe the law enforcement presence in an urban setting. The footage also highlights a routine patrol in a quiet neighborhood, complete with classic vehicles and brick buildings, painting a picture of the era's streetscape. In addition to police activities, there are also scenes reflecting daily life, including domestic moments and suburban interactions. Furthermore, the footage includes a dramatic response from firefighters to a residential emergency, showcasing their efforts to manage a fire incident. Overall, this collection presents a rich tapestry of 1960s life, blending law enforcement, community interactions, and emergency responses. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. #1960s Police #Urban Life #Firefighters #Historical Footage #Community Interactions 00:02:48 A man in a white garment is shown in a domestic setting, with personal photographs on a dresser behind him. 00:03:09 A man walks away from a white car in a residential area, observed by two people on a porch. 00:06:10 A person in a shirt and tie demonstrates how to open and inspect a revolver's cylinder. 00:10:01 - 00:13:12 Police Patrol in the 1960s 00:10:01 A police officer approaches a parked car on a busy urban road, possibly for a routine traffic stop or inspection. 00:13:07 Two police officers are shown driving through a city street, patrolling the urban environment of the 1960s. 00:13:12 Firefighters arrive at a residential area with fire engines, deploying hoses and a ladder against a house to combat a fire. 00:22:20 - 00:25:00 1960s Police Patrol 00:22:20 A 1960s police officer is shown driving a patrol car through an urban area with storefronts and classic vehicles. 00:23:33 The police car turns a corner in a quiet urban area, revealing a typical 1960s street scene with a brick building in the background. 00:25:00 - 00:28:03 1960s Urban Police Patrol 00:25:00 A vintage 1960s police car is parked in an urban setting, indicating a law enforcement presence. 00:26:27 A vehicle drives through a busy city street, showcasing typical urban traffic conditions in the 1960s. 2026-04-08T04:00:00.000Z yes A/V Geeks 16mm Films no 1684 1960spolice patrolfirefightersurban lifecommunity interactionshistorical footageclassic carspolice training https://avgeeks.videonest.co/videos/1796622/a-v-geeks-16mm-lunch-4-8-2026-uxn7amn2U3 https://img.videonest.org/gamma/1796622_thumbnail_resized_v2.webp https://gamma.videonest.org/1796622_video_v5_360.mp4 A/V Geeks 16mm Lunch 4-8-2026 16mm films for your pleasure! #avgeeks #16mmfilms 2026-04-08T16:59:37.000Z yes A/V Geeks 16mm Films no 4292 16mm filmAV GeeksNavajo cultureNative American historycoral reefsmarine liferadio comediansgolden age radio1940s radioclassic radioGeorge BurnsGracie AllenEdgar BergenCharlie McCarthyventriloquism https://avgeeks.videonest.co/videos/1796625/the-doppler-effect-1951-h-mZ_ET79o https://img.videonest.org/gamma/1796625_thumbnail_resized_v2.webp https://gamma.videonest.org/1796625_video_v5_360.mp4 The Doppler Effect (1951) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This fill explains the physical principles behind the Doppler effect, illustrating how the frequency of wave arrivals determines the perceived pitch of a sound. It breaks down the mathematical relationship between wave speed, wavelength, and frequency, demonstrating how these factors change when either the sound source or the observer is in motion. By analyzing scenarios where a source moves toward or away from a stationary listener—or conversely, where a listener moves relative to a stationary source—the film clarifies why the pitch of a sound appears to shift, providing real-world context through examples such as passing trains and road signals. Keywords: Doppler effect, physics, wave frequency, wavelength, acoustics, sound, pitch, motion, wave speed, longitudinal waves 2026-04-08T16:00:00.000Z yes A/V Geeks 16mm Films no 504 Doppler effectwave frequencywavelengthsoundpitchacousticsphysics principleslongitudinal waveswave speed https://avgeeks.videonest.co/videos/1800153/scattering-of-quantum-mechanical-wave-packets-from-ewgql6eCw4 https://img.videonest.org/gamma/1800153_thumbnail_resized_v2.webp https://gamma.videonest.org/1800153_original_360.mp4 Scattering of Quantum Mechanical Wave Packets from a Potential (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-09T16:00:00.000Z yes A/V Geeks 16mm Films no 305 quantum mechanicswave packetsscatteringpotential wellpotential barrierparticle energy16mm filmLawrence Radiation Laboratory https://avgeeks.videonest.co/videos/1800155/child-of-bethlehem-1941-8d758hh7MZ https://img.videonest.org/gamma/1800155_thumbnail_resized_v2.webp https://gamma.videonest.org/1800155_video_v5_360.mp4 Child Of Bethlehem (1941) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film narrates the story of the birth and early life of Jesus Christ, focusing on events from the Gospels of Luke and Matthew. It describes the journey of Mary and Joseph to Bethlehem for a census, the birth of Jesus in a manger, the visit of shepherds and wise men, King Herod's reaction, and Jesus' early years, including a significant event at the temple when he was twelve. 2026-04-09T04:00:00.000Z yes A/V Geeks 16mm Films no 1152 NativityJesus ChristBethlehemBibleReligionGospelHerodThree Wise MenMaryJosephChristianity https://avgeeks.videonest.co/videos/1800522/av-geeks-16mm-lunch-4-9-2026-shne8kMXOH https://img.videonest.org/gamma/1800522_thumbnail_resized_v2.webp https://gamma.videonest.org/1800522_video_v5_360.mp4 AV Geeks 16mm Lunch 4-9-2026 16mm films for you! #avgeeks #16mmfilms 2026-04-09T16:57:44.000Z yes A/V Geeks 16mm Films no 4451 AV Geeks16mm filmshopliftingsafety trainingheavy machineryworkplace safetyaccident preventionPearl HarborWorld War IIBob HopeJack BennyFred Allenradio comedyvintage radioShake Hands With Danger https://avgeeks.videonest.co/videos/1800919/snow-monkeys-of-japan-1975-kvOKpH5b_Y https://img.videonest.org/gamma/1800919_thumbnail_resized_v2.webp https://gamma.videonest.org/1800919_video_v5_360.mp4 Snow Monkeys Of Japan (1975) This documentary explores the fascinating lives of Japanese macaques, also known as snow monkeys, in the Jigo-Kudani hot springs west of Tokyo. It highlights their unique habit of bathing in the hot springs, a behavior that began with a young monkey in 1963 and spread throughout the troop by 1970. The film also captures the monkeys' daily activities, including play, grooming, foraging for food (even washing it), and their coordinated movements for safety and rest, demonstrating their social structure and survival instincts in the harsh winter environment. Keywords: Snow monkeys, Japanese macaques, Jigo-Kudani, hot springs, wildlife, animal behavior, social structure, winter, Japan, primates, grooming, foraging, adaptation 2026-04-10T04:00:00.000Z yes A/V Geeks 16mm Films no 462 https://avgeeks.videonest.co/videos/1801634/av-geeks-16mm-lunch-4-10-2026-xjpQXb676d https://img.videonest.org/gamma/1801634_thumbnail_resized_v2.webp https://gamma.videonest.org/1801634_video_v5_360.mp4 AV Geeks 16mm Lunch 4-10-2026 Salve, Skip sum. Ad spectaculum nostrum te salutat. Haec pellicula Latine scripta est. #avgeeks #16mmfilms 2026-04-10T16:58:50.000Z yes A/V Geeks 16mm Films no 3668 https://avgeeks.videonest.co/videos/1801635/the-housefly-3rd-ed-1982-OoNBsbAi7k https://img.videonest.org/gamma/1801635_thumbnail_resized_v2.webp https://gamma.videonest.org/1801635_video_v5_360.mp4 The Housefly (3rd Ed, 1982) Discusses the life cycle of the housefly, starting from the female laying eggs in garbage and waste. The eggs hatch into legless maggots that feed on the same refuse. After several days of growth, the maggots pupate, undergoing metamorphosis into adult flies. The process is accelerated through time-lapse photography, showcasing the transformation and emergence of the adult fly, which then begins grooming and preparing to fly. The housefly's behaviors are instinctive, and their lifespan varies between males and females. Keywords housefly, life cycle, eggs, maggots, pupation, metamorphosis, instinctive behavior, time-lapse photography 2026-04-10T16:47:49.000Z yes A/V Geeks 16mm Films no 910 houseflyfly life cyclemaggotsinsect anatomytime-lapsefly wingsinsect flightpupationmetamorphosis https://avgeeks.videonest.co/videos/1801636/simple-harmonic-motion-XF1eGpDr1J https://img.videonest.org/gamma/1801636_thumbnail_resized_v2.webp https://gamma.videonest.org/1801636_original_360.mp4 Simple Harmonic Motion Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film provides a technical explanation of simple harmonic motion (SHM), illustrating the concept through the physical behavior of a mass attached to a spring. It defines SHM as periodic motion where the restoring force is directly proportional to the displacement but acts in the opposite direction, a relationship expressed by Hooke's Law ($F = -kx$). The video utilizes a "circle of reference" as a geometric tool to model and analyze key physical variables—including amplitude, period, frequency, displacement, velocity, and acceleration—demonstrating how these factors evolve over time. By mapping the projection of circular motion onto a horizontal diameter, the film confirms that the acceleration of the system is proportional to the negative of the displacement, thereby verifying the mechanics of simple harmonic oscillators. Keywords: simple harmonic motion, periodic motion, spring-mass system, Hooke's Law, oscillation, circle of reference, amplitude, frequency, acceleration, velocity, physics 2026-04-10T16:00:00.000Z yes A/V Geeks 16mm Films no 634 https://avgeeks.videonest.co/videos/1802810/law-enforcement-a-local-issue-hobbs-act-1970s-tkuBGcqgWN https://img.videonest.org/gamma/1802810_thumbnail_resized_v2.webp https://gamma.videonest.org/1802810_video_v5_360.mp4 Law Enforcement - A Local Issue (Hobbs Act) 1970s Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film presents an argument against proposed federal legislation that would disproportionately criminalize picket line violence committed by union members while leaving similar offenses by employers under the jurisdiction of local courts. The narrative emphasizes that the American collective bargaining system is fundamentally successful and peaceful, and that existing state laws are already sufficient to handle isolated incidents of labor disputes. By highlighting the potential for discriminatory enforcement and "unequal protection under the law," the film asserts that such a federal mandate is not a genuine effort to reduce violence, but rather a biased, anti-union attempt to weaken the rights of organized labor. Keywords: Labor unions, collective bargaining, picket lines, federal legislation, AFL-CIO, workers' rights, due process, labor disputes, law enforcement, equal protection, anti-unionism 2026-04-11T16:00:00.000Z yes A/V Geeks 16mm Films no 375 labor unionscollective bargainingpicket lineslaw enforcementworkers rightsAFL-CIOHobbs Actlabor disputesanti-unionismfederal legislation https://avgeeks.videonest.co/videos/1802811/a-usina-hidrelectrica-de-correntina-spanish-1950s-VXFo73t6ZB https://img.videonest.org/gamma/1802811_thumbnail_resized_v2.webp https://gamma.videonest.org/1802811_original_360.mp4 A Usina Hidrelectrica De Correntina (Spanish, 1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film documents the design and construction of the Correntina hydroelectric plant in Bahia, an initiative led by the São Francisco Valley Commission to promote regional development. The project, which faced major logistical challenges due to geographic isolation, included the construction of roads, urban infrastructure, and advanced energy generation and transmission technologies. The undertaking aimed not only to meet the energy demands of the city of Correntina, but to bring progress to various municipalities throughout the Bahian backlands (sertão) through the regulation of the waters of the Correntes River and an automated electrical distribution system — marking a significant advancement in the region's energy infrastructure. **Keywords:** Correntina, São Francisco Valley, hydroelectric plant, energy, infrastructure, regional development, Bahia, engineering, sertão, electrification. O filme documenta o projeto e a execução da usina hidrelétrica de Correntina, na Bahia, uma iniciativa liderada pela Comissão do Vale do São Francisco para promover o desenvolvimento regional. A obra, que enfrentou grandes desafios logísticos devido ao isolamento geográfico, incluiu a construção de estradas, infraestrutura urbana e tecnologias avançadas de geração e transmissão de energia. O empreendimento visava não apenas suprir a demanda da cidade de Correntina, mas levar progresso a diversos municípios do sertão baiano através da regularização das águas do rio Correntes e de um sistema automatizado de distribuição elétrica, marcando um avanço significativo na infraestrutura energética da região. Palavras-chave: Correntina, Vale do São Francisco, hidrelétrica, energia, infraestrutura, desenvolvimento regional, Bahia, engenharia, sertão, eletrificação. 2026-04-11T04:00:00.000Z yes A/V Geeks 16mm Films no 634 https://avgeeks.videonest.co/videos/1804492/progressive-waves-transverse-and-longitudinal-1953-yeblRVcIZF https://img.videonest.org/gamma/1804492_thumbnail_resized_v2.webp https://gamma.videonest.org/1804492_original_360.mp4 Progressive Waves: Transverse and Longitudinal (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film provides a foundational overview of wave mechanics, distinguishing between transverse and longitudinal waves. It explains that transverse waves involve particle movement perpendicular to the direction of wave travel, using a vibrating rope as a primary example, while longitudinal waves involve particle displacement parallel to the direction of propagation, illustrated through linked beads and the mechanics of sound waves in air. The film further explores the physical factors influencing wave velocity, such as tension and inertia, and establishes the fundamental mathematical relationship between wave velocity, frequency, and wavelength ($V = f \lambda$), providing a clear conceptual framework for understanding how waves move through different media. Keywords: transverse waves, longitudinal waves, wave velocity, frequency, wavelength, simple harmonic motion, pulse, elastic factor, inertial factor, sound waves, wave mechanics. 2026-04-13T16:00:00.000Z yes A/V Geeks 16mm Films no 526 transverse waveslongitudinal waveswave motionwave velocitywavelengthsimple harmonic motionsound wavesphysics education https://avgeeks.videonest.co/videos/1804887/friction-fighters-1940-eXh8DF6QOr https://img.videonest.org/gamma/1804887_thumbnail_resized_v2.webp https://gamma.videonest.org/1804887_original_360.mp4 Friction Fighters (1940) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film highlights the critical role of chemical research in modern industry, focusing specifically on the evolution of petroleum technology and the science of lubrication. Using the analogy of a "friction fighter," the narrator explains how engineers combat the destructive forces of friction within automobile engines, which have become increasingly complex and high-performing over time. By comparing various motor oils through rigorous laboratory testing, the film demonstrates the dangers of oil "breakdown"—where lubricants either thicken in the cold or lose their protective body under high heat, leading to varnish deposits, engine wear, and oil consumption. Ultimately, the documentary showcases how advancements in refining and chemical additives have produced superior, high-performance lubricants that provide a wider range of protection across extreme temperature variations, ensuring greater engine longevity and efficiency. Keywords: Petroleum research, lubrication, friction, engine performance, chemical engineering, motor oil, thermal stability, scientific innovation, automotive technology, viscosity. 2026-04-14T16:00:00.000Z yes A/V Geeks 16mm Films no 1899 petroleum researchlubrication sciencefrictionmotor oilengine wearchemical additivesautomotive technologyviscositythermal stability https://avgeeks.videonest.co/videos/1805532/forgotten-treasure-1943-KZ5eOh2hnu https://img.videonest.org/gamma/1805532_thumbnail_resized_v2.webp https://gamma.videonest.org/1805532_original_360.mp4 Forgotten Treasure (1943) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film chronicles the mission of the Museum of Modern Art to salvage and preserve fragile historical footage before it degrades, emphasizing the vital role of cinema as a primary document of human history. Through a curated collection of early 20th-century reels, the documentary presents pivotal moments—including the final days of President McKinley, the 1906 San Francisco earthquake, the construction of the Panama Canal, and the final gathering of European monarchs before the outbreak of World War I. By contrasting these "lost" historical moments with a futuristic classroom setting where students study life through interactive historical film archives, the documentary serves as both a plea for the technical preservation of celluloid and a meditation on the cyclical nature of human triumph and tragedy. Keywords: Film preservation, Museum of Modern Art, historical footage, celluloid, early 20th century, William McKinley, San Francisco earthquake, Panama Canal, royalty, World War I, educational technology, archival history. 2026-04-15T16:00:00.000Z yes A/V Geeks 16mm Films no 551 Film preservationHistorical footageMuseum of Modern ArtEarly 20th centuryWilliam McKinleySan Francisco earthquakePanama CanalRoyaltyWorld War I https://avgeeks.videonest.co/videos/1807936/from-eight-to-five-1963-3mO3MjPuKt https://img.videonest.org/gamma/1807936_thumbnail_resized_v2.webp https://gamma.videonest.org/1807936_original_360.mp4 From Eight to Five (1963) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film serves as an instructional guide for university secretaries, detailing the professional standards, administrative responsibilities, and behavioral traits necessary to excel in an academic office environment. Through the perspective of a department head, the film outlines the importance of maintaining a professional appearance, managing complex scheduling, and effectively balancing tasks for multiple faculty members. It emphasizes ten essential professional qualities—including accuracy, initiative, tact, and loyalty—while highlighting how a competent secretary contributes to the efficiency and reputation of the entire department. The narrative concludes with a lighthearted resolution where the exemplary secretary decides to rescind her resignation, much to the relief of her appreciative supervisor. Keywords: University Secretary, Office Management, Professional Development, Administrative Skills, Workplace Efficiency, Secretarial Standards, Academic Environment, Human Relations, Job Performance, Employee Training 2026-04-16T16:00:00.000Z yes A/V Geeks 16mm Films no 1179 https://avgeeks.videonest.co/videos/1810702/characters-in-conflict-1972-QGx08LeOwE https://img.videonest.org/gamma/1810702_thumbnail_resized_v2.webp https://gamma.videonest.org/1810702_original_360.mp4 Characters in Conflict (1972) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This instructional film explores the essential elements of effective character development in creative writing, emphasizing that compelling characters must be rooted in a deep understanding of their personal histories. The narrative argues that characters are not just "blobs" born fully grown, but complex individuals shaped by their past experiences, conflicting internal desires, and unique perspectives on the world. By showcasing how characters perceive their environment differently based on their own biases, the film illustrates that drama arises from the conflict between a character's self-image and their external reality. Ultimately, it suggests that writers should balance uniqueness—which captures reader interest—with universal human traits that foster empathy and rapport, advising authors to let characters reveal themselves through their actions and words rather than through direct exposition. Keywords: character development, creative writing, storytelling, conflict, narrative technique, human nature, point of view, fiction, empathy, personal history 2026-04-19T16:00:00.000Z yes A/V Geeks 16mm Films no 760 https://avgeeks.videonest.co/videos/1810703/taking-care-of-your-school-building-1979-DUCknYG5PO https://img.videonest.org/gamma/1810703_thumbnail_resized_v2.webp https://gamma.videonest.org/1810703_original_360.mp4 Taking Care of Your School Building (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. In this educational short film, two students named Susie and Bill are preparing their classroom for a Halloween open house when they begin hearing a mysterious voice emanating from the school's loudspeaker. The voice, claiming to be the building itself—nicknamed "LM"—begins a conversation with the children to explain how years of careless behavior have caused it physical pain and degradation. Through a series of examples, such as crayon marks on walls, carved desks, and clogged drains, the school teaches the children how small, thoughtless actions accumulate into significant damage. The children respond by creating a comprehensive list of rules to help their classmates treat the school with respect, ultimately learning that preserving their environment is a shared responsibility that saves money for better school resources. The film concludes with the reveal that the school custodian, Mr. Dylan, had been using the loudspeaker to deliver the message, leaving the students inspired to take better care of their building. Keywords: school, property care, education, responsibility, school maintenance, respect, vandalism, public property, student behavior, childhood development 2026-04-18T16:00:00.000Z yes A/V Geeks 16mm Films no 918 https://avgeeks.videonest.co/videos/1810704/communication-by-voice-and-action-1969-upMIDjYWi0 https://img.videonest.org/gamma/1810704_thumbnail_resized_v2.webp https://gamma.videonest.org/1810704_original_360.mp4 Communication by Voice and Action (1969) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the fundamental nature of human communication, emphasizing that individuals are social beings who constantly transmit messages through both verbal content and non-verbal cues. It posits that effective communication is a two-way process where the "what" (the message) and the "how" (the delivery) are inseparable. By examining various public speaking scenarios, the film demonstrates that a speaker's personality, vocal modulation, physical posture, and gestures are essential tools for conveying attitude and intent. Ultimately, it argues that to be truly understood, one must cultivate a sense of bodily and vocal alertness, ensuring that words and physical actions work in harmony to authentically reflect the speaker's thoughts and emotions. Keywords: Communication, Public Speaking, Non-verbal Communication, Delivery, Body Language, Voice Modulation, Social Interaction, Presentation Skills, Interpersonal Communication, Persuasion 2026-04-17T16:00:00.000Z yes A/V Geeks 16mm Films no 790 communicationpublic speakingbody languagevoice modulationpresentation skills https://avgeeks.videonest.co/videos/1812595/elementary-natural-science-hawks-1977-RegGK8piHU https://img.videonest.org/gamma/1812595_thumbnail_resized_v2.webp https://gamma.videonest.org/1812595_original_360.mp4 Elementary Natural Science: Hawks (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film provides a comprehensive overview of the diverse species of North American birds of prey, categorizing them into groups such as buteos, accipiters, and falcons, while highlighting their unique physical characteristics and hunting strategies. It details the life cycles and behaviors of various birds—including the red-tailed hawk, osprey, peregrine falcon, and bald eagle—emphasizing their vital role in maintaining ecological balance as apex predators. Ultimately, the documentary underscores the conservation challenges these raptors face, noting that while natural threats exist, human interference, environmental toxins, and habitat loss represent the most significant dangers to their survival. Hawks, North America, Raptors, Buteos, Accipiters, Falcons, Eagles, Biodiversity, Ecology, Conservation, Wildlife, Predators, Habitat loss, Falconry 2026-04-22T16:00:00.000Z yes A/V Geeks 16mm Films no 770 hawksbirds of preyraptorseaglesfalconswildlifeconservationred-tailed hawkperegrine falconbald eagle https://avgeeks.videonest.co/videos/1812599/summer-of-johnson-holiday-1971-LsMbni6MWi https://img.videonest.org/gamma/1812599_thumbnail_resized_v2.webp https://gamma.videonest.org/1812599_original_360.mp4 Summer of Johnson Holiday (1971) This documentary film provides an intimate look at the daily life of Johnson, a young Navajo boy living in the isolated and rugged landscape of Monument Valley. Through his summer experiences, the film explores the traditional Navajo "beauty way of life," highlighting strong family bonds, the roles of various family members in maintaining their remote hogan, and the responsibilities of chores like tending sheep and gathering firewood. While celebrating the cultural richness and communal closeness of the Navajo, the narrative also addresses the challenges of poverty and the inevitable encroachment of modern society. As Johnson prepares to return to school, the film contemplates the tension between preserving his indigenous heritage and embracing the educational and materialistic opportunities offered by the outside world, questioning whether he can find a balance between these two distinct paths. Navajo, Monument Valley, Reservation life, Indigenous culture, Education, Traditional lifestyle, Family values, Childhood, Cultural identity, Shepherding, Boarding schools, Modernization. 2026-04-21T16:00:00.000Z yes A/V Geeks 16mm Films no 701 https://avgeeks.videonest.co/videos/1812601/coal-the-rock-that-burns-1976-pTSWRKMgUp https://img.videonest.org/gamma/1812601_thumbnail_resized_v2.webp https://gamma.videonest.org/1812601_original_360.mp4 Coal: The Rock That Burns (1976) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film provides a comprehensive overview of the coal industry, detailing how coal is formed through geological pressure, the various grades of coal—such as anthracite, bituminous, and lignite—and the evolution of mining techniques from manual labor to modern, machine-driven processes. It explores both underground and surface mining methods, emphasizing the importance of land reclamation and ecological responsibility. Furthermore, the documentary examines the logistics of transporting coal via rail, water, and pipelines, and highlights coal’s vital role in power generation. Finally, the film discusses the environmental challenges associated with coal combustion and illustrates the diverse industrial byproducts derived from coal, including coke, tar, light oils, and ammonia, showcasing its ongoing versatility in the modern economy. Keywords: Coal, Mining, Energy, Bituminous, Anthracite, Strip Mining, Reclamation, Electricity, Byproducts, Industrialization, Fossil Fuels, Transportation 2026-04-20T16:00:00.000Z yes A/V Geeks 16mm Films no 727 https://avgeeks.videonest.co/videos/1828250/making-salads-the-student-s-choice-1984-83_ANIedyn https://i.ytimg.com/vi/bqW-VbnaONM/sddefault.jpg https://gamma.videonest.org/1828250_original_360.mp4 Making Salads.. The Student's Choice! (1984) This film explores the successful implementation of salad bars in elementary schools as a strategy to improve student nutrition and increase lunch participation rates. By adopting trends popularized by the fast-food industry—specifically the emphasis on fresh ingredients, variety, and the "finger food" appeal of dips—food service directors have successfully debunked the myth that children dislike vegetables. The program highlights how giving students the autonomy to choose their own meals fosters a sense of responsibility, significantly reduces food waste, and makes healthy eating an engaging, fun experience. Ultimately, the documentary emphasizes that through proper planning, taste-testing, and administrative support, salad bars serve as an economical and highly effective tool for modern school lunch programs. Essentially this is an ad for Hidden Valley Ranch dressing. Keywords: school lunch, salad bars, nutrition, student participation, healthy eating, food service, vegetables, child development, dietary habits, fresh food, menu planning 2026-04-23T16:00:00.000Z yes A/V Geeks 16mm Films no 797 https://avgeeks.videonest.co/videos/1830717/invasion-of-fortress-europe-etc-1940s-JG2Y1waDzF https://img.videonest.org/gamma/1830717_thumbnail_resized_v2.webp https://gamma.videonest.org/1830717_original_360.mp4 Invasion Of Fortress Europe, Etc (1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Film suffers from water damage. Also has a cartoon spliced on the end. This documentary film captures the monumental scope of the Allied invasion of Normandy during World War II, detailing the strategic preparation and the intense reality of the D-Day landings. It chronicles the massive coordination between naval, air, and ground forces as they breach the fortified "Fortress Europe," overcoming treacherous obstacles and enemy fire to establish a critical beachhead. The narrative transitions from the grim, heroic efforts of the infantry and medical corps on the sands of France to a more lighthearted, educational look at the daily operations, training, and weaponry of the United States Navy, ultimately providing a comprehensive overview of the Allied war machine’s capacity for both combat and organization. Keywords: D-Day, Normandy, World War II, Allied Forces, amphibious warfare, United States Navy, military training, combat, beachhead, naval maneuvers, General Eisenhower, fortress Europe. 2026-04-26T16:00:00.000Z yes A/V Geeks 16mm Films no 723 D-DayNormandyWorld War IIAllied Forcesamphibious warfareUnited States Navymilitary trainingcombatbeachheadnaval maneuvers https://avgeeks.videonest.co/videos/1830719/mythology-of-greece-and-rome-1969-Y4Xk63m6Gj https://img.videonest.org/gamma/1830719_thumbnail_resized_v2.webp https://gamma.videonest.org/1830719_original_360.mp4 Mythology Of Greece And Rome (1969) This film explores the function and significance of Greek and Roman mythology, which ancient civilizations developed to explain the mysteries of the natural world, human emotions, and moral conduct. Through iconic tales—such as the seasonal cycle of Ceres and Proserpina, the tragic romance of Apollo and Daphne, and the hubristic downfall of Bellerophon—the narrative illustrates how these stories served to personify natural phenomena like the weather and harvest while imparting essential cultural values. By weaving together the divine interventions of gods like Jupiter, Neptune, and Cupid with the experiences of mortals, the film highlights how these enduring myths act as a symbolic framework for understanding the complexities of the human condition. Keywords: Greek mythology, Roman mythology, gods, nature, moral lessons, Ceres, Proserpina, Apollo, Daphne, Bellerophon, Pegasus, seasons, human behavior, folklore, heritage 2026-04-25T16:00:00.000Z yes A/V Geeks 16mm Films no 922 greek mythologyroman mythologyancient greeceancient romeceresapollocupidbellerophonpegasusmoral lessonsfolkloreheritage https://avgeeks.videonest.co/videos/1830723/our-totem-is-the-raven-1971-eU8Z6MBkZn https://img.videonest.org/gamma/1830723_thumbnail_resized_v2.webp https://gamma.videonest.org/1830723_original_360.mp4 Our Totem Is The Raven (1971) This film follows a young boy named David who is taken on a traditional spirit quest by his grandfather, a member of the Raven clan, to reconnect with their ancestral heritage. Amidst the backdrop of ecological degradation and the loss of tribal lands to industrialization, the grandfather leads David through the wilderness to teach him the old ways, emphasizing the importance of resilience, nature, and the spiritual bond between their people and the land. Through physical challenges, traditional rituals, and profound storytelling, the grandfather helps David transition into manhood while lamenting the decline of their culture and the encroachment of the modern world on their sacred environment. Keywords: Spirit quest, Indigenous culture, coming of age, heritage, nature, environmentalism, Raven clan, tradition, ancestral lands, intergenerational bond 2026-04-24T16:00:00.000Z yes A/V Geeks 16mm Films no 1282 spirit questindigenous culturecoming of ageancestral landsenvironmentalismraven clanchief dan george1971 https://avgeeks.videonest.co/videos/1832987/witch-who-was-afraid-of-witches-1979-9L9FUy0j5J https://img.videonest.org/gamma/1832987_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1832987/witch-who-was-afraid-of-witches-1979-9L9FUy0j5J Witch Who Was Afraid Of Witches (1979) Animated film. Wendy is a young, timid witch who feels belittled by her bossy older sisters, who constantly mock her lack of flying ability and magical power. After losing her broomstick on Halloween, she befriends a ghost who encourages her to believe in herself, helping her discover that she can fly and cast her own unique spells. Empowered by this newfound confidence, Wendy performs a bit of harmless mischief on her sisters to teach them humility before ultimately using her magic to help them regain their powers. The story concludes with the three sisters reconciled and heading to the woods together, with Wendy finally finding her place as a capable witch who is no longer afraid. Halloween, Witches, Magic, Self-confidence, Siblings, Spells, Broomsticks, Empowerment, Friendship, Ghosts 2026-04-27T16:00:00.000Z yes A/V Geeks 16mm Films no 888 witchmagicbroomstickghostself-confidenceempowermentsistersHalloweenanimatedchildrenfantasy https://avgeeks.videonest.co/videos/1835190/village-visit-a-b-roll-silent-7_1nkqKxhq https://img.videonest.org/gamma/1835190_thumbnail_resized_v2.webp https://gamma.videonest.org/1835190_original_360.mp4 Village Visit (a/b roll, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film opens with a stylized title card reading **"VILLAGE VISIT"** against a blue background, with a silhouette of a family (man, woman, and child). It then cuts to a **home living room** scene where a housewife in a white dress kneels beside her husband, who is sitting in a chair reading a newspaper — apparently discussing the family's laundry needs. The action moves to a **Norge Self-Service Cleaning laundromat**, where the husband (wearing a plaid shirt) and wife bring their laundry to the counter. A cheerful female attendant in a teal dress assists them. There are close-up shots of the laundry being handled — including a detailed look at someone using what appears to be a **snap/rivet tool on plaid fabric**, and a prominent close-up of a washing machine's **"Load Checker" dial**, demonstrating how to properly load the machines (with markings for "Safe Load" and "Overload"). The film then takes the viewer into the **basement/utility room** of the laundromat, where the husband crouches down alongside an older, bespectacled woman (likely the facility manager or attendant) amid a network of large industrial pipes — apparently a tour of the behind-the-scenes operations of the facility. The family returns to the **main laundromat floor**, shown among racks of hanging clothes and front-loading washing machines, while their young daughter in a red coat is seen holding a small blonde doll and waiting patiently. The film closes with an end title card featuring the colorful globe logo of **"NORGE Self-Service Cleaning, presented by J&P Enterprises, Inc."** Overall, this is a mid-20th century promotional/educational silent film showcasing a family's experience visiting and using a Norge coin-operated self-service laundromat, highlighting the convenience, equipment, and clean facilities of the establishment. 2026-04-29T01:03:18.000Z yes A/V Geeks 16mm Films no 537 laundromatvintagecoin operatededucational filmadvertisingself servicefamily1950sNorgelaundry https://avgeeks.videonest.co/videos/1835191/dreamy-parachutes-mesmerizing-sky-views-you-won-t-YF4F49wWpC https://img.videonest.org/gamma/1835191_thumbnail_resized_v2.webp https://gamma.videonest.org/1835191_original_360.mp4 Dreamy Parachutes: Mesmerizing Sky Views You Won't Forget! #shorts Witness the breathtaking ballet of parachutes against the endless canvas of the sky. A moment of pure, dreamlike beauty captured in flight. #Parachute #Sky #Aviation #Dreamlike #Adventure 2026-04-29T00:03:36.000Z yes A/V Geeks 16mm Films no 19 parachutevintage filmaviationskydivingaerial display https://avgeeks.videonest.co/videos/1835192/fortune-telling-bird-predicts-your-future-at-the-a-BvhL3f1R7F https://img.videonest.org/gamma/1835192_thumbnail_resized_v2.webp https://gamma.videonest.org/1835192_original_360.mp4 Fortune Telling Bird Predicts Your Future at the Amusement Park! #shorts A fortune-telling bird sparks wonder about rocket ships, while kids enjoy a classic merry-go-round, contemplating its timeless charm and history. #AmusementPark #KidsFun #FutureTech #History 2026-04-28T23:59:50.000Z yes A/V Geeks 16mm Films no 33 fortune telling birdamusement parkvintage filmrocket shipsretronostalgia https://avgeeks.videonest.co/videos/1835193/3-lbs-lighter-roller-coaster-thrills-you-won-t-for-TnCZftqGZt https://img.videonest.org/gamma/1835193_thumbnail_resized_v2.webp https://gamma.videonest.org/1835193_original_360.mp4 3 LBS Lighter! Roller Coaster Thrills You Won't Forget! #shorts Experience the ultimate thrill! Ascend to breathtaking heights, brace for the heart-pounding drop, and feel the rush of wind as you speed through twists and turns. The carnival's most exhilarating ride awaits. #RollerCoaster #CarnivalRides #ThrillSeeker #AmusementPark #Adrenaline 2026-04-28T23:57:33.000Z yes A/V Geeks 16mm Films no 60 roller coastercarnival ridevintage coasterthrill rideamusement parkclassic film https://avgeeks.videonest.co/videos/1835194/thanks-for-watching-PEz2JYgDSP https://img.videonest.org/gamma/1835194_thumbnail_resized_v2.webp https://gamma.videonest.org/1835194_original_360.mp4 Thanks for watching We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T17:37:33.000Z yes A/V Geeks 16mm Films no 11 16mm film archivefilm storagearchival footageA/V Geeksfilm preservation https://avgeeks.videonest.co/videos/1835195/adelante-cubanos-1958-HZnRAyXbD_ https://img.videonest.org/gamma/1835195_thumbnail_resized_v2.webp https://gamma.videonest.org/1835195_original_360.mp4 Adelante Cubanos (1958) We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary celebrates the dynamism and progress of revolutionary Cuba, highlighting its industrial self-sufficiency and national pride. It shows the production of a variety of goods, from office furniture and air-conditioning equipment made from sheet metal to refrigeration components and beer production, emphasizing the quality and control of its processes. The importance of consuming Cuban products to strengthen the economy is underscored, and the inauguration of the first steel foundry is presented as a crucial step toward integrating the metallurgical industry. The film concludes with a call for unity and collective effort to build the dreamed-of Cuba, driven by faith in its destiny and sovereignty. Keywords: Cuba, revolution, industry, production, self-sufficiency, steel, beer, sheet metal, nationalism, economy, progress, sovereignty. 2026-04-28T16:40:27.000Z yes A/V Geeks 16mm Films no 632 Cubarevolutionindustrysteel productionbeer1950snationalismeconomy https://avgeeks.videonest.co/videos/1835196/life-is-a-lark-at-willow-grove-park-trWfHb0CL1 https://img.videonest.org/gamma/1835196_thumbnail_resized_v2.webp https://gamma.videonest.org/1835196_original_360.mp4 Life Is a Lark at Willow Grove Park We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The lively atmosphere at Willow Grove Park is captured through vibrant musical performances featuring diverse instruments like guitar, congas, drums, and flute. Alongside the music, the importance of continuous learning and active listening is highlighted as individuals engage in meaningful communication and interaction. 2026-04-28T16:40:24.000Z yes A/V Geeks 16mm Films no 229 Willow Grove Parkmusical performanceflutecongasdrumsguitaractive listeningmeaningful communication https://avgeeks.videonest.co/videos/1835197/wheels-of-tragedy-1963-Da-khm9lKa https://img.videonest.org/gamma/1835197_thumbnail_resized_v2.webp https://gamma.videonest.org/1835197_original_360.mp4 Wheels of Tragedy (1963) ***WARNING - ACTUAL TRAFFIC FATALITY FOOTAGE*** We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film follows a patrolman on a holiday weekend as he trains a new cadet, teaching him the realities of highway patrol. They encounter various accidents, including a fatal car and truck collision caused by a driver falling asleep due to carbon monoxide poisoning from a faulty muffler, a single-car accident resulting from loss of control and the driver not wearing a seatbelt, and a tragic incident where young people are killed in another truck collision. The film also revisits a previous victim of a severe car accident and highlights the devastating impact of negligence and human error on the road, comparing the annual number of traffic fatalities to the population of a city. Keywords: highway patrol, cadet training, traffic accidents, fatal collision, carbon monoxide, negligence, seatbelts, human error, traffic fatalities, holiday weekend. 2026-04-28T16:40:24.000Z yes A/V Geeks 16mm Films no 1663 highway patroltraffic accidentssafety filmcadet trainingfatal collision1963 https://avgeeks.videonest.co/videos/1835198/carnival-A5_aCKmaER https://img.videonest.org/gamma/1835198_thumbnail_resized_v2.webp https://gamma.videonest.org/1835198_original_360.mp4 Carnival We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film captures the exhilarating chaos and pure joy of a carnival, showcasing a vibrant array of rides and attractions. From the towering Wonder Wheel offering panoramic views to the dizzying spins of various thrill rides, the experience is a whirlwind of excitement. The boardwalk bustles with families enjoying treats, children delighting in miniature rides and a steeple chase, and the classic merriment of the carousel. The narrative also touches upon the simple pleasures like balloon catching and the ultimate adrenaline rush of the roller coaster, culminating in a final descent back to reality after a day of unadulterated fun. Keywords: Carnival, rides, Wonder Wheel, thrill rides, boardwalk, carousel, steeple chase, roller coaster, joy, excitement, family, children, fun, amusement, entertainment. 2026-04-28T16:40:23.000Z yes A/V Geeks 16mm Films no 482 carnivalrideswonder wheelroller coasteramusement parkvintage film16mm filmboardwalkfamily fun https://avgeeks.videonest.co/videos/1835199/the-heart-of-a-hero-silent-njir0S5Tfr https://img.videonest.org/gamma/1835199_thumbnail_resized_v2.webp https://gamma.videonest.org/1835199_original_360.mp4 The Heart of a Hero (silent) We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Biography of Revolutionary War patriot Nathan Hale. 2026-04-28T16:40:22.000Z yes A/V Geeks 16mm Films no 766 Nathan HaleRevolutionary War16mmSilent FilmHistorySpyAmerican RevolutionEspionage https://avgeeks.videonest.co/videos/1835200/adelante-cubanos-14-28-53-00-WqMCYiE1U- https://img.videonest.org/gamma/1835200_thumbnail_resized_v2.webp https://gamma.videonest.org/1835200_original_360.mp4 Adelante Cubanos 14 28 53 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:21.000Z yes A/V Geeks 16mm Films no 437 CubaCuban IndustryIndustrializationHousingBeauty ProductsSocial Progress1960sCuban Revolution https://avgeeks.videonest.co/videos/1835201/energia-para-las-americas-gBIlDIA7wh https://img.videonest.org/gamma/1835201_thumbnail_resized_v2.webp https://gamma.videonest.org/1835201_original_360.mp4 Energia Para Las Americas We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The documentary shows the vast geography of the Americas, from majestic glacier-covered mountains to San Francisco, emphasizing the importance of the United States and historical figures such as Bolívar and San Martín. It highlights the transformative power of water, symbolized by Iguazú Falls, and how it is harnessed for the progress and defense of the continent. Through the construction of large dams and electric power plants in the Tennessee Valley, millions of horsepower are generated, and crucial raw materials for the war industry, such as phosphorus and ammonium nitrate, are obtained. Electricity powers factories that produce everything from canvas and uniforms to boots and aircraft components, also using manganese and alumina. The valley’s underground resources provide essential minerals for manufacturing ammunition. The film concludes by showing the air and ground strength of the United States, represented by powerful airplanes and mechanized forces, reiterating that all this industrial and military effort is dedicated to preserving the freedom and spirit of the Americas against global threats. 2026-04-28T16:40:19.000Z yes A/V Geeks 16mm Films no 832 AmericasenergydefenseindustryBolivarSan Martinwater powerTennessee Valleyraw materialsmilitary strengthfreedom https://avgeeks.videonest.co/videos/1835202/0451-heart-of-a-hero-the-01-00-38-00-3mb-KNww4exEGS https://img.videonest.org/gamma/1835202_thumbnail_resized_v2.webp https://gamma.videonest.org/1835202_original_360.mp4 0451 Heart of a Hero The 01 00 38 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:19.000Z yes A/V Geeks 16mm Films no 708 nathan haleamerican revolutionrevolutionary warsilent film16mm filmprelinger archiveshistorical dramaamerican history https://avgeeks.videonest.co/videos/1835203/0408-life-is-a-lark-at-willow-grove-park-00-21-35-rrXhiTyL7Z https://img.videonest.org/gamma/1835203_thumbnail_resized_v2.webp https://gamma.videonest.org/1835203_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 21 35 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:17.000Z yes A/V Geeks 16mm Films no 314 jazzlive musicWillow Grove Park16mm filmvintage musicbandperformancedrumsbass guitarconga https://avgeeks.videonest.co/videos/1835204/home-movies-hoffman-43-silent-TnhcowDEDH https://img.videonest.org/gamma/1835204_thumbnail_resized_v2.webp https://gamma.videonest.org/1835204_original_360.mp4 Home Movies - Hoffman 43 (silent) We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This 1940s home movie documents a wide-ranging family road trip through the American West and Midwest, mixing scenic travel footage with tourist attractions and community events. It begins with highway travel through mountains, tunnels, valleys, and overlooks, then lingers on rodeo scenes with cowboys, cowgirls, bronco riding, steer wrestling, calf roping, horse racing, and spectators. Much of the film follows a Colorado mountain vacation through Big Thompson Canyon, Estes Park, Rocky Mountain National Park, Bear Lake, Glacier Basin, Trail Ridge Road, snowy passes, lakes, wildlife, chipmunks, deer, cabins, campgrounds, and roadside views. Later sections shift to historic and recreational attractions, including Mackinac Island, horse-drawn carriages, forts, Arch Rock, Skull Cave, Lake Huron boat rides, waterfront scenes, mining/quarry visits, a carnival, parade, Spud Rodeo festivities, and more rodeo events. Overall, the film captures mid-century American auto tourism, outdoor recreation, western spectacle, family sightseeing, and roadside Americana. 2026-04-28T16:40:17.000Z yes A/V Geeks 16mm Films no 3025 1940shome moviesroad tripAmerican WestMidwestrodeoRocky MountainsMackinac Islandauto tourismroadside Americana https://avgeeks.videonest.co/videos/1835205/modern-home-has-helipad-on-roof-KuZj3C3sjO https://img.videonest.org/gamma/1835205_thumbnail_resized_v2.webp https://gamma.videonest.org/1835205_original_360.mp4 [Modern Home has Helipad on Roof ] We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Ray Nichols commutes from his office to his home in the Oakland hills by car, a journey that takes him 20 minutes. However, after acquiring a helicopter, his commute is reduced to just a few minutes, allowing him to arrive home to his granddaughter. The transcript then describes his home, known as the "Sequoia House," which is a modern, rugged structure built with a steel framework and featuring expansive glass walls that offer panoramic views of San Francisco Bay. Every room in the house has access to a deck or garden, while still maintaining complete privacy. Keywords: helicopter commute, modern home, steel framework, panoramic views, San Francisco Bay, privacy, architect, interior design, landscaping, decks, gardens 2026-04-28T16:40:17.000Z yes A/V Geeks 16mm Films no 49 helicopter commutemodern homeOakland hillssteel frameworkSan Francisco Bayhelipad https://avgeeks.videonest.co/videos/1835206/1021-hiroshima-aerial-footage-mos-irhFhBgW1e https://img.videonest.org/gamma/1835206_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1835206/1021-hiroshima-aerial-footage-mos-irhFhBgW1e 1021 Hiroshima Aerial Footage MOS We digitized and uploaded this film from the Prelinger Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:16.000Z yes A/V Geeks 16mm Films no 485 hiroshimaaerial footageatomic bombworld war 2japanhistorical footageprelinger archive16mm film https://avgeeks.videonest.co/videos/1835207/0457-elsie-presents-bordens-cottage-cheese-01-00-5-o_bn7alyaE https://img.videonest.org/gamma/1835207_thumbnail_resized_v2.webp https://gamma.videonest.org/1835207_original_360.mp4 0457 Elsie Presents Bordens Cottage Cheese 01 00 59 03 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:15.000Z yes A/V Geeks 16mm Films no 1378 Borden'sElsie the Cowcottage cheesedairycheese makingvintage ad16mm filmPrelinger Archivesfood historyprocessed food https://avgeeks.videonest.co/videos/1835208/1018-hidden-values-mos-9R0f9PMFYb https://img.videonest.org/gamma/1835208_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1835208/1018-hidden-values-mos-9R0f9PMFYb 1018 Hidden Values MOS We digitized and uploaded this film from the Prelinger Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:14.000Z yes A/V Geeks 16mm Films no 1184 American Standardplumbing fixturesmanufacturing processvintage industrial16mm filmPrelinger Archiveproduction linebathroom fixturesfaucetslavatories https://avgeeks.videonest.co/videos/1835209/0381-san-francisco-welcomes-lions-international-40-emkRjkfiv0 https://img.videonest.org/gamma/1835209_thumbnail_resized_v2.webp https://gamma.videonest.org/1835209_original_360.mp4 0381 San Francisco Welcomes Lions International 40th Anniversary Con 12 54 28 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:14.000Z yes A/V Geeks 16mm Films no 40 San FranciscoLions InternationalParade1957VintageArchive FootageCalifornia https://avgeeks.videonest.co/videos/1835210/0381-picture-puzzle-aids-in-criminal-identificatio-JjZKEJDW1i https://img.videonest.org/gamma/1835210_thumbnail_resized_v2.webp https://gamma.videonest.org/1835210_original_360.mp4 0381 Picture Puzzle Aids in Criminal Identification 12 55 02 27 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:14.000Z yes A/V Geeks 16mm Films no 48 criminal identificationpicture puzzlerogues gallerypolicelaw enforcementcrime https://avgeeks.videonest.co/videos/1835211/0452-california-rodeo-at-salinas-01-34-55-15-3mb-rPtsedzqwD https://img.videonest.org/gamma/1835211_thumbnail_resized_v2.webp https://gamma.videonest.org/1835211_original_360.mp4 0452 California Rodeo at Salinas 01 34 55 15 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:13.000Z yes A/V Geeks 16mm Films no 509 rodeosalinascaliforniawild westcowboyscowgirlsbull ridinghorse ridingvintage16mm filmarchival https://avgeeks.videonest.co/videos/1835212/hoff-062-1941mardigras-_j_37dQSLT https://img.videonest.org/gamma/1835212_thumbnail_resized_v2.webp https://gamma.videonest.org/1835212_original_360.mp4 HOFF 062 1941MardiGras We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:13.000Z yes A/V Geeks 16mm Films no 1013 Mardi GrasNew Orleans1941Vintage16mm filmParadeLouisianaFloatsCarnival https://avgeeks.videonest.co/videos/1835213/1017-frozen-freshness-mos-Q8zt7xZMAV https://img.videonest.org/gamma/1835213_thumbnail_resized_v2.webp https://gamma.videonest.org/1835213_original_360.mp4 1017 Frozen Freshness MOS We digitized and uploaded this film from the Prelinger Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:12.000Z yes A/V Geeks 16mm Films no 591 food preservationfreezing foodvintage refrigeratorFrigidaire1950shome economicsstate fairfrozen foods https://avgeeks.videonest.co/videos/1835214/0388-historical-review-of-incineration-20-41-13-20-wRsl1cox1S https://img.videonest.org/gamma/1835214_thumbnail_resized_v2.webp https://gamma.videonest.org/1835214_original_360.mp4 0388 Historical Review of Incineration 20 41 13 20 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:12.000Z yes A/V Geeks 16mm Films no 1047 incinerationgarbage disposalwaste managementhistorical footage16mm filmhog feedingenvironmental history https://avgeeks.videonest.co/videos/1835215/0381-mt-tamalpais-air-force-station-marin-county-c-9tQ8G2L0j2 https://img.videonest.org/gamma/1835215_thumbnail_resized_v2.webp https://gamma.videonest.org/1835215_original_360.mp4 0381 Mt Tamalpais Air Force Station Marin County California 12 46 55 05 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:12.000Z yes A/V Geeks 16mm Films no 52 Mt TamalpaisAir Force StationMarin CountyCaliforniaCold WarRadarAircraft ControlWarning CenterSan FranciscoHamilton Air Force Base https://avgeeks.videonest.co/videos/1835216/typesetting-linotype-1960-_StcqHFgau https://img.videonest.org/gamma/1835216_thumbnail_resized_v2.webp https://gamma.videonest.org/1835216_original_360.mp4 Typesetting Linotype (1960?) The film explores the intricate workings of mechanical typesetting machines, particularly the linotype and intertype machines, which revolutionized printing in the late 19th century. It details the process of composing, casting, and distributing type for printing, emphasizing the roles of various components such as keyboards, matrices, and casting mechanisms. The film also highlights advancements in automation, including the use of perforated tape to operate the machines without direct human intervention, allowing for high-speed typesetting essential for modern publishing. Keywords typesetting, linotype, intertype, mechanical machines, printing process, automation, matrices, casting, publishing, high-speed typesetting We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:11.000Z yes A/V Geeks 16mm Films no 2131 typesettinglinotypeintertypeprinting processmechanical machinesautomationmatricescastingprinting history https://avgeeks.videonest.co/videos/1835217/0408-life-is-a-lark-at-willow-grove-park-00-06-39-_4fDx0HPCD https://img.videonest.org/gamma/1835217_thumbnail_resized_v2.webp https://gamma.videonest.org/1835217_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 06 39 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:11.000Z yes A/V Geeks 16mm Films no 238 Bob HornKing of KingsSoul16mm filmvintage performancegoing in circles https://avgeeks.videonest.co/videos/1835218/0065-world-at-war-01-00-42-20-JiO0Hlmq9W https://img.videonest.org/gamma/1835218_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835218_video_v5_360.mp4 0065 World at War 01 00 42 20 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:10.000Z yes A/V Geeks 16mm Films no 2610 https://avgeeks.videonest.co/videos/1835219/carelesswithfilm-template-W_btkIOU9M https://img.videonest.org/gamma/1835219_thumbnail_resized_v2.webp https://gamma.videonest.org/1835219_original_360.mp4 CarelessWithFilm Template this for making a template 2026-04-28T16:40:10.000Z yes A/V Geeks 16mm Films no 60 16mm filmfilm projectorfilm handlingvintage filmarchival film https://avgeeks.videonest.co/videos/1835220/0451-heart-of-a-hero-the-01-12-28-17-3mb-qq_o3wPCLk https://img.videonest.org/gamma/1835220_thumbnail_resized_v2.webp https://gamma.videonest.org/1835220_original_360.mp4 0451 Heart of a Hero The 01 12 28 17 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:09.000Z yes A/V Geeks 16mm Films no 920 silent film16mm filmamerican revolutionspyespionagenathan halewidow chichesterking georgerevolutionary warhistorical drama https://avgeeks.videonest.co/videos/1835221/hoff48-wWwC4xy4xo https://img.videonest.org/gamma/1835221_thumbnail_resized_v2.webp https://gamma.videonest.org/1835221_original_360.mp4 HOFF48 We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:07.000Z yes A/V Geeks 16mm Films no 2809 coloradomountainsscenicnational parktravel16mm filmvintage footagenaturehistoricalgarden of the godspikes peakroyal gorge https://avgeeks.videonest.co/videos/1835222/0408-life-is-a-lark-at-willow-grove-park-00-18-13-pBZyJ18Iu8 https://img.videonest.org/gamma/1835222_thumbnail_resized_v2.webp https://gamma.videonest.org/1835222_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 18 13 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:06.000Z yes A/V Geeks 16mm Films no 191 Latin jazzWillow Grove Parkconcertlive musicvintage film16mm filmbandconga drumsbass guitar https://avgeeks.videonest.co/videos/1835223/psareelten-ixeadQkNUR https://img.videonest.org/gamma/1835223_thumbnail_resized_v2.webp https://gamma.videonest.org/1835223_original_360.mp4 PSAReelTen We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:06.000Z yes A/V Geeks 16mm Films no 1356 public service announcementPSA1970sretrovintagefilmarchiveeducationsafety https://avgeeks.videonest.co/videos/1835224/hoff45-d8y8az2kUz https://img.videonest.org/gamma/1835224_thumbnail_resized_v2.webp https://gamma.videonest.org/1835224_original_360.mp4 Hoff45 We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:05.000Z yes A/V Geeks 16mm Films no 2828 Floridavintagetravelbeachswimmingdiving16mm film https://avgeeks.videonest.co/videos/1835225/kingisdead-JwAtY5OzPX https://img.videonest.org/gamma/1835225_thumbnail_resized_v2.webp https://gamma.videonest.org/1835225_original_360.mp4 KingIsDead We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:40:02.000Z yes A/V Geeks 16mm Films no 332 Martin Luther King JrMLKAssassinationCivil Rights Movement1960sBlack HistoryActivismSocial Justice https://avgeeks.videonest.co/videos/1835226/0950-china-at-the-front-NXX1mAYtkW https://img.videonest.org/gamma/1835226_thumbnail_resized_v2.webp https://gamma.videonest.org/1835226_original_360.mp4 0950 China At The Front Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:35.000Z yes A/V Geeks 16mm Films no 907 China16mm filmwarmilitaryarmyartillerycavalryinfantrywarlordshistorical footage1920ssoldiers https://avgeeks.videonest.co/videos/1835227/checkmate-on-the-hudson-1975-x69qmeABv6 https://img.videonest.org/gamma/1835227_thumbnail_resized_v2.webp https://gamma.videonest.org/1835227_original_360.mp4 Checkmate On The Hudson (1975) The film "Checkmate on the Hudson" recounts the historical significance of the Hudson River during the American Revolutionary War, highlighting the intense struggles and battles between American patriots and British loyalists. It follows the experiences of William McCarthy, a local farmer, as he navigates the conflicts and divided loyalties in the region. The narrative details key battles, particularly the engagements around Saratoga, showcasing the strategies and leadership of figures like General Gates and General Burgoyne. The film emphasizes the emotional toll of war, the grim realities of battle, and the eventual turning point at Saratoga, which led to American victory and French support. Keywords Hudson River, American Revolutionary War, William McCarthy, Saratoga, General Gates, General Burgoyne, divided loyalties, battles, strategies, turning point, French support. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:27.000Z yes A/V Geeks 16mm Films no 1216 hudson riverrevolutionary warsaratogageneral gatesgeneral burgoynewilliam mccarthyamerican history1775new york state https://avgeeks.videonest.co/videos/1835228/december7dayofinfamyreel2-ebeA_SM3ql https://img.videonest.org/gamma/1835228_thumbnail_resized_v2.webp https://gamma.videonest.org/1835228_original_360.mp4 December7DayOfInfamyReel2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:23.000Z yes A/V Geeks 16mm Films no 1555 pearl harborjapanworld war 2Japanese militaryJapanese navyIndochinaNankingFranklin RooseveltTreatyUS fleetmilitary https://avgeeks.videonest.co/videos/1835229/making-a-skyscraper-steel-empire-state-bldg-silent-cv00TNQXWN https://img.videonest.org/gamma/1835229_thumbnail_resized_v2.webp https://gamma.videonest.org/1835229_original_360.mp4 Making A Skyscraper (Steel) "Empire State Bldg. (silent, 1930s) *Making a Skyscraper (Steel) "Empire State Bldg."* is a black-and-white, silent film from around 1930 that documents the early construction stages of the Empire State Building in New York City. The film highlights the process of manufacturing steel structural beams and their assembly at the construction site. It includes animation sequences that explain the engineering behind the building’s steel framework. The footage captures workers connecting floor beams and panels, showcasing the meticulous effort involved in erecting one of the world’s most iconic skyscrapers. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:21.000Z yes A/V Geeks 16mm Films no 645 Empire State BuildingSkyscraperConstructionSteel1930sNew York CityVintage filmHistorical footageBuilding constructionSteel beams https://avgeeks.videonest.co/videos/1835230/the-character-of-oedipus-1959-yaftHPazt5 https://img.videonest.org/gamma/1835230_thumbnail_resized_v2.webp https://gamma.videonest.org/1835230_original_360.mp4 The Character of Oedipus (1959) The film discusses Sophocles' play "Oedipus the King," highlighting its themes of fate, self-discovery, and the conflict between old beliefs and new ideas. It portrays Oedipus as a detective seeking the truth behind King Laius's murder, unaware that he himself is the killer and the son of Laius and Jocasta. The narrative unfolds as Oedipus's relentless pursuit of knowledge leads him to uncover his tragic fate, fulfilling a prophecy that foretold he would kill his father and marry his mother. The exploration of Oedipus's character reveals his admirable qualities, while also questioning the nature of fate and divine intervention in human affairs. Keywords Oedipus, Sophocles, tragedy, fate, prophecy, self-discovery, murder, King Laius, Jocasta, Greek drama, character analysis, divine intervention 2026-04-28T16:38:21.000Z yes A/V Geeks 16mm Films no 1786 OedipusSophoclesGreek tragedyfateself-discoveryOedipus Rex https://avgeeks.videonest.co/videos/1835231/phxinstrumentsofbandandorchestrapercussions-0B7MuDBMZW https://img.videonest.org/gamma/1835231_thumbnail_resized_v2.webp https://gamma.videonest.org/1835231_original_360.mp4 PHXInstrumentsOfBandAndOrchestraPercussions Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:20.000Z yes A/V Geeks 16mm Films no 3881 https://avgeeks.videonest.co/videos/1835232/0387-edison-newsreels-san-francisco-earthquake-aft-8ruhKav78M https://img.videonest.org/gamma/1835232_thumbnail_resized_v2.webp https://gamma.videonest.org/1835232_original_360.mp4 0387 Edison Newsreels San Francisco Earthquake Aftermath Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:20.000Z yes A/V Geeks 16mm Films no 1416 San Francisco1906 EarthquakeEdison NewsreelNatural DisasterHistorical FootageEarthquake AftermathSan Francisco History https://avgeeks.videonest.co/videos/1835233/one-hundred-years-of-progress-silent-1963-C48sx74PUw https://img.videonest.org/gamma/1835233_thumbnail_resized_v2.webp https://gamma.videonest.org/1835233_original_360.mp4 One Hundred Years of Progress (silent, 1963) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 378 1963March on WashingtonCivil Rights MovementAfrican American Historyprotest https://avgeeks.videonest.co/videos/1835234/0387-trip-down-market-street-before-fire-PAiOIQruI2 https://img.videonest.org/gamma/1835234_thumbnail_resized_v2.webp https://gamma.videonest.org/1835234_original_360.mp4 0387 Trip Down Market Street Before Fire Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 841 Market StreetSan Francisco1900shistorical footagevintage filmstreet scenetransportationCalifornia history https://avgeeks.videonest.co/videos/1835235/0734-belles-of-the-south-seas-03-01-21-00-yChu0x_2IU https://img.videonest.org/gamma/1835235_thumbnail_resized_v2.webp https://gamma.videonest.org/1835235_original_360.mp4 0734 Belles of the South Seas 03 01 21 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 578 South SeasTahitiFijiSamoaPapuaTravelogue16mmVintagePacific IslandsCulture https://avgeeks.videonest.co/videos/1835236/dance-little-children-1961-34EA4wSDEV https://img.videonest.org/gamma/1835236_thumbnail_resized_v2.webp https://gamma.videonest.org/1835236_original_360.mp4 Dance Little Children (1961) "Dance Little Children" explores the impact of a syphilis outbreak in the fictional town of Oakdale, revealing the hidden struggles of its teenagers, particularly focusing on Lyn Corwin and Hal Grover. The film highlights the societal pressures surrounding youth, the stigma of sexually transmitted diseases, and the challenges faced by health officials in managing the crisis. As the community grapples with the reality of the outbreak, the narrative emphasizes the need for understanding, education, and responsibility among both the youth and their parents. Keywords syphilis, outbreak, teenagers, Oakdale, health department, societal pressure, sexual education, stigma, responsibility, community Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 1490 syphilisoutbreakteenagersSTDsexual health1960sstigmasexual educationhealth department https://avgeeks.videonest.co/videos/1835237/yuxtapongo-32-mp4-i02zJOL6z4 https://img.videonest.org/gamma/1835237_thumbnail_resized_v2.webp https://gamma.videonest.org/1835237_original_360.mp4 Yuxtapongo 32.mp4 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 1711 television historyCBS Electronicvideo recordingLeonard Nimoyratsrodentsblack and white filmvintagerat fightpsychedelic fashionvintage dresses1970s fashionHoneycomb cerealcereal advertisementpsychedelic montage https://avgeeks.videonest.co/videos/1835238/watch-along-the-watershed-1981-_by24mBUvr https://img.videonest.org/gamma/1835238_thumbnail_resized_v2.webp https://gamma.videonest.org/1835238_original_360.mp4 Watch Along The Watershed (1981) "Watch Along the Watershed" chronicles the efforts of communities and industries in Pennsylvania to establish a flood warning system following the devastating floods of 1972. The film highlights the importance of preparedness and coordination among local citizens, government agencies, and private industries to mitigate flood damage. Through a network of volunteers and advanced monitoring techniques, the system allows for timely alerts to protect lives and property, demonstrating how communities can adapt and respond to natural disasters. Keywords flood warning system, preparedness, community response, Pennsylvania, 1972 flood, coordination, volunteers, flood monitoring, disaster management, economic impact Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:19.000Z yes A/V Geeks 16mm Films no 1280 flood warning systemflood preparednesscommunity responsePennsylvania1972 flooddisaster management https://avgeeks.videonest.co/videos/1835239/dynamics-of-the-circle-1963-oaAmud01cg https://img.videonest.org/gamma/1835239_thumbnail_resized_v2.webp https://gamma.videonest.org/1835239_original_360.mp4 Dynamics Of The Circle (1963) The film discusses the fundamental properties and concepts related to circles. It explains the definitions of key terms such as radius, chord, diameter, arcs, and central angles. The relationship between central angles and their intercepted arcs is outlined, emphasizing that equal central angles lead to equal arcs in the same circle. The film also covers the significance of perpendicular chords and their relationship with the circle's center, highlighting how distances from the center affect chord lengths. Additionally, it reinforces the principles of congruence and equality in arcs and chords, summarizing the geometric relationships that govern circles. Keywords circle, radius, chord, diameter, arc, central angle, congruent circles, geometric relationships, perpendicular bisector, arc equality Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:18.000Z yes A/V Geeks 16mm Films no 835 circleradiuschorddiameterarccentral anglegeometrygeometric relationships https://avgeeks.videonest.co/videos/1835240/0561-pictures-of-various-member-of-the-mallinckrod-BUuwZkwjgJ https://img.videonest.org/gamma/1835240_thumbnail_resized_v2.webp https://gamma.videonest.org/1835240_original_360.mp4 0561 Pictures of Various Member of The Mallinckrodt Organization 193 12 40 10 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:17.000Z yes A/V Geeks 16mm Films no 673 MallinckrodtChemical Works1935Employee PicturesSt. LouisIndustrial History16mm film https://avgeeks.videonest.co/videos/1835241/0734-red-haired-riot-burlesque-other-burlesque-str-pGXoD8fEfO https://img.videonest.org/gamma/1835241_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835241_video_v5_360.mp4 0734 Red Haired Riot Burlesque Other Burlesque Strippers Program 1 03 10 59 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:17.000Z yes A/V Geeks 16mm Films no 2252 https://avgeeks.videonest.co/videos/1835242/keystone-readers-service-silent-footage-ruzBBO3xmC https://img.videonest.org/gamma/1835242_thumbnail_resized_v2.webp https://gamma.videonest.org/1835242_original_360.mp4 ["Keystone Readers Service", silent, footage] This is silent footage for a promotional film for a "Keystone Readers Service" contest, documenting a prize trip to California for contest winners. It features scripted dramatic segments with a young male protagonist, intercut with genuine travel footage of the winners enjoying California attractions — including amusement parks (likely Knott's Berry Farm or similar), a zoo, the beach, and city sightseeing via a branded charter bus. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:16.000Z yes A/V Geeks 16mm Films no 813 16mm filmKeystone Readers ServiceCalifornia triptravel footagevintage travelamusement parkSan Diego ZooDisneyland https://avgeeks.videonest.co/videos/1835243/0945-along-the-new-england-coast-Detq1IgIug https://img.videonest.org/gamma/1835243_thumbnail_resized_v2.webp https://gamma.videonest.org/1835243_original_360.mp4 0945 Along The New England Coast Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:16.000Z yes A/V Geeks 16mm Films no 968 New England coast16mm filmPenobscot tribeUS submarinesProvincetownHistorical footageVintage film https://avgeeks.videonest.co/videos/1835244/oaseed-seeddisposal-B-gbiC9l6k https://img.videonest.org/gamma/1835244_thumbnail_resized_v2.webp https://gamma.videonest.org/1835244_original_360.mp4 OASeed&SeedDisposal Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:16.000Z yes A/V Geeks 16mm Films no 458 seed dispersal16mm filmbotanynatureplant reproductionflowersseeds https://avgeeks.videonest.co/videos/1835245/0950-american-tanks-in-china--8twhEGdOf https://img.videonest.org/gamma/1835245_thumbnail_resized_v2.webp https://gamma.videonest.org/1835245_original_360.mp4 0950 American Tanks In China Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:15.000Z yes A/V Geeks 16mm Films no 248 American tanksChinaUS troopsChinese Revolution16mm filmarchival footagemilitaryhistorical footagetanks https://avgeeks.videonest.co/videos/1835246/0951-blind-leaders-Fldlky5lHk https://img.videonest.org/gamma/1835246_thumbnail_resized_v2.webp https://gamma.videonest.org/1835246_original_360.mp4 0951 Blind Leaders Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:15.000Z yes A/V Geeks 16mm Films no 884 PhariseeshypocrisyJesusSanhedrinreligion16mm filmold filmBiblebiblical https://avgeeks.videonest.co/videos/1835247/flowers-growing-and-opening-silent-1930s-i5tdEDZgeH https://img.videonest.org/gamma/1835247_thumbnail_resized_v2.webp https://gamma.videonest.org/1835247_original_360.mp4 Flowers Growing And Opening (silent, 1930s) Looks at different flowers and how they grow. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:13.000Z yes A/V Geeks 16mm Films no 1225 16mm filmtime lapseflowersMissouri Botanical Gardensvintage flowersplant lifeorchidlilyroseflower growth https://avgeeks.videonest.co/videos/1835248/0490-reel-fun-in-oregon-0fmARQgVQ_ https://img.videonest.org/gamma/1835248_thumbnail_resized_v2.webp https://gamma.videonest.org/1835248_original_360.mp4 0490 Reel Fun In Oregon Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:13.000Z yes A/V Geeks 16mm Films no 2881 fishingfly fishingOregonriver fishinglakeboatoutdoorsfishing rodfishing fliescatching fishrivercampingfishing techniquesvintage fishingfish https://avgeeks.videonest.co/videos/1835249/explaining-matter-molecules-in-motion-1959-_6C_o-oyYq https://img.videonest.org/gamma/1835249_thumbnail_resized_v2.webp https://gamma.videonest.org/1835249_original_360.mp4 Explaining Matter - Molecules in Motion (1959) The film explains the concept of matter, molecules, and their motion, illustrating how materials exist in different states: solid, liquid, and gas. Through experiments with water, evaporation, and temperature changes, it demonstrates how molecules behave and interact, explaining physical changes and the principles of pressure. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:12.000Z yes A/V Geeks 16mm Films no 1158 moleculesmatterstates of mattersolidliquidgasevaporationpressuresciencephysicschemistrymotion https://avgeeks.videonest.co/videos/1835250/the-honey-maker-silent-a8dJWERP3v https://img.videonest.org/gamma/1835250_thumbnail_resized_v2.webp https://gamma.videonest.org/1835250_original_360.mp4 The Honey Maker (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:12.000Z yes A/V Geeks 16mm Films no 466 honey beebeekeeping16mm filmbeeshoneycombinsectsentomologyvintage filmeducational filmbee life cycle https://avgeeks.videonest.co/videos/1835251/pedophile-rfEQZ_pTT_ https://img.videonest.org/gamma/1835251_thumbnail_resized_v2.webp https://gamma.videonest.org/1835251_original_360.mp4 Pedophile Rare Sid Davis film covering one of his favorite subjects - sexual predators. This features a Robert Fuller (TV's Emergency) as the host narrator. Higher quality versions of this film can also be licensed for stock footage. Contact footage@avgeeks.com for more information. 2026-04-28T16:38:11.000Z yes A/V Geeks 16mm Films no 1263 pedophilechild molestersexual predatorSid DavisRobert Fullerchild safety https://avgeeks.videonest.co/videos/1835252/jack-and-the-beanstalk-WGQGvVyvhh https://img.videonest.org/gamma/1835252_thumbnail_resized_v2.webp https://gamma.videonest.org/1835252_original_360.mp4 Jack And The Beanstalk Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:10.000Z yes A/V Geeks 16mm Films no 593 jack and the beanstalkpuppetanimation16mm filmfairy talebilly boodle https://avgeeks.videonest.co/videos/1835253/phxindianinfluencesintheusa-silent-raw-F9H2U6XMIO https://img.videonest.org/gamma/1835253_thumbnail_resized_v2.webp https://gamma.videonest.org/1835253_original_360.mp4 PHXIndianInfluencesInTheUSA (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:10.000Z yes A/V Geeks 16mm Films no 630 Native AmericanIndian influencesUSAartculturehistorycraftspaintings https://avgeeks.videonest.co/videos/1835254/6115-untitled-france-part-2-01-17-19-00-PUbAS-IvN0 https://img.videonest.org/gamma/1835254_thumbnail_resized_v2.webp https://gamma.videonest.org/1835254_original_360.mp4 6115 Untitled France part 2 01 17 19 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:10.000Z yes A/V Geeks 16mm Films no 980 France16mm filmtravelvintage travelhistorical footageFrance travel https://avgeeks.videonest.co/videos/1835255/phxatomsandnuclearenergy-raw-XwUV_AePYp https://img.videonest.org/gamma/1835255_thumbnail_resized_v2.webp https://gamma.videonest.org/1835255_original_360.mp4 PHXAtomsAndNuclearEnergy (raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:09.000Z yes A/V Geeks 16mm Films no 512 atomsnuclear energy16mm filmradiumuraniumhydrogencarbonelementsscience education https://avgeeks.videonest.co/videos/1835256/0950-china-and-the-chinese-E44Zxsb6Uu https://img.videonest.org/gamma/1835256_thumbnail_resized_v2.webp https://gamma.videonest.org/1835256_original_360.mp4 0950 China And The Chinese Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:07.000Z yes A/V Geeks 16mm Films no 479 ChinaChinese cultureVintage film16mmPekingHong KongShanghai https://avgeeks.videonest.co/videos/1835257/phxarithmeticunderstandingtheproblem-silent-raw-pbUYuP1sXt https://img.videonest.org/gamma/1835257_thumbnail_resized_v2.webp https://gamma.videonest.org/1835257_original_360.mp4 PHXArithmeticUnderstandingTheProblem (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:07.000Z yes A/V Geeks 16mm Films no 443 arithmeticmatheducationvintage film16mmschoollearningadditionsubtractionmultiplicationdivision https://avgeeks.videonest.co/videos/1835258/6147-sea-elephants-and-sea-lions-01-37-29-06-kCdKWLWIRn https://img.videonest.org/gamma/1835258_thumbnail_resized_v2.webp https://gamma.videonest.org/1835258_original_360.mp4 6147 Sea Elephants and Sea Lions 01 37 29 06 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:06.000Z yes A/V Geeks 16mm Films no 996 sea elephantssea lionsmarine lifevintage film16mm filmwildlife footagesealsanimal behavior https://avgeeks.videonest.co/videos/1835259/flowering-trees-of-hawaii-silent-2Px2RWhTDn https://img.videonest.org/gamma/1835259_thumbnail_resized_v2.webp https://gamma.videonest.org/1835259_original_360.mp4 Flowering Trees Of Hawaii (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:05.000Z yes A/V Geeks 16mm Films no 674 Hawaiitropical treesflowering treestropical flowersplumeriahibiscuslychee treemango treeexotic plantsisland life https://avgeeks.videonest.co/videos/1835260/personal-hygiene-for-young-men-silent-SY5Degmz9- https://img.videonest.org/gamma/1835260_thumbnail_resized_v2.webp https://gamma.videonest.org/1835260_original_360.mp4 Personal Hygiene For Young Men (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:05.000Z yes A/V Geeks 16mm Films no 894 personal hygienehealthsex educationgonorrheasyphilis https://avgeeks.videonest.co/videos/1835261/0339-nature-reel-16-52-08-00-2qT4hMG_Ab https://img.videonest.org/gamma/1835261_thumbnail_resized_v2.webp https://gamma.videonest.org/1835261_original_360.mp4 0339 Nature Reel 16 52 08 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:05.000Z yes A/V Geeks 16mm Films no 535 16mm filmvintageanimalschildrencomedydogsbeaveralligatorsquirrelowldonkeystuffed animalsschoolblack and white https://avgeeks.videonest.co/videos/1835262/food-part-i-1950s-Ct2pUEOKvT https://img.videonest.org/gamma/1835262_thumbnail_resized_v2.webp https://gamma.videonest.org/1835262_original_360.mp4 Food (Part I, 1950s) The film showcases three traditional Japanese meals enjoyed at the Chinzanso restaurant in Tokyo, highlighting the unique cooking styles and flavors of Jingus Khan barbecue, Sukiyaki, and Tempura. Jingus Khan features meats grilled over charcoal with savory sauces, while Sukiyaki is known for its tender meat and sweet sauce, served with a raw egg. Tempura involves deep-frying seafood and vegetables, requiring precise timing and technique. The film emphasizes the cultural experience of dining in Japan and encourages viewers to explore these culinary delights. Keywords Japanese cuisine, Jingus Khan, Sukiyaki, Tempura, Chinzanso, Tokyo, barbecue, cooking styles, traditional meals Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:05.000Z yes A/V Geeks 16mm Films no 314 Japanese cuisineJingus KhanSukiyakiTempuraChinzansoTokyobarbecuecooking stylestraditional meals1950sJapan https://avgeeks.videonest.co/videos/1835263/measurement-in-a-food-store-can-1-2-silent-raw-foo-ARNvoY_cZt https://img.videonest.org/gamma/1835263_thumbnail_resized_v2.webp https://gamma.videonest.org/1835263_original_360.mp4 Measurement In A Food Store, Can 1-2 (silent, raw footage, 1960s) Raw silent footage from the educational film, Measurement in a Food Store, from the 1960s is a vintage educational film that teaches concepts of measurement, weight, and comparison in a real-world setting. The footage follows shoppers, including adults and children, as they navigate a grocery store, selecting produce, weighing items on scales, checking labels, and discussing differences in size, weight, and pricing. Scenes highlight practical applications of measurement through everyday shopping experiences, such as comparing oranges, potatoes, and packaged goods, while store clerks and cashiers demonstrate weighing and checkout processes. With instructional moments featuring scales, measurement tools, and real-world decision-making, the film reinforces the importance of mathematics and consumer awareness in daily life, making it an engaging and practical learning tool for students. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:05.000Z yes A/V Geeks 16mm Films no 1483 1960sgrocery storeshoppingmeasurementeducational filmvintage filmraw footagefood storeretro16mm https://avgeeks.videonest.co/videos/1835264/0323-little-journey-to-england-and-france-july-7th-ARs_cQUOvl https://img.videonest.org/gamma/1835264_thumbnail_resized_v2.webp https://gamma.videonest.org/1835264_original_360.mp4 0323 Little Journey to England and France July 7th to August 16th 19 01 00 55 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:04.000Z yes A/V Geeks 16mm Films no 3278 LondonEnglandvintage filmBritish historyLondon landmarksBuckingham PalaceChanging of the GuardTower of LondonWestminster Abbeytravelhistorical sitesBritish cultureocean linerQueen Mary1930s https://avgeeks.videonest.co/videos/1835265/0949-structure-of-the-earth-earthquakes-8v188JHpk2 https://img.videonest.org/gamma/1835265_thumbnail_resized_v2.webp https://gamma.videonest.org/1835265_original_360.mp4 0949 Structure Of The Earth Earthquakes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:04.000Z yes A/V Geeks 16mm Films no 1020 earthquakeseismologyjapantokyodisaster1923sanata barbaraseismographfault linestectonic plates https://avgeeks.videonest.co/videos/1835266/rr342-appcli-10-TIZpcosg7J https://img.videonest.org/gamma/1835266_thumbnail_resized_v2.webp https://gamma.videonest.org/1835266_original_360.mp4 RR342 appcli 10 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:03.000Z yes A/V Geeks 16mm Films no 659 16mm filmmilitaryaerial footagewarvintage film https://avgeeks.videonest.co/videos/1835267/divine-baptism-1946-silent-DOIpd7ljto https://img.videonest.org/gamma/1835267_thumbnail_resized_v2.webp https://gamma.videonest.org/1835267_original_360.mp4 Divine Baptism (1946, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Two silent vintage 16mm biblical/religious films. The main film is a color dramatization of scenes from the life of John the Baptist and Jesus — depicting the Baptism of Christ, the Sermon on the Mount, and related events — with costumed actors filmed on location in a dry, Mediterranean-looking landscape. It cuts between dramatic narrative scenes and illustrated title cards with scripture. The second film is The Divine Baptism (1946), directed by Harry S. Webb, 2026-04-28T16:38:03.000Z yes A/V Geeks 16mm Films no 500 John the BaptistJesusBaptismSermon on the Mount194616mmVintage FilmReligious FilmSilent FilmBibleBiblical Dramatization https://avgeeks.videonest.co/videos/1835268/life-in-a-cubic-foot-of-soil-silent-raw-footage-19-4mQMXvRE4U https://img.videonest.org/gamma/1835268_thumbnail_resized_v2.webp https://gamma.videonest.org/1835268_original_360.mp4 Life In A Cubic Foot Of Soil (silent, raw footage, 1960s) This 1960s educational film focuses on soil study, likely as part of a classroom science experiment. It follows students and their teacher as they explore the composition, structure, and life within soil. The film begins with natural observations—flowers, larvae, worms, and ants—before transitioning into a more structured investigation using a glass cube that mimics soil layers. The students analyze samples under a microscope, mix soil with water in a beaker, and examine petri dishes filled with dirt. They also observe insects, seeds, and plant roots in soil, highlighting the intricate ecosystems beneath our feet. The methodical, hands-on approach emphasizes mid-century science education’s focus on observation and experimentation. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:02.000Z yes A/V Geeks 16mm Films no 826 soil studyscience education1960seducational filmclassroom experimentsoil layersmicroscopeplant rootssoil compositionsoil structureecosystemlarvaewormsantsseeds https://avgeeks.videonest.co/videos/1835269/adelante-cubanos-14-36-38-19-gzHLveJEM4 https://img.videonest.org/gamma/1835269_thumbnail_resized_v2.webp https://gamma.videonest.org/1835269_original_360.mp4 Adelante Cubanos 14 36 38 19 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:02.000Z yes A/V Geeks 16mm Films no 436 CubaindustrymanufacturinginfrastructuredevelopmentbeautyCuban woman https://avgeeks.videonest.co/videos/1835270/1508-post-war-germany-Td16UVTnsp https://img.videonest.org/gamma/1835270_thumbnail_resized_v2.webp https://gamma.videonest.org/1835270_original_360.mp4 1508 Post War Germany Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:02.000Z yes A/V Geeks 16mm Films no 2206 post-war Germany1947BerlinWWIIIndustrial ProductionRuhrAllied Occupationrecoverydevastation https://avgeeks.videonest.co/videos/1835271/rp-lest-we-forget-001-1oTliUWr8n https://img.videonest.org/gamma/1835271_thumbnail_resized_v2.webp https://gamma.videonest.org/1835271_original_360.mp4 RP Lest We Forget 001 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:01.000Z yes A/V Geeks 16mm Films no 523 Will RogersWiley Post1930sfundraisersilent filmclassic filmaviation historyOklahomaHollywood history https://avgeeks.videonest.co/videos/1835272/fairyland-fantasy-silent-raw-footage-e99t0lPS3O https://img.videonest.org/gamma/1835272_thumbnail_resized_v2.webp https://gamma.videonest.org/1835272_original_360.mp4 Fairyland Fantasy (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:01.000Z yes A/V Geeks 16mm Films no 449 16mm filmfairylandpranksvintage comedychildren https://avgeeks.videonest.co/videos/1835273/jack-visits-costa-rica-silent-raw-zgbBMjbuEv https://img.videonest.org/gamma/1835273_thumbnail_resized_v2.webp https://gamma.videonest.org/1835273_original_360.mp4 Jack Visits Costa Rica (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:01.000Z yes A/V Geeks 16mm Films no 397 Costa Rica16mm filmvintagetravelox cartchildrenairplane model https://avgeeks.videonest.co/videos/1835274/excavation-of-fort-stanwix-1970s-Fa3DLv4eJK https://img.videonest.org/gamma/1835274_thumbnail_resized_v2.webp https://gamma.videonest.org/1835274_original_360.mp4 Excavation of Fort Stanwix (1970s) The film depicts the tense atmosphere during the siege of Fort Stanwix in 1777, where American defenders are faced with the threat of British forces and their Indian allies. The commandant and his men grapple with dwindling supplies, the fear of attack, and the moral dilemma of surrendering to protect their families. Despite the pressure to capitulate, the commandant is resolute in his determination to hold the fort, emphasizing the importance of courage and loyalty to their cause. The narrative unfolds with discussions about strategy, the harsh realities of war, and the hope for reinforcements. Keywords Fort Stanwix, siege, American Revolution, British forces, Indian allies, supplies, surrender, courage, loyalty, strategy Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:00.000Z yes A/V Geeks 16mm Films no 1168 Fort StanwixsiegeAmerican RevolutionBritish forcesIndian allies1777 https://avgeeks.videonest.co/videos/1835275/farm-terracing-and-earth-moving-silent-IE_2I2Ty_p https://img.videonest.org/gamma/1835275_thumbnail_resized_v2.webp https://gamma.videonest.org/1835275_original_360.mp4 Farm Terracing And Earth Moving (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This footage showcases the process of farm terracing and earth moving using heavy machinery. It highlights how sloped terrains are transformed into structured agricultural plots, emphasizing the use of tractors with caterpillar tracks engaged in reshaping the landscape. The machinery is shown shifting soil and leveling uneven ground, which aids in preventing erosion and improving water management. Additionally, the segment illustrates techniques for creating irrigation channels, providing an aerial perspective of the extensive layout of terraced fields, demonstrating the effectiveness of these methods in enhancing agricultural productivity. For inquiries about the footage and its use in projects, viewers are encouraged to reach out via email. #FarmTerracing #EarthMoving #HeavyMachinery #AgriculturalTechniques #SoilManagement Timeline 00:00:00 - 00:04:00 Farm Terracing and Earth Moving 00:00:17 Heavy machinery is used to create terraces on a farmland, allowing for improved agriculture on sloped terrains. 00:00:53 A mechanical plow with a large blade and steel wheels is depicted, showcasing agricultural equipment used for farm terracing and earth-moving tasks. 00:02:04 A tractor is engaged in agricultural activities, transforming the landscape by creating terraces and moving earth to enhance its usability for farming purposes. 00:04:00 - 00:08:00 Farm Terracing and Earth Moving 00:06:06 A tractor with caterpillar tracks is maneuvering through dense vegetation, likely creating terraces on a farm to prevent erosion and improve soil management. 00:07:53 The earth-moving machinery reshapes the landscape, altering the terrain to create terraces suitable for farming and enhancing arable land. 00:08:00 - 00:09:57 Farm Terracing and Earth Moving 00:09:05 A tractor is used for earth-moving tasks, likely in the process of farm terracing, operating on a dirt pathway and shifting soil to create level areas on a sloped terrain. 00:09:12 A tractor operator is leveling a sloped, muddy terrain using a heavy roller attachment, appearing to be part of creating terraces to manage water runoff and improve agricultural land use. 00:09:36 A tractor equipped with earth-moving equipment is engaged in farm terracing, creating level steps on a sloped landscape to prevent soil erosion and manage water runoff, enhancing agricultural productivity. 00:09:57 - 00:10:45 Farm Terracing and Water Management 00:09:57 A tractor operator is shown maneuvering a vehicle along a newly dug, water-filled irrigation channel, demonstrating the initial stages of terracing for water distribution. 00:10:31 An aerial view reveals expansive terraced farmland, emphasizing strategic planning for water flow, soil erosion prevention, and efficient land use in agricultural practices. 2026-04-28T16:38:00.000Z yes A/V Geeks 16mm Films no 646 farm terracingearth movingheavy machineryagricultural techniquessoil managementvintage filmcaterpillar tracksirrigation channelsarable land https://avgeeks.videonest.co/videos/1835276/yellow-edge-silent-raw-footage-Bma7NTEM8j https://img.videonest.org/gamma/1835276_thumbnail_resized_v2.webp https://gamma.videonest.org/1835276_original_360.mp4 Yellow Edge (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Approximately 7.5 minutes of silent, unedited raw 16mm color film footage, shot for a Larry Harmon Production project titled "Scholle," filmed in Altadena, California. This is established immediately by the opening shot of a classic film clapperboard — "Scene 1, Take 1" — held up in front of the camera in a busy industrial setting. The vast majority of the footage consists of a single long, locked-off wide shot of an industrial packaging or filling facility. A worker dressed entirely in white (uniform, trousers, and cap) stands on a rubber mat at the center of the frame, operating a large, complex industrial machine. Prominent in the upper-left corner of the frame is a large wall clock, which ticks forward in real time throughout the footage (starting near noon), serving as an unintentional but fascinating timestamp of the shoot. The machinery around the worker is substantial — a mix of stainless steel and grey industrial equipment with pneumatic tubing, wiring, and precision mechanical components. In the background, other workers and industrial structures are partially visible. In the final portion of the video, the camera cuts to closer shots of the same machinery and worker. A medium close-up shows the worker leaning over the machine's control area, with stacked cardboard boxes visible nearby. The footage then moves to an extreme close-up of the machine's filling head — a stainless steel mechanism with precision nozzles — and finally to a tight shot of the worker's hands carefully guiding a clear plastic bag or film pouch through the machine's filling nozzle, making it clear the machine is a bag-filling or liquid/product packaging line, consistent with the "Scholle" production name (Scholle Packaging is a real company known for flexible packaging). The footage ends without any title cards or credits. 2026-04-28T16:38:00.000Z yes A/V Geeks 16mm Films no 458 16mm filmpackaging lineindustrial footageScholleAltadena Californiavintage filmraw footagefactory workerindustrial machineryA/V Geeks https://avgeeks.videonest.co/videos/1835277/photographer-1948-Q3EdYkcRuR https://img.videonest.org/gamma/1835277_thumbnail_resized_v2.webp https://gamma.videonest.org/1835277_original_360.mp4 Photographer (1948) The film explores the philosophy and artistry of photographer Edward Weston, emphasizing his connection to nature and the depth of his artistic vision. It highlights his belief that photography is not merely a mechanical process but a means to express feelings and thoughts about the world. Weston values simplicity and beauty found in everyday life and nature, using his keen observational skills to capture significant forms and moments. The documentary also touches on his technical approach to photography, his love for the outdoors, and the emotional experiences that inform his work. Keywords Edward Weston, photography, nature, art, philosophy, simplicity, emotional experience, technical skill, California, beauty Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:00.000Z yes A/V Geeks 16mm Films no 1609 Edward WestonphotographyCaliforniaartnature16mm film https://avgeeks.videonest.co/videos/1835278/rr330-dvic-50933-cwjAxXxfJf https://img.videonest.org/gamma/1835278_thumbnail_resized_v2.webp https://gamma.videonest.org/1835278_original_360.mp4 RR330 dvic 50933 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:38:00.000Z yes A/V Geeks 16mm Films no 1838 military airlift commandus air forceaircraftaviation historyair transportcargo planemilitary aircraftair rescue https://avgeeks.videonest.co/videos/1835279/foxes-silent-raw-footage-NF02NWg0tF https://img.videonest.org/gamma/1835279_thumbnail_resized_v2.webp https://gamma.videonest.org/1835279_original_360.mp4 Foxes (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 354 fox kitsbaby foxeswildlife footageanimal behaviorfox den16mm filmvintage footage https://avgeeks.videonest.co/videos/1835280/0197-integration-report-i-16-00-44-00-sBpZXBnpzW https://img.videonest.org/gamma/1835280_thumbnail_resized_v2.webp https://gamma.videonest.org/1835280_original_360.mp4 0197 Integration Report I 16 00 44 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 1232 civil rightsafrican americansegregation1960sprotestMontgomery AlabamaMartin Luther KingNAACP https://avgeeks.videonest.co/videos/1835281/0196-target-usa-15-00-36-00-W9BFmeVQ8e https://img.videonest.org/gamma/1835281_thumbnail_resized_v2.webp https://gamma.videonest.org/1835281_original_360.mp4 0196 Target USA 15 00 36 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 1237 civil defensecold war1950sUSAair raidatomic bombemergency preparednesspublic safetyhistorical footage https://avgeeks.videonest.co/videos/1835282/kileaua-and-mauna-loa-silent-raw-footage-mIVrPfVsr1 https://img.videonest.org/gamma/1835282_thumbnail_resized_v2.webp https://gamma.videonest.org/1835282_original_360.mp4 Kileaua And Mauna Loa (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This silent film footage presents a comprehensive visual journey of Hawaii's Kilauea Volcano and its surrounding tropical environment. It begins with serene scenes of lush fern forests and detailed close-ups of plant life, transitioning into dramatic footage of volcanic activity including steam vents, lava fountains, and flowing molten lava. The footage captures both daytime and nighttime eruptions, showcasing lava interacting with the ocean to create massive plumes of steam. Interspersed are shots of mid-20th-century tourists observing the volcanic spectacle, all accompanied at times by natural sounds or narration, culminating in a powerful display of nature's geothermal forces. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 353 KilaueaMauna LoaHawaii VolcanoesVolcanic EruptionLava FlowSteam VentsFern ForestTropicalGeothermalVintage Footage16mm Film https://avgeeks.videonest.co/videos/1835283/demonstrations-magnified-silent-TyaY-iiLuQ https://img.videonest.org/gamma/1835283_thumbnail_resized_v2.webp https://gamma.videonest.org/1835283_original_360.mp4 Demonstrations Magnified (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 713 chemistryexperimentsscienceeducational film16mm film https://avgeeks.videonest.co/videos/1835284/0213-activity-group-therapy-08-00-31-18--nMb_bqjeb https://img.videonest.org/gamma/1835284_thumbnail_resized_v2.webp https://gamma.videonest.org/1835284_original_360.mp4 0213 Activity Group Therapy 08 00 31 18 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 1460 group therapychild developmentmental healthpsychology16mm filmav geeksprelinger archivestherapy https://avgeeks.videonest.co/videos/1835285/0191-to-new-horizons-m00912-10-39-29-00-HBQfJSnwz0 https://img.videonest.org/gamma/1835285_thumbnail_resized_v2.webp https://gamma.videonest.org/1835285_original_360.mp4 0191 To New Horizons M00912 10 39 29 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:59.000Z yes A/V Geeks 16mm Films no 1386 General Motors16mm filmtransportationfutureautomobileshighwayscitiestechnologyWorld's Fair1960sinnovationprogress https://avgeeks.videonest.co/videos/1835286/0255-interrupted-morning-14-42-08-00-poPSs9mHcY https://img.videonest.org/gamma/1835286_thumbnail_resized_v2.webp https://gamma.videonest.org/1835286_original_360.mp4 0255 Interrupted Morning 14 42 08 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 1003 seatbelt safetycar accidentpublic service film16mm filmvintage safety https://avgeeks.videonest.co/videos/1835287/morepainting-W8mt-euZTM https://img.videonest.org/gamma/1835287_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835287_video_v5_360.mp4 MorePainting Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 2005 paintingartstill lifeartistdrawingpaintcanvasfine art https://avgeeks.videonest.co/videos/1835288/colorado-prologue-silent-raw-footage-Wo9Bm0p4w6 https://img.videonest.org/gamma/1835288_thumbnail_resized_v2.webp https://gamma.videonest.org/1835288_original_360.mp4 Colorado Prologue (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 404 Coloradotelephonetelecommunicationsrotary phoneswitchboardcolor phones https://avgeeks.videonest.co/videos/1835289/0178-man-to-man-m01671-21-00-39-00-AjXdVZpgqD https://img.videonest.org/gamma/1835289_thumbnail_resized_v2.webp https://gamma.videonest.org/1835289_original_360.mp4 0178 Man to Man M01671 21 00 39 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 1461 salessalesmanshipselling techniquesbusinesstraininginstructional filmarchival16mm filmvintagemarketingElmer WheelerRivers Peterson https://avgeeks.videonest.co/videos/1835290/0226-news-magazine-of-the-screen-the-1957-20-00-42-V9-0j8uhPM https://img.videonest.org/gamma/1835290_thumbnail_resized_v2.webp https://gamma.videonest.org/1835290_original_360.mp4 0226 News Magazine of the Screen The 1957 20 00 42 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 1284 newsreel1957cold warerie canalguided missileshummingbirdadenauerhungarysoviet unionunited nations https://avgeeks.videonest.co/videos/1835291/0226-experiments-in-the-revival-of-organisms-20-36-V6m5jOV3Xl https://img.videonest.org/gamma/1835291_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835291_video_v5_360.mp4 0226 Experiments in the Revival of Organisms 20 36 46 00 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 1181 https://avgeeks.videonest.co/videos/1835292/the-divine-baptism-silent-footage-mW3RSCbLO0 https://img.videonest.org/gamma/1835292_thumbnail_resized_v2.webp https://gamma.videonest.org/1835292_original_360.mp4 The Divine Baptism (silent footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 518 john the baptistreligion16mm filmold filmvintageheroddivine baptism https://avgeeks.videonest.co/videos/1835293/place-value-ones-tens-hundreds-2nd-ed-1979-JukWeMdk-E https://img.videonest.org/gamma/1835293_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835293_video_v5_360.mp4 Place Value: Ones, Tens, Hundreds (2nd Ed, 1979) In this educational film, Joe, the bakery owner, and his helper Henry demonstrate how to efficiently count and organize cookies using place value. They explain the ones, tens, and hundreds places in numerical representation while preparing an order of 326 chocolate chip cookies. The film illustrates how to keep track of large quantities of items by grouping them and using numerals to represent counts, making the counting process easier and more systematic. Keywords place value, counting, cookies, education, numerals, ones, tens, hundreds, bakery, Joe, Henry Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 643 place valuecountingcookieseducationnumeralsones tens hundredsmathbakery https://avgeeks.videonest.co/videos/1835294/phxarithmeticestimatingandcheckinganswers-545l6ncFth https://img.videonest.org/gamma/1835294_thumbnail_resized_v2.webp https://gamma.videonest.org/1835294_original_360.mp4 PHXArithmeticEstimatingAndCheckingAnswers Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:58.000Z yes A/V Geeks 16mm Films no 921 arithmeticestimatingchecking answerscoronet filmseducation https://avgeeks.videonest.co/videos/1835295/0408-life-is-a-lark-at-willow-grove-park-00-10-41-aa227XQOrs https://img.videonest.org/gamma/1835295_thumbnail_resized_v2.webp https://gamma.videonest.org/1835295_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 10 41 19 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:56.000Z yes A/V Geeks 16mm Films no 421 retro musicvintage performancelive audience16mm filmband performancespanish music https://avgeeks.videonest.co/videos/1835296/phxmidsummernightsdreamcan1-3-3gSLJohIG7 https://img.videonest.org/gamma/1835296_thumbnail_resized_v2.webp https://gamma.videonest.org/1835296_original_360.mp4 PHXMidsummerNightsDreamCan1 3 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:56.000Z yes A/V Geeks 16mm Films no 1734 ShakespeareMidsummer Night's Dreamplaytheater production16mm film https://avgeeks.videonest.co/videos/1835297/0381-san-francisco-first-annual-cable-car-festival-LSbn3KNLjC https://img.videonest.org/gamma/1835297_thumbnail_resized_v2.webp https://gamma.videonest.org/1835297_original_360.mp4 0381 San Francisco First Annual Cable Car Festival 12 47 41 27 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:56.000Z yes A/V Geeks 16mm Films no 82 San Franciscocable carfestivalhistoric footagePrelinger ArchivesparadeUnion SquareCalifornia history https://avgeeks.videonest.co/videos/1835298/0381-teenage-road-e-o-vallejo-california-12-44-34-I_r-lQ_ba9 https://img.videonest.org/gamma/1835298_thumbnail_resized_v2.webp https://gamma.videonest.org/1835298_original_360.mp4 0381 Teenage Road E O Vallejo California 12 44 34 19 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:56.000Z yes A/V Geeks 16mm Films no 35 vallejo californiateenage driversdriving competition1950sdriving safetyprelinger archivesvintage cars https://avgeeks.videonest.co/videos/1835299/0408-life-is-a-lark-at-willow-grove-park-00-00-47--07fzx6BHW https://img.videonest.org/gamma/1835299_thumbnail_resized_v2.webp https://gamma.videonest.org/1835299_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 00 47 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:55.000Z yes A/V Geeks 16mm Films no 338 Bob HornKing of KingsJazz MusicSoul Music16mm FilmVintage PerformanceSaxophoneLive MusicMusical PerformanceAfrican American Music https://avgeeks.videonest.co/videos/1835300/0408-life-is-a-lark-at-willow-grove-park-00-27-21-gy78foDNrG https://img.videonest.org/gamma/1835300_thumbnail_resized_v2.webp https://gamma.videonest.org/1835300_original_360.mp4 0408 Life Is a Lark at Willow Grove Park 00 27 21 00 3mb We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:55.000Z yes A/V Geeks 16mm Films no 237 jazz16mm filmvintage musiclive performanceAfrobeat https://avgeeks.videonest.co/videos/1835301/0381-placerville-california-el-dorado-county-fair-zzmuA_BISy https://img.videonest.org/gamma/1835301_thumbnail_resized_v2.webp https://gamma.videonest.org/1835301_original_360.mp4 0381 Placerville California El Dorado County Fair and John M Studeba 12 40 47 20 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:55.000Z yes A/V Geeks 16mm Films no 54 PlacervilleEl Dorado Countycounty fairwheelbarrow raceStudebakerCaliforniaGold RushHangtown16mm film https://avgeeks.videonest.co/videos/1835302/0381-pocket-sized-biplane-12-41-35-19-zN1VyI3vkB https://img.videonest.org/gamma/1835302_thumbnail_resized_v2.webp https://gamma.videonest.org/1835302_original_360.mp4 0381 Pocket Sized Biplane 12 41 35 19 We digitized and uploaded this film on behalf of the Prelinger Archives. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:55.000Z yes A/V Geeks 16mm Films no 32 biplanevintage aircraftexperimental planeaviation history16mm filmCaliforniaJohn Potius https://avgeeks.videonest.co/videos/1835303/footage-about-the-history-of-lighting-silent-raw-f-swTuXQpvfU https://img.videonest.org/gamma/1835303_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835303_video_v5_360.mp4 Footage about the history of lighting (silent, raw footage) Footage about the history of lighting (silent, raw footage) Overview The footage showcases a variety of scenes centered around the theme of lighting and experimental processes. It begins with a scene featuring metal pans and an unclear liquid, suggesting an intriguing crafting or experimental endeavor. This is followed by a dramatic demonstration of electrical arcs produced by two gloved hands manipulating metal rods in a dim environment, emphasizing the bright bursts of light amidst controlled conditions. Next, the focus shifts to an individual working with metal objects in a rustic, poorly lit space, transitioning to another person engaged in welding or soldering tasks. A simple yet striking moment captures a single light bulb against a plain backdrop, accompanied by a sequence where another person adjusts or replaces light bulbs on a panel. The ambiance then transitions to a vintage oil lamp, which casts a warm glow in a dimly lit setting, showcasing its polished surface and evoking a sense of nostalgia. The footage concludes with a segment characterized by a blend of rhythmic tapping, static sounds, and music, although it lacks visual elements directly related to lighting, creating a somewhat disjointed yet engaging experience. #Experimental Lighting #Metalworking #Electrical Demonstration #Vintage Oil Lamp #Artistic Footage Timeline 00:00:52 Two metal pans with an unknown liquid are shown on a wooden surface, suggesting a crafting or experimental process in a rustic setting. 00:02:01 - 00:02:36 Electrical Arc Demonstration 00:02:01 Two gloved hands create an electrical arc by touching metal rods together in a dark environment, emphasizing the generated spark. 00:02:08 The intense glow from the intersecting rods suggests a high-energy electrical experiment, with the surrounding darkness highlighting the light. 00:02:25 A pair of rods are positioned in an inverted V shape against a dark background, suggesting an experiment on electrical conductivity. 00:02:29 Two gloved hands manipulate red sticks, holding them together at an angle to form a triangular shape in a silent, dark setting. 00:02:36 - 00:03:34 Metalwork in Dim Light 00:02:53 An individual in dark attire is seated at a rustic wooden table, handling metal bowls in a dimly lit environment. 00:03:17 A person is engaged in welding or soldering work, emitting smoke and sparks in a dimly lit environment. 00:03:34 - 00:07:42 Lighting Demonstrations and Adjustments 00:05:51 A single light bulb is displayed against a plain background, possibly to showcase its design or functionality and emphasize its essential role. 00:07:32 A person is seen adjusting or replacing light bulbs on a panel, suggesting an exploration of lighting mechanics or maintenance. 00:07:42 - 00:10:39 Vintage Oil Lamp 00:09:23 A vintage oil lamp is shown, casting a warm glow in a dimly lit environment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:52.000Z yes A/V Geeks 16mm Films no 756 history of lightingoil lampelectrical arcmetalworkingvintage footageexperimental lighting16mm film https://avgeeks.videonest.co/videos/1835304/ohiopowercompanyvetsparty-mYtMcDPcJX https://img.videonest.org/gamma/1835304_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835304_video_v5_360.mp4 OhioPowerCompanyVetsParty We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:47.000Z yes A/V Geeks 16mm Films no 583 Ohio Power Companyveterans16mm filmarchive footagecompany partyskitsdinnervintage eventemployee appreciation https://avgeeks.videonest.co/videos/1835305/moonshotfootageapollo11-v-QRADU3ip https://img.videonest.org/gamma/1835305_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835305_video_v5_360.mp4 MoonShotFootageApollo11 We digitized and uploaded this film from the A/V Geeks 16mm Archive. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:46.000Z yes A/V Geeks 16mm Films no 386 Apollo 11Moon LandingLunar ModuleSpace History16mm filmav geeksastronautmoon surfacelunar exploration https://avgeeks.videonest.co/videos/1835306/middleeast-9sVtFzpwG8 https://img.videonest.org/gamma/1835306_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835306_video_v5_360.mp4 MiddleEast Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:17.000Z yes A/V Geeks 16mm Films no 798 https://avgeeks.videonest.co/videos/1835307/alaska-earthquake-damage-1964-pN8Gto1uaR https://img.videonest.org/gamma/1835307_thumbnail_resized_v2.webp https://gamma.videonest.org/1835307_video_v5.mp4 [Alaska Earthquake Damage, 1964] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Documentation of the destruction in and around Anchorage, Alaska from the 1964 Great Alaskan Earthquake. Includes images of fallen buildings, houses on precipitous hillsides, and collapsed streets. 2026-04-28T16:37:15.000Z yes A/V Geeks 16mm Films no 2324 https://avgeeks.videonest.co/videos/1835308/phxinstallmentbuyingreelsab-33Loiwu3me https://img.videonest.org/gamma/1835308_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835308_video_v5_360.mp4 PHXInstallmentBuyingReelsAB Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:15.000Z yes A/V Geeks 16mm Films no 662 installment buyingcreditvintage educationhome buying16mm film https://avgeeks.videonest.co/videos/1835309/indian-summer-silent-raw-footage-1970s-5ZV4sVjHaO https://img.videonest.org/gamma/1835309_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835309_video_v5_360.mp4 Indian Summer (silent, raw footage, 1970s) The raw footage from *Indian Summer* (1970s) captures a lively outdoor festival where children and adults engage in various activities celebrating community and culture. The scenes depict children arriving on a yellow school bus, dressed in costumes and face paint, participating in games, crafting decorations, and making handmade percussion instruments. They are seen linking hands in a circle, dancing, playing tug-of-war, and practicing spear-throwing with feathered spears. A parade featuring costumed participants waving banners and marching through the park adds to the festive atmosphere. Other moments include a woman painting a boy’s face, children fishing with bamboo rods, and a clear vinyl kite soaring in the sky. The film conveys a sense of joy, creativity, and communal celebration against a natural backdrop of grassy hillsides and trees. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:15.000Z yes A/V Geeks 16mm Films no 367 1970sfestivalraw footage16mm filmschool busparadeface paintvintagechildrencommunitycultureindian summer https://avgeeks.videonest.co/videos/1835310/chemehuev-indian-tribes-raw-footage-_p05PypdCr https://img.videonest.org/gamma/1835310_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835310_video_v5_360.mp4 [Chemehuev Indian Tribes, raw footage] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This is approximately 3 minutes of silent, raw 16mm color film footage, labeled "Roll 1 – Scene" on a handwritten clapperboard held up at the very start against a desert backdrop. The footage was shot in what appears to be the Mojave Desert — most likely the area of the Chemehuevi Valley along the Colorado River in California/Arizona — and is likely b-roll or research footage related to the Chemehuevi people, a Native American tribe of the Southern Paiute who have lived in the Mojave Desert region for centuries. The bulk of the first two-thirds of the video consists of a series of wide and medium landscape shots capturing the stark beauty of the Mojave Desert environment: sweeping panoramas of flat sandy desert floors covered in sparse scrub brush (creosote bush, ocotillo), dramatic rocky buttes and eroded sandstone outcroppings rising from the valley floor, and expansive overcast skies with dramatic cloud formations. The shots vary from close ground-level angles that emphasize the desert scrub to sweeping wide-angle vistas that capture the full scale of the terrain, and appear to be taken from a moving vehicle as well as static positions. The final third of the video introduces human activity: a drilling rig operation appears, with a large red drill truck and at least two hard-hatted workers standing beside a steel drill pipe being driven into the desert hillside — likely a water well or mineral survey drill. This is followed by a brief but beautiful shot of what appears to be the Colorado River, showing calm green water in the foreground with dramatic sandy desert cliffs and jagged rock formations rising steeply on the far bank. The video ends with the film reel's tail leader frames before cutting out. 2026-04-28T16:37:14.000Z yes A/V Geeks 16mm Films no 178 Mojave Desert16mm filmraw footagelandscapedrillingColorado RiverChemehuevidesert landscapeold filmfilm reel https://avgeeks.videonest.co/videos/1835311/alisal-tales-and-trails-silent-uyuMbtXUOj https://img.videonest.org/gamma/1835311_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835311_video_v5_360.mp4 Alisal Tales and Trails (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:13.000Z yes A/V Geeks 16mm Films no 601 Alisal RanchCalifornia Rancho16mm filmvintage travelcattle ranchhorseback ridingresort lifeold westhistorical footageSanta Ynez Valley https://avgeeks.videonest.co/videos/1835312/imperialism-silent-raw-footage-4tkM8TnyEQ https://img.videonest.org/gamma/1835312_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835312_video_v5_360.mp4 Imperialism (silent, raw footage) This film recreation of 1880s-era appears to depict historical and political discussions, likely centered on colonial expansion and global affairs. Key scenes involve men studying maps, reading newspapers, and discussing world events, possibly related to Africa and Asia. A soldier's presence suggests military involvement, while an image of a boat and an Italian factory hint at industrialization and maritime activity. Interactions between white men and indigenous individuals indicate colonial encounters. Religious elements, such as a man reading from a Bible, suggest a missionary or ideological component. The film captures the political, economic, and social dynamics of the late 19th century through a series of staged discussions and visual representations. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:13.000Z yes A/V Geeks 16mm Films no 410 ImperialismColonialismEuropean ExpansionAfricaAsia19th CenturyMilitaryMissionaryFactoryIndustrialization https://avgeeks.videonest.co/videos/1835313/beet-hitler-silent-BOMfh4C4mr https://img.videonest.org/gamma/1835313_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835313_video_v5_360.mp4 Beet Hitler (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This is a ~17-minute silent World War II-era instructional and propaganda film about the proper technique for trimming sugar beets, produced for workers at a beet processing plant. The title "Beet Hitler" is a patriotic wartime pun — the film frames beet trimming as a contribution to the Allied war effort. The film opens with a title card reading "TRIMMING BEETS", followed immediately by a humorous wartime propaganda image: a caricature drawing of Adolf Hitler being smacked in the face by a flying beet, with red juice splattered across the image. This sets the film's tone of linking the mundane work of beet processing to the broader war effort. The first live-action scenes show workers in the field — a young man in a cap and work shirt is shown bent over, trimming beets by hand in the field. The film then shifts to an indoor processing facility, where workers in light-colored uniforms are shown sorting and trimming beets at tables and on conveyor belts. A diagram demonstrating the correct knife-grip technique (labeled "GRASP" and "AWAY") is shown to teach the proper motion. Numerous silent-film style intertitles punctuate the instructional sequences, carrying messages such as "THERE ARE TWO METHODS OF DOING ANY KIND OF WORK," "A CURVED, SHAVING TYPE TRIMMING MOTION IS NOT ONLY EASIER, BUT SAVES MORE OF THE BEET FOR OUR MUCH NEEDED FOOD SUPPLY," "PREVENTING ACCIDENTS ON OUR PRODUCTION FRONT WILL HELP ROUND UP THE AXIS ON THE BATTLE FRONT," and numbered instructions like "4. AND TRIM CAREFULLY." Workers wearing aprons and gloves are shown close-up handling beets on conveyor chutes, demonstrating correct and incorrect cutting techniques. The film also briefly includes a street scene and notably a baseball game — showing workers enjoying recreation, likely to frame beet processing work as part of a healthy and patriotic community life. The film closes patriotically with a shot of an American flag flying against a bright blue sky, reinforcing the wartime theme that proper beet trimming is itself a form of service to the nation. 2026-04-28T16:37:12.000Z yes A/V Geeks 16mm Films no 1042 beet trimmingWorld War IIpropagandainstructional film16mm filmAdolf Hitlerfood supplypatrioticallied war effort https://avgeeks.videonest.co/videos/1835314/listen-to-learn-raw-footage-silent-1950s-B_5T3NK-Zq https://img.videonest.org/gamma/1835314_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835314_video_v5_360.mp4 Listen To Learn (raw footage, silent, 1950s) Raw silent footage from the educational film, Listen to Learn, from the 1950s is an educational film produced by Coronet, designed to teach elementary school students the importance of attentive listening as a key learning skill. The footage features students in classrooms engaging with phonographs, record players, and teacher-led lessons, illustrating the role of audio-based learning in mid-century education. Scenes also depict children listening to instructions at home, interacting with teachers, and practicing good listening habits in various settings. Through a combination of classroom demonstrations and real-world applications, the film emphasizes the value of active listening for academic success, fostering better communication, and developing critical thinking skills. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:11.000Z yes A/V Geeks 16mm Films no 1096 https://avgeeks.videonest.co/videos/1835315/inside-detroit-silent-raw-footage-HeMaLGuLhg https://img.videonest.org/gamma/1835315_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835315_video_v5_360.mp4 Inside Detroit (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This vintage film compilation offers a nostalgic glimpse into mid-20th century Detroit and its surrounding areas, showcasing a range of scenes from industrial manufacturing and city waterfronts to educational institutions and suburban family life. The film features archival footage of Detroit's skyline, bustling streets, and river traffic, alongside public service announcements and presentations by authoritative figures. It also captures leisure activities at the Detroit Zoo and local sports events, as well as daily routines within suburban households, including morning rituals and family farewells. 2026-04-28T16:37:10.000Z yes A/V Geeks 16mm Films no 483 https://avgeeks.videonest.co/videos/1835316/your-postal-service-silent-01IGz4sCrk https://img.videonest.org/gamma/1835316_thumbnail_resized_v2.webp https://gamma.videonest.org/1835316_original_360.mp4 Your Postal Service (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:09.000Z yes A/V Geeks 16mm Films no 579 postal servicemail deliverymail sortingvintage film16mm filmmail truckmail train https://avgeeks.videonest.co/videos/1835317/we-ll-get-there-somehow-part-3-silent-nLU16bKAcH https://img.videonest.org/gamma/1835317_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835317_video_v5_360.mp4 We'll Get There Somehow, Part 3 (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Appears to be the third installment of a dramatized educational or industrial production about the oil trucking and drilling industry, likely from the 1950s or early 1960s. The footage opens with a large vintage red cab-over freight truck rolling down a rural tree-lined road with cattle grazing in the background, immediately establishing the trucking theme. The narrative quickly shifts to an interior scene set in a busy dispatch or routing office, where a young man in a light work shirt confers with an older supervisor wearing a white fedora and glasses; behind them looms a large chalkboard filled with handwritten truck route numbers (2395W, 856-J, 2660-J, 750, 2199-J, and others) alongside driver names and destinations, evoking a working trucking operation's headquarters. After a section of film leader separating reel segments, the story moves into a dramatic indoor scene in which a man in a wide-brimmed hat bends over someone lying ill in a bed, suggesting a plot involving an accident or illness along a route. The film then returns to live-action exterior shots of the oil fields: a massive, heavily-built red specialty vehicle — fitted with large pipes, industrial machinery, and oversized off-road tires — is shown parked on the worksite, followed by a wide elevated view of a derrick or crane structure against a pale sky with rust-colored earth below. The film then transitions into a sustained animated educational segment explaining oil drilling technology, using colorful illustrated diagrams including a cross-section of a drill bit boring through labeled underground strata captioned "OIL SAND," a detailed cutaway of a wellhead or "Christmas tree" valve assembly showing red pipes and blue gas flow, and further geological cross-sections depicting a borehole passing through layered rock formations in pinks, greys, and reds. After another reel break and leader section, the live-action footage resumes with a close-up of a worker in heavily soiled overalls on-site, followed by the film's final wide overhead shot of a full-scale oil well servicing operation: dozens of red industrial pumping trucks, tanks, and equipment crowded together on a flat worksite with vintage automobiles parked in the background, conveying the scale and complexity of a mid-century petroleum extraction effort. 2026-04-28T16:37:09.000Z yes A/V Geeks 16mm Films no 503 1950s1960soil industrytruckingoil drillingvintage filmeducational filmindustrial film16mm filmHalliburtonoil well https://avgeeks.videonest.co/videos/1835318/alaska-sled-dogs-silent-raw-footage-a4jRWj2cZ0 https://img.videonest.org/gamma/1835318_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835318_video_v5_360.mp4 [Alaska Sled Dogs] (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. "RP Alaska Sled Dogs (silent, raw footage)" is a roughly three-minute silent color film shot on location in Alaska, uploaded by A/V Geeks 16mm Films. The footage opens with a white leader strip before cutting to a crowd of spectators bundled in heavy winter coats and parkas gathered outdoors in a snowy landscape with bare deciduous trees and mountains in the background, suggesting a public race or community event. The film then shifts to one of its most striking shots: a wide, sunlit panorama of a dog sled team traversing a vast frozen plain with a wall of dark spruce forest and dramatic snow-capped mountain peaks stretching across the horizon under a clear blue sky — the team and musher appear tiny against the immense wilderness. A close-up of a passing sled reveals a sponsor placard reading "Home of the Husky / Alaska Battery" affixed to the sled, indicating this is likely a sponsored race or promotional demonstration. The camera cuts to ground-level close-ups of individual Siberian huskies in harness — black-and-white dogs with tongues lolling, energetic and ready — before capturing a handler bending down among the dogs on a snowy wooded trail, tending to the team. Another sequence shows the sled team running at pace through a flat, open snowy corridor lined with bare-branched trees, the dogs strung out in a long working line. A thrilling low-angle or near point-of-view shot follows close behind the running dogs through a wooded trail, conveying the speed and excitement of the run. The film closes with a warm personal moment: a person in a large fur-lined parka hood smiling broadly while crouched down surrounded by several affectionate sled dogs — including a white husky and a large grey dog — in the snow-covered woods, ending the footage on a human and intimate note. 2026-04-28T16:37:09.000Z yes A/V Geeks 16mm Films no 185 Alaskadog sleddog sleddinghuskyvintage footage16mm filmwinter sportsnowdogssled dogs https://avgeeks.videonest.co/videos/1835319/literature-appreciation-how-to-read-biographies-ra-BXy2lPmspI https://img.videonest.org/gamma/1835319_thumbnail_resized_v2.webp https://gamma.videonest.org/1835319_video_v5.mp4 Literature Appreciation: How To Read Biographies (raw footage, silent, 1960s) The raw, silent footage from *Literature Appreciation: How to Read Biographies* (1965, Coronet Films) consists of various scenes illustrating the process of engaging with biographies in different contexts. It features sequences of people browsing and selecting books in a library, handling and reading books, and interacting in office settings, where discussions and note-taking occur. Scenes include text on chalkboards, hands flipping through book pages, and individuals pointing to specific passages. Other shots depict daily life activities such as washing dishes, walking through different locations, and exploring historical sites like Mount Vernon. The film also includes footage of outdoor environments, such as gardens, lakesides, trees, and stone sculptures, possibly symbolizing aspects of historical or biographical narratives. The variety of visuals suggests a structured approach to understanding biographies, combining traditional educational settings with real-world and historical context. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:09.000Z yes A/V Geeks 16mm Films no 631 https://avgeeks.videonest.co/videos/1835320/herald-tribune-high-school-forum-no-3-tehran-tehra-vcOduPU4Dw https://img.videonest.org/gamma/1835320_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835320_video_v5_360.mp4 Herald Tribune High School Forum No. 3: Tehran: TEHRAN (silent, 1960s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Herald Tribune High School Forum No. 3: Tehran: TEHRAN The footage presents a diverse range of scenes, beginning with an engaging classroom environment where a teacher leads a lesson, and students actively participate in their studies. The focus shifts to a lively outdoor gathering, showcasing a group of women and young adults immersed in conversation and interacting with their surroundings in a social or educational context. Additionally, various groups of people are seen enjoying social interactions in different outdoor settings, highlighting the dynamics of community engagement and connection. #Classroom Engagement #Community Connection #Outdoor Gatherings #Social Interaction #Educational Events Timeline 00:00:00 - 00:04:00 Classroom Instruction and Learning 00:00:00 A woman in a checkered jacket is seen in a formal setting, surrounded by other individuals, suggesting a group gathering. 00:01:48 A teacher instructs a classroom of female students, gesturing towards a blackboard filled with writing. 00:03:05 A group of formally dressed individuals, mostly women, are seated in a classroom, attentively listening to a presentation. 00:03:50 Students are depicted in a classroom, focused on their studies, taking notes, and listening intently. 00:04:00 - 00:08:00 Outdoor Gathering 00:06:28 Women in coats and formal attire gather outdoors, conversing and carrying books and handbags, suggesting a social or educational event. 00:07:20 A group of people stand closely together in front of a building, appearing engaged in a social or educational gathering. 00:08:00 - 00:11:15 Outdoor Social Gatherings 00:08:33 A group of adults and a child are seated outdoors, possibly at a social or educational event, dressed in semi-formal attire on a sunny day. 00:09:34 A man and a woman are seated closely on a bench, with the man's arm around the woman, suggesting a familiar or comfortable interaction. 00:11:05 Four people are seated around a small table outdoors, conversing and enjoying a leisurely moment, with a small dog present. 2026-04-28T16:37:07.000Z yes A/V Geeks 16mm Films no 675 TehranIran1960shigh schoolforumeducationstudentsclassroomsocial gathering https://avgeeks.videonest.co/videos/1835321/the-displaced-person-part-2-1977-upRpNGmDyj https://img.videonest.org/gamma/1835321_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835321_video_v5_360.mp4 The Displaced Person Part 2 (1977) Adapted from the short story The Displaced Person by Flannery O'Connor. The film presents a tense conversation between characters discussing the implications of bringing a Polish immigrant, Mr. Gack, into their community. The dialogue reveals deep-seated prejudices and moral dilemmas regarding race, immigration, and responsibility. The speaker expresses frustration over the idea of having to accommodate Mr. Gack, emphasizing their belief that they owe more to those who have served their country than to newcomers. The narrative highlights themes of exclusion, economic hardship, and the struggle for acceptance in a changing society. Keywords immigration, prejudice, race, responsibility, community, economic hardship, exclusion, moral dilemma 2026-04-28T16:37:07.000Z yes A/V Geeks 16mm Films no 1715 immigrationprejudicemoral dilemmaexclusionFlannery O'Connor https://avgeeks.videonest.co/videos/1835322/thehouseflydamaged-6ZiDBuhfhy https://img.videonest.org/gamma/1835322_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835322_video_v5_360.mp4 TheHouseFlyDAMAGED Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:07.000Z yes A/V Geeks 16mm Films no 1006 houseflyfliesinsectdiseasesanitationpublic healthfly eggsmaggotpest controlmedical https://avgeeks.videonest.co/videos/1835323/yesterdaylivesagain-zJM-qSIAt8 https://img.videonest.org/gamma/1835323_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835323_video_v5_360.mp4 YesterdayLivesAgain Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:06.000Z yes A/V Geeks 16mm Films no 573 16mm filmvintagehistorical footageold time moviesearly 1900sblack and white https://avgeeks.videonest.co/videos/1835324/rrh-hf-265-r3-FkhZfGW0mu https://img.videonest.org/gamma/1835324_thumbnail_resized_v2.webp https://gamma.videonest.org/1835324_original_360.mp4 RRH HF 265 R3 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:05.000Z yes A/V Geeks 16mm Films no 530 segregationeducationSouth CarolinaNAACP16mm filmjim crow https://avgeeks.videonest.co/videos/1835325/rr306-lss-1816-Nw3IhIT3Oh https://img.videonest.org/gamma/1835325_thumbnail_resized_v2.webp https://gamma.videonest.org/1835325_original_360.mp4 RR306 LSS 1816 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:04.000Z yes A/V Geeks 16mm Films no 553 BostonMassachusettsSymphony HallMuseum of Fine ArtsAirportCityscape1950sSchoolOrchestra https://avgeeks.videonest.co/videos/1835326/oaseed-seeddisposal-h-264-v3je5HytJS https://i.ytimg.com/vi/KE1XpKxj3bM/sddefault.jpg https://gamma.videonest.orghttps:.videonest.co/1835326_video_v5_360.mp4 OASeed&SeedDisposal H 264 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:04.000Z yes A/V Geeks 16mm Films no 458 https://avgeeks.videonest.co/videos/1835327/newsparadeofyear1953silent-n2S8Vx2kxV https://i.ytimg.com/vi/PvlOIoFqGkc/maxresdefault.jpg https://gamma.videonest.orghttps:.videonest.co/1835327_video_v5_360.mp4 NewsParadeofYear1953Silent Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:04.000Z yes A/V Geeks 16mm Films no 490 https://avgeeks.videonest.co/videos/1835328/avgeeksupennunknownhmreels1-7-tpLR8t2IWs https://img.videonest.org/gamma/1835328_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835328_video_v5_360.mp4 AVGeeksUPennUnknownHMReels1 7 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:37:00.000Z yes A/V Geeks 16mm Films no 2468 beachEiffel TowerParisIsraelJerusalemStatue of LibertyItalyvintage footagehistorical footagetravelvacationchildren playingtouristscruise shipboats https://avgeeks.videonest.co/videos/1835329/306-5912-2TcVR5c4BM https://i.ytimg.com/vi/Cv7n_6ZEIzI/maxresdefault.jpg https://gamma.videonest.orghttps:.videonest.co/1835329_video_v5_360.mp4 306 5912 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:58.000Z yes A/V Geeks 16mm Films no 403 https://avgeeks.videonest.co/videos/1835330/mary-s-little-lamb-6NJTil7mdX https://i.ytimg.com/vi/gdheEqg7rCE/sddefault.jpg https://gamma.videonest.orghttps:.videonest.co/1835330_video_v5_360.mp4 Mary's Little Lamb Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:58.000Z yes A/V Geeks 16mm Films no 496 https://avgeeks.videonest.co/videos/1835331/rrh-hf-177-r1-NhVfEZfrRK https://i.ytimg.com/vi/wJ-uHvjQkRA/maxresdefault.jpg https://gamma.videonest.orghttps:.videonest.co/1835331_video_v5_360.mp4 RRH HF 177 R1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:58.000Z yes A/V Geeks 16mm Films no 599 https://avgeeks.videonest.co/videos/1835332/battleofbritainrememberedunrestinthedominicanrepub-99yCk3sS2i https://img.videonest.org/gamma/1835332_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835332_video_v5_360.mp4 BattleOfBritainRememberedUnrestInTheDominicanRepublicTOODAMAGED Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:58.000Z yes A/V Geeks 16mm Films no 860 Battle of BritainDominican RepublicWorld War IIRAFLuftwaffeLyndon Johnson1965Cold War https://avgeeks.videonest.co/videos/1835333/ibm-day-new-york-world-s-fair-may-4-1939-eXpUhjhLe7 https://img.videonest.org/gamma/1835333_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835333_video_v5_360.mp4 IBM Day: New York World's Fair (May 4, 1939) The film documents IBM Day at the New York World's Fair on May 4, 1939, celebrating the company's contributions to international peace and trade. Over 3,000 IBM representatives from 27 countries gathered to honor Thomas J. Watson, who marked 25 years of leadership. The event highlighted IBM's global operations, showcased its technological innovations, and emphasized the importance of international cooperation and cultural exchange. The fair served as a platform for promoting goodwill among nations and underscored the belief in achieving world peace through trade. Keywords IBM Day, New York World's Fair, Thomas J. Watson, international peace, world trade, global cooperation, cultural exchange, technological innovation, 1939, celebration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:57.000Z yes A/V Geeks 16mm Films no 2626 IBM DayNew York World's FairThomas J Watson1939World TradeCultural ExchangeTechnological Innovation https://avgeeks.videonest.co/videos/1835334/rr306-lss-253-ShDS2dXW6u https://img.videonest.org/gamma/1835334_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835334_video_v5_360.mp4 RR306 LSS 253 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:57.000Z yes A/V Geeks 16mm Films no 343 tuskegee institute16mm filmafrican american historyvintage filmaviation trainingbooker t washington https://avgeeks.videonest.co/videos/1835335/advances-in-avionics-1970s-NO4X_kACjp https://img.videonest.org/gamma/1835335_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835335_video_v5_360.mp4 Advances in Avionics (1970s) The film discusses advances in avionics, highlighting how electronic systems in aircraft enhance pilot communication, navigation, and flight control. It emphasizes the potential of computers to assist pilots, allowing them to focus on critical decision-making. The use of touch-sensitive screens and voice feedback systems is demonstrated, showing how they simplify tasks like weight loading and flight planning. The film illustrates a flight planning example, showcasing how advanced avionics can improve safety and efficiency in aviation. Keywords avionics, electronic systems, pilot assistance, navigation, flight control, NASA, computer technology, safety, flight planning, voice feedback Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:57.000Z yes A/V Geeks 16mm Films no 276 avionicsflight controlnavigationpilot assistanceNASAcomputer technologyaerospace engineeringtouch screen technologyvoice feedback https://avgeeks.videonest.co/videos/1835336/306-558-jlXkVWlhO_ https://img.videonest.org/gamma/1835336_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835336_video_v5_360.mp4 306 558 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:56.000Z yes A/V Geeks 16mm Films no 95 Lyndon B. JohnsonEugene BlackWorld Bank16mm filmWhite House https://avgeeks.videonest.co/videos/1835337/oasoundtestbybertmunck-K8sCD4kQze https://img.videonest.org/gamma/1835337_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835337_video_v5_360.mp4 OASoundTestbyBertMunck Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:56.000Z yes A/V Geeks 16mm Films no 260 plastic foamthermal insulationbuilding materialsarchitectureengineering https://avgeeks.videonest.co/videos/1835338/beginning-responsibility-being-on-time-1956-ROP20kfGl2 https://img.videonest.org/gamma/1835338_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835338_video_v5_360.mp4 Beginning Responsibility: Being On Time (1956) The film follows a boy named Jimmy who struggles with being on time for school. His tardiness affects not only his own experiences, like missing a special trip to the fire station and his favorite TV show, but also inconveniences his classmates and teachers. Through various scenarios, Jimmy learns the importance of punctuality and planning his time effectively. He realizes that being on time is essential for himself and others, and he decides to improve his habits to avoid being late in the future. Keywords Jimmy, punctuality, time management, school, fire station, responsibility, planning, lateness, consequences, learning Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:56.000Z yes A/V Geeks 16mm Films no 636 punctualitytime managementresponsibilityschoolchildren1950splanningconsequenceslearningcoronet films https://avgeeks.videonest.co/videos/1835339/pele-the-master-and-his-method-trapping-and-headin-wSqo16Fsmi https://img.videonest.org/gamma/1835339_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1835339/pele-the-master-and-his-method-trapping-and-headin-wSqo16Fsmi Pele - The Master And His Method - Trapping And Heading (1973) The film discusses the essential skills of trapping and heading in soccer. It emphasizes the importance of controlling the ball gently with various parts of the body, such as the foot, thigh, chest, and head. The technique of trapping involves cushioning the ball to maintain possession, while heading requires confidence and proper timing to effectively redirect the ball. The video also highlights the need for practice, coordination, and body movement to master these skills, making them crucial for successful gameplay. Keywords soccer, trapping, heading, ball control, techniques, practice, body movement, coordination, gameplay Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:56.000Z yes A/V Geeks 16mm Films no 992 pelesoccertrappingheadingball controlsoccer techniquessoccer training https://avgeeks.videonest.co/videos/1835340/the-american-negro-unfinished-r1-1962-IXt-S18GhJ https://img.videonest.org/gamma/1835340_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835340_video_v5_360.mp4 The American Negro (unfinished, R1, 1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Presents a narrative about the diverse lives of African Americans, highlighting their contributions in various professions, including medicine, journalism, and social work. It emphasizes the ongoing challenges of segregation and discrimination faced by the community, despite significant advancements. The film showcases personal stories and family dynamics, particularly during Thanksgiving, while also addressing the deep-seated feelings of inferiority and frustration caused by societal inequalities. It concludes with a glimpse of a new wave of activism among young people fighting against segregation. This unfinished civil rights-era film details how segregation affects the daily lives of African Americans, and includes portions of interviews with James Farmer, Roy Wilkins, Whitney Young, and Ralph Metcalfe. Farmer, Wilkins, and Young were considered to be among the “Big Four” leaders in the U.S. civil rights movement, along with Martin Luther King, Jr. The film also describes the strides and challenges faced by African Americans in the areas of voting, housing, and education. The film was written by Louis Lomax, produced by Willard Van Dyke, directed by Graeme Ferguson, and narrated by Charles Gordone. Keywords African American, segregation, Thanksgiving, professions, activism, inequality, family, community, history, diversity 2026-04-28T16:36:56.000Z yes A/V Geeks 16mm Films no 604 african americansegregationcivil rights1960sblack history https://avgeeks.videonest.co/videos/1835341/goodbye-and-good-luck-yy07422veV https://img.videonest.org/gamma/1835341_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835341_video_v5_360.mp4 Goodbye And Good Luck Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T16:36:55.000Z yes A/V Geeks 16mm Films no 1856 veteranscivil rightsvietnam warafrican americanblack powermilitary https://avgeeks.videonest.co/videos/1835342/reportondownssyndrome-Yq9uiF1daD https://img.videonest.org/gamma/1835342_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835342_video_v5_360.mp4 ReportOnDownsSyndrome Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T16:36:55.000Z yes A/V Geeks 16mm Films no 1138 Down SyndromeMongolismMental Retardation1962Medical filmGeneticsChromosome 21 https://avgeeks.videonest.co/videos/1835343/cbsovietdailylife-ZB356LX3aX https://img.videonest.org/gamma/1835343_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835343_video_v5_360.mp4 CBSovietDailyLife Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:55.000Z yes A/V Geeks 16mm Films no 161 Soviet UnionUSSRindustryeconomicsdaily life16mm filmcommunismMoscowRussian culturefactory https://avgeeks.videonest.co/videos/1835344/universeourgoldenageofastronomythecopyright-id0oCBIkM3 https://img.videonest.org/gamma/1835344_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835344_video_v5_360.mp4 UniverseOurGoldenAgeOfAstronomyTheCOPYRIGHT Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T16:36:55.000Z yes A/V Geeks 16mm Films no 1229 astronomyspaceuniverse16mm filmtelescopesradio astronomyx-ray astronomyblack holessupernova https://avgeeks.videonest.co/videos/1835345/phxclothesandyoulineandproportionokc-b-5d4HImaFmE https://img.videonest.org/gamma/1835345_thumbnail_resized_v2.webp https://gamma.videonest.org/1835345_original_360.mp4 PHXClothesAndYouLineAndProportionOKC B Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:55.000Z yes A/V Geeks 16mm Films no 479 clothing lineproportionfashion design16mm filmvintage fashionoklahoma city https://avgeeks.videonest.co/videos/1835347/306-6376-spanish-DbuWldjg3H https://img.videonest.org/gamma/1835347_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835347_video_v5_360.mp4 306 6376 spanish Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 436 16mm filmcartoonanimationinterplanetaryspace travelvintage animationcomedyfunnyav geeks https://avgeeks.videonest.co/videos/1835348/the-feline-fighter-silent-1929-sxLhMW7xht https://img.videonest.org/gamma/1835348_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835348_video_v5_360.mp4 The Feline Fighter (silent, 1929) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 513 1929vintage filmhuntingdogshoundsFloridafelinebig catswamphistoric16mm filmarchive footage https://avgeeks.videonest.co/videos/1835349/oathelynx-WOG0GxGJB_ https://img.videonest.org/gamma/1835349_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835349_video_v5_360.mp4 OATheLynx Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 554 LynxHuntingVintage filmDogsSan Francisco PeaksChildrenNatureWinter https://avgeeks.videonest.co/videos/1835350/raccoon-mountain-pumped-storage-plant-silent-oCW_ARCpfm https://img.videonest.org/gamma/1835350_thumbnail_resized_v2.webp https://gamma.videonest.org/1835350_original_360.mp4 Raccoon Mountain Pumped Storage Plant (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 801 Raccoon MountainPumped StorageHydroelectric PowerEnergyDamPower Plant16mm Film https://avgeeks.videonest.co/videos/1835351/castle-films-cartoon-clips-M8waeV8snX https://img.videonest.org/gamma/1835351_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835351_video_v5_360.mp4 Castle Films Cartoon Clips Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 619 cartoonanimationvintage film16mm filmcastle filmsclassic cartoonhowdy doodypantry panicsnookums bearsmidget car maniacs https://avgeeks.videonest.co/videos/1835352/oasomewhereineuropeimmigrationpart1-1921-lzHLfUWAI- https://img.videonest.org/gamma/1835352_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835352_video_v5_360.mp4 OASomewhereInEuropeImmigrationPart1 1921 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:52.000Z yes A/V Geeks 16mm Films no 605 1921immigrationEllis IslandEuropean immigrantssilent filmfamilyAmericaold filmimmigrant familynew york city https://avgeeks.videonest.co/videos/1835353/oaunknownhomemovieswaterfowl3-cont-1-6vIeZFSohB https://img.videonest.org/gamma/1835353_thumbnail_resized_v2.webp https://gamma.videonest.org/1835353_original_360.mp4 OAunknownhomemoviesWaterfowl3 cont 1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:51.000Z yes A/V Geeks 16mm Films no 414 16mm filmwaterfowlpelicansswanscrater lakenational parkwildlife refugebirdsnature https://avgeeks.videonest.co/videos/1835354/6119-evolution-01-48-42-21-75_JKE-Y8w https://img.videonest.org/gamma/1835354_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835354_video_v5_360.mp4 6119 Evolution 01 48 42 21 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:51.000Z yes A/V Geeks 16mm Films no 784 16mm filmearly lifeevolutionbiologysingle cellreptilesmammalsdinosaurszoology https://avgeeks.videonest.co/videos/1835355/tanksmos-qdmSKlVA4o https://img.videonest.org/gamma/1835355_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835355_video_v5_360.mp4 TanksMOS Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:51.000Z yes A/V Geeks 16mm Films no 622 military tankstank productionmanufacturingordnance departmentmilitary vehiclestank arsenaltank factory16mm film https://avgeeks.videonest.co/videos/1835356/6145-world-beneath-the-sea-01-39-37-05-hqtFFrv8OG https://img.videonest.org/gamma/1835356_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835356_video_v5_360.mp4 6145 World Beneath the Sea 01 39 37 05 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:51.000Z yes A/V Geeks 16mm Films no 711 sea anemonetube wormssalpaemarine life16mm filmocean lifeunderseavintage footagecoelenterataannelida https://avgeeks.videonest.co/videos/1835357/6147-emergency-first-aid-a-study-in-motion-picture-i07BsBrv6X https://img.videonest.org/gamma/1835357_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835357_video_v5_360.mp4 6147 Emergency First Aid A Study in Motion Pictures to Aid Civil Def 01 00 47 24 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:51.000Z yes A/V Geeks 16mm Films no 1206 first aidbandagingwoundsburnsvintagemedical1940scivil defenseemergency carered crosswound care https://avgeeks.videonest.co/videos/1835358/0945-on-the-land-4odq2IIS9Y https://img.videonest.org/gamma/1835358_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835358_video_v5_360.mp4 0945 On The Land Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 496 world war oneWWIamerican legionUS military16mm filmhistorical footagewar footagetrench warfare https://avgeeks.videonest.co/videos/1835359/0385-panama-canal-16-45-30-00-5xtLqA6xky https://img.videonest.org/gamma/1835359_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835359_video_v5_360.mp4 0385 Panama Canal 16 45 30 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 556 Panama Canal16mm filmConstructionHistorical footageEngineering featSteam trainVintageCanal Zone https://avgeeks.videonest.co/videos/1835360/continents-of-the-world-silent-footage-1950s-yLGWPGhB9G https://img.videonest.org/gamma/1835360_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835360_video_v5_360.mp4 Continents Of The World (silent footage, 1950s) This 1960s educational film follows a young boy as he explores geography using a spinning globe, maps, and real-world observations. Scenes alternate between the boy studying a globe at home, tracing routes across various continents, and traveling in a car, possibly connecting his learning to real-world experiences. The film highlights major locations such as North America, South America, Europe, Asia, and Africa, emphasizing geographical awareness. Production placards indicate instructional or documentary-style filmmaking, reinforcing the film’s goal of educating viewers about world geography and exploration. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 704 world geographyeducational film1950svintage filmglobemapcontinentstravelexploration https://avgeeks.videonest.co/videos/1835361/b-52-footage-boeing-plant-seattle-washington-and-m-gXTP1Mu3yg https://img.videonest.org/gamma/1835361_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835361_video_v5_360.mp4 B-52 Footage, Boeing Plant, Seattle, Washington, And Moses Lake Flight Center (silent, 1957) This footage provides a detailed look at the final stages of B-52C Stratofortress construction, pre-flight preparations, and maintenance procedures. Scenes capture aircraft parked on the flight line at Moses Lake Flight Center, crew members suiting up, and pilots entering the cockpit. Ground crews conduct safety checks, including inspecting fuel leaks under the aircraft’s wing. Additional footage shifts to the Firestone Rubber Plant in Los Angeles, documenting the production of fuel cells, from cutting materials to assembling and inspecting the final components. The film serves as a technical and procedural record of B-52C operations and manufacturing, highlighting both military aviation and industrial processes. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 1836 B-52StratofortressBoeingMoses LakeAir ForceFirestoneFuel Cells16mm film1957Cold WarAircraft Manufacturing https://avgeeks.videonest.co/videos/1835362/0387-panama-canal-MAffiGtix3 https://img.videonest.org/gamma/1835362_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835362_video_v5_360.mp4 0387 Panama Canal Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 472 Panama Canalcanal historyearly 1900sshipsengineering https://avgeeks.videonest.co/videos/1835363/the-last-tern-_eZ7HtGx1h https://img.videonest.org/gamma/1835363_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835363_video_v5_360.mp4 The Last Tern Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 1027 Least TernCalifornia BirdsCoastal WildlifeBird NestSeabird https://avgeeks.videonest.co/videos/1835364/306-5914-NZbn_trTCE https://img.videonest.org/gamma/1835364_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835364_video_v5_360.mp4 306 5914 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 829 Korean WarAir Forcemilitary demonstrationjet fightersradar https://avgeeks.videonest.co/videos/1835365/0949-the-executive-Dbk_zKY5FS https://img.videonest.org/gamma/1835365_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835365_video_v5_360.mp4 0949 The Executive Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:50.000Z yes A/V Geeks 16mm Films no 703 16mm filmexecutiveleadershipcareerpromotionofficeworkbusinesssuccessold film https://avgeeks.videonest.co/videos/1835366/0593-pontiac-advertising-06-43-04-00-WnhlMJzEl1 https://img.videonest.org/gamma/1835366_thumbnail_resized_v2.webp https://gamma.videonest.org/1835366_original_360.mp4 0593 Pontiac Advertising 06 43 04 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 416 1955 PontiacPontiacClassic CarVintage Ad1950sAutomobileTelevisionRadioAdvertising Campaign https://avgeeks.videonest.co/videos/1835367/0475-motor-conditioning-in-dogs-Npzp5Xl-7l https://img.videonest.org/gamma/1835367_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835367_video_v5_360.mp4 0475 Motor Conditioning In Dogs Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 424 doghearingtestanimalexperimentvintage filmmotor conditioningAnimal Hearing LaboratoryUniversity of Illinoisotology https://avgeeks.videonest.co/videos/1835368/s-e-manning-company-ltd-film-silent-zPJlPZdhrn https://img.videonest.org/gamma/1835368_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835368_video_v5_360.mp4 S E Manning Company Ltd Film (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 1058 San FranciscoOaklandBerkeleyRichmondEast Baytraveloghistorical footage1930sCalifornia history16mm film https://avgeeks.videonest.co/videos/1835369/great-roads-silent-1970s-v2JQbOsNaJ https://img.videonest.org/gamma/1835369_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835369_video_v5_360.mp4 Great Roads (silent, 1970s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 1099 scenic drive1970shighwaysbridgesroad tripvintage footagetravelcarsnational parksmountains https://avgeeks.videonest.co/videos/1835370/how-movies-began-excerpt-1947-kJDFhk5BzN https://img.videonest.org/gamma/1835370_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835370_video_v5_360.mp4 How Movies Began (Excerpt, 1947) The film explores the origins of motion pictures, beginning with early Magic Lantern slides and evolving through various inventions like the mutoscope and early projectors. It highlights key milestones, including Eadweard Muybridge's pioneering horse motion photography and the rise of Nickelodeons in the late 19th century. The documentary captures the excitement of early cinema in New York and the development of film technology, showcasing classic films and significant historical events that shaped the film industry. Keywords motion pictures, Magic Lantern, Eadweard Muybridge, mutoscope, Nickelodeons, film technology, early cinema, historical events, classic films, New York Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 556 motion picturesmagic lanternEadweard Muybridgemutoscopenickelodeonsfilm technologyearly cinemasilent film https://avgeeks.videonest.co/videos/1835371/0237-yesteryears-a-reminiscence-of-over-two-decade-CW2utQ5Imj https://img.videonest.org/gamma/1835371_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835371_video_v5_360.mp4 0237 Yesteryears A Reminiscence of Over Two Decades 08 46 08 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 776 1910ssilent filmvintagehistorical footagebarber shopnewspapersromance https://avgeeks.videonest.co/videos/1835372/rr342-appcli-7-3bhnq-CYRm https://img.videonest.org/gamma/1835372_thumbnail_resized_v2.webp https://gamma.videonest.org/1835372_original_360.mp4 RR342 appcli 7 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 461 aerial footagewar zonecombatmilitary16mm filmhistorical footage https://avgeeks.videonest.co/videos/1835373/little-journey-to-england-and-france-july-7th-to-a-R1JFvxgmXO https://img.videonest.org/gamma/1835373_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835373_video_v5_360.mp4 Little Journey to England and France July 7th to August 16th Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 3464 ParisFranceChateaux16mm filmEuropeHistoryTravelArchitectureCathedrals https://avgeeks.videonest.co/videos/1835374/besler-corporation-film-silent-ETyJVMRDQs https://img.videonest.org/gamma/1835374_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835374_video_v5_360.mp4 Besler Corporation film (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 1006 Beslersteam powersteam carsteam airplaneNew Haven Traintechnology16mm film https://avgeeks.videonest.co/videos/1835375/two-pay-days-part-ii-HqKGNO3_Eu https://img.videonest.org/gamma/1835375_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835375_video_v5_360.mp4 Two Pay Days Part II Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:49.000Z yes A/V Geeks 16mm Films no 823 salessales training16mm filmvintagecarsChevroletsales techniquesmarketing https://avgeeks.videonest.co/videos/1835376/allentown-parade-silent-z2Y1mn5nLt https://img.videonest.org/gamma/1835376_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835376_video_v5_360.mp4 [Allentown Parade, silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 3800 Allentown PAparademarching bandvintage carsfloatsAllentownPennsylvania1962community eventmilitary paradehistoric eventLiberty BellvintageLehigh ValleyBicentennial Parade https://avgeeks.videonest.co/videos/1835377/6410-glimpses-here-and-there-west-of-twin-peaks-01-rJS_YxN42B https://img.videonest.org/gamma/1835377_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835377_video_v5_360.mp4 6410 Glimpses Here and There West of Twin Peaks 01 40 53 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 1020 Westwood ParkSan Francisco1917vintage film16mmhistorical footagestreetcarautomobilesarchitecture https://avgeeks.videonest.co/videos/1835378/6177-american-indian-when-the-white-man-came-and-a-ZOJITq3L0g https://img.videonest.org/gamma/1835378_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835378_video_v5_360.mp4 6177 American Indian When the White Man Came and After The 18 29 46 00 1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 901 American IndianNative AmericanIndigenous People16mm filmcultural history https://avgeeks.videonest.co/videos/1835379/virginia-capital-square-workprint-silent-yDWphE3S8T https://img.videonest.org/gamma/1835379_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835379_video_v5_360.mp4 [Virginia Capital Square Workprint, silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 667 VirginiaCapital SquareRichmond16mm filmhistorical footagestate capitolstatuesgovernmentstate government https://avgeeks.videonest.co/videos/1835380/untitled-stop-fisk-tire-safety-stripes-silent-gNqzimPA-M https://img.videonest.org/gamma/1835380_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835380_video_v5_360.mp4 [Untitled Stop Fisk Tire Safety Stripes silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 850 fisk tirestire safetycar accidentsvintage safety film16mm filmauto safetysafety stripesvintage adsautomobile accidentscar crashtire technologyautomobile safety https://avgeeks.videonest.co/videos/1835381/proof-the-silent-4tFreJ28oq https://img.videonest.org/gamma/1835381_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835381_video_v5_360.mp4 Proof, The (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 771 16mm filmChevroletproving groundcar testvintage carsauto history https://avgeeks.videonest.co/videos/1835382/rr330-ief-8-k6URO5IJ0y https://img.videonest.org/gamma/1835382_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835382_video_v5_360.mp4 RR330 ief 8 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 1690 vietnam warhuemass graveatrocitiesexhumation196916mm filmarchival footagearmyvietnam https://avgeeks.videonest.co/videos/1835383/peasants-revolt-california-in-century-1-5C6D7BOSK2 https://img.videonest.org/gamma/1835383_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835383_video_v5_360.mp4 Peasants Revolt California In Century 1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 3392 Peasants RevoltMedieval EnglandCalifornia1940sCalifornia industryWat TylerRichard IIFeudal SystemHistorical DramaAgricultureSan FranciscoGolden Gate BridgeIndustrial DevelopmentTourismRebellion https://avgeeks.videonest.co/videos/1835384/6435-transatlantic-telephone-01-44-01-00-I4pvO4CbiW https://img.videonest.org/gamma/1835384_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835384_video_v5_360.mp4 6435 Transatlantic Telephone 01 44 01 00 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 791 transatlantic telephonevintage technology16mm filmtelephone historycommunications historytelephone operators https://avgeeks.videonest.co/videos/1835385/6327-expo-67-01-00-31-28-DSLy5QOMKf https://img.videonest.org/gamma/1835385_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835385_video_v5_360.mp4 6327 Expo 67 01 00 31 28 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:48.000Z yes A/V Geeks 16mm Films no 1766 Expo 67MontrealCanadaWorld's Fair1967Vintage Film16mm FilmHistoryTravel https://avgeeks.videonest.co/videos/1835386/cutting-and-pasting-raw-silent-cL9w_3Alnm https://img.videonest.org/gamma/1835386_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835386_video_v5_360.mp4 Cutting And Pasting (raw, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 1184 classroomcraftingcut and pastevintage educationanimationpaper crafts https://avgeeks.videonest.co/videos/1835387/phxlawsofconservationofmatterandenergy-kETFaxCnVU https://img.videonest.org/gamma/1835387_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835387_video_v5_360.mp4 PHXLawsOfConservationOfMatterAndEnergy Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 538 laws of conservationsciencephysics16mmeducation https://avgeeks.videonest.co/videos/1835388/lightandcolorfootage-dczftnJWOr https://img.videonest.org/gamma/1835388_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835388_video_v5_360.mp4 LightAndColorFootage Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 1394 lightcolorsciencephysicsexperimentvintage16mm filmstock footage https://avgeeks.videonest.co/videos/1835389/phxbirdhomes-ATE3WZeJGM https://img.videonest.org/gamma/1835389_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835389_video_v5_360.mp4 PHXBirdHomes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 176 bird housebird nest16mm filmbirdsnaturewildlife https://avgeeks.videonest.co/videos/1835390/middletonfamilynewyorkworldsfair-lfjU57jIBh https://img.videonest.org/gamma/1835390_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835390_video_v5_360.mp4 MiddletonFamilyNewYorkWorldsFair Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 3280 New York World's FairWestinghouse1939TechnicolorMiddleton familyElectro the Moto-ManTime CapsuleElectrical livingVintage clothingFamily dramaRobotScience exhibitJob creationFamily breakfastTimes Square https://avgeeks.videonest.co/videos/1835391/lets-measure-pints-quarts-gallons-silent-raw-RS26BpWvA3 https://img.videonest.org/gamma/1835391_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835391_video_v5_360.mp4 Lets Measure Pints Quarts Gallons (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 1248 pintsquartsgallonsmeasurementliquid volumevintage16mm filmretroeducation https://avgeeks.videonest.co/videos/1835392/phxinsecthomes-FA6rOTWE-t https://img.videonest.org/gamma/1835392_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835392_video_v5_360.mp4 PHXInsectHomes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 411 insect homesinsect nestsinsect lifebeeswaspscaterpillarmothspiderwebinsect eggs https://avgeeks.videonest.co/videos/1835393/key-inventions-silent-raw-footage-dvI-720nJF https://img.videonest.org/gamma/1835393_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835393_video_v5_360.mp4 Key Inventions (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 986 16mm filminventionsvintagehistorical footageamericanawater wheelcotton ginreaperspinning schoolsmith creekwestern union https://avgeeks.videonest.co/videos/1835394/phxcanadashistory-silent-raw-3Uwiy_oswv https://img.videonest.org/gamma/1835394_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835394_video_v5_360.mp4 PHXCanadasHistory (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 847 16mm filmCanadahistoryhistorical footagevintagearchival footage https://avgeeks.videonest.co/videos/1835395/communications-for-beginners-silent-raw-footage-19-8MuLRJsdeD https://img.videonest.org/gamma/1835395_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835395_video_v5_360.mp4 Communications For Beginners (silent, raw footage,1950s) This 1950s film appears to follow a young boy, often wearing a headdress, as he navigates various situations in reverse motion. The boy interacts with his surroundings by walking, running, and delivering a package backwards, engaging with objects like a toy telegraph, a telephone, and a television. Scenes of historical and technological elements—such as a working telegraph key, a Native American figurine, and a newspaper—suggest themes of communication and cultural representation. The presence of adults guiding the boy, as well as children gathering around an ice cream truck and playing, adds a domestic and educational tone. The film blends everyday suburban life with elements of historical curiosity, creating a unique narrative that explores movement, technology, and cultural imagery. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 1142 1950s filmsilent filmcommunicationtelegraphtelephonetelevisionNative Americanice cream trucksuburban lifehistorical footageboy with headdress https://avgeeks.videonest.co/videos/1835396/phxyugoslavvillage-aroll-0t6dvVRB2Y https://img.videonest.org/gamma/1835396_thumbnail_resized_v2.webp https://gamma.videonest.org/1835396_original_360.mp4 PHXYugoslavVillage ARoll Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 529 Yugoslaviavillage lifehistorical footage16mm filmdaily liferural lifetraditions https://avgeeks.videonest.co/videos/1835397/amphibians-1957-80F95GpDoh https://img.videonest.org/gamma/1835397_thumbnail_resized_v2.webp https://gamma.videonest.org/1835397_original_360.mp4 Amphibians (1957) This 11-minute educational film explores the characteristics of amphibians, focusing on frogs, toads, and salamanders. It highlights their similarities and differences, examining their habitats, life cycles, and unique ability to live both in water and on land. The film provides a detailed look at metamorphosis, following the transformation of a frog from egg to tadpole to adult. Presented in black and white, it serves as an informative introduction to amphibian biology for students. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:47.000Z yes A/V Geeks 16mm Films no 625 amphibiansfrogstoadssalamandersnewtstadpolesmetamorphosisanimal life cycleanimal biologycold bloodedvertebratescamouflage https://avgeeks.videonest.co/videos/1835398/phxbanksandcredit-4akcldTrRL https://img.videonest.org/gamma/1835398_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835398_video_v5_360.mp4 PHXBanksAndCredit Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1742 bankingfinancecreditamerican history1940s https://avgeeks.videonest.co/videos/1835399/phxchristianityinworldhistory-raw-silent-S7Ji0THpC1 https://img.videonest.org/gamma/1835399_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835399_video_v5_360.mp4 PHXChristianityInWorldHistory (raw, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 817 Christianityworld history16mm filmreligious historyRomeRoman empiremonksancient romeConstantine https://avgeeks.videonest.co/videos/1835400/animal-studies-social-modification-silent-C_3rQN4VHQ https://img.videonest.org/gamma/1835400_thumbnail_resized_v2.webp https://gamma.videonest.org/1835400_original_360.mp4 Animal Studies Social Modification (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 687 animal studiessocial modificationbehaviorpsychologyratsanimal behavior https://avgeeks.videonest.co/videos/1835401/phxlawsofgases-mCZeutHoLf https://img.videonest.org/gamma/1835401_thumbnail_resized_v2.webp https://gamma.videonest.org/1835401_original_360.mp4 PHXLawsOfGases Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 517 gas lawsboyle's lawcharles' lawavogadro's lawdalton's lawphysics educationchemistry education https://avgeeks.videonest.co/videos/1835402/making-of-the-river-raw-footage-silent-TomOUY7V2a https://img.videonest.org/gamma/1835402_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835402_video_v5_360.mp4 Making Of The River (raw footage, silent) This passage vividly describes serene and dramatic natural landscapes, primarily focusing on rivers, waterfalls, and grasslands in the 1960s. It paints a picturesque scene of water flowing through various terrains—winding fields, rocky chasms, and grassy wetlands—accompanied by elements like sunlight filtering through trees and misty, cloud-covered mountains. The repetition of phrases like "waterfall crashing" and "river flowing" enhances the imagery of movement and tranquility in nature. Would you like me to refine or expand on this description? Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 240 riverwaterfall16mm filmnaturevintage1960slandscapewaterstreamforest https://avgeeks.videonest.co/videos/1835403/birthofnasa-KtJ5NEpiiy https://img.videonest.org/gamma/1835403_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835403_video_v5_360.mp4 BirthOfNASA Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1810 NASASpace ProgramSputnikExplorer 1Mercury ProgramSpace RaceRocket LaunchVintage FootageArchivalSpace History https://avgeeks.videonest.co/videos/1835404/phxaudiovisualmaterialsinteaching-raw-FCfo-LToTt https://img.videonest.org/gamma/1835404_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835404_video_v5_360.mp4 PHXAudioVisualMaterialsInTeaching (raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1759 educationclassroomaudio visualteachingschoolfilm16mmprojectorstudentsteacher https://avgeeks.videonest.co/videos/1835405/phxcolorinart-raw-silent-gsbJt0Ui_Q https://img.videonest.org/gamma/1835405_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835405_video_v5_360.mp4 PHXColorInArt (raw, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 543 16mm filmart classart techniquescolor mixingvintage educationart education https://avgeeks.videonest.co/videos/1835406/phxchina-Wr3ySVRyrm https://img.videonest.org/gamma/1835406_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835406_video_v5_360.mp4 PHXChina Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 646 China16mm filmagricultureindustrydaily lifehistorical footageChinese culture https://avgeeks.videonest.co/videos/1835407/menandpulleys-silent-gY3SSEDPZP https://img.videonest.org/gamma/1835407_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835407_video_v5_360.mp4 MenandPulleys (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 375 nuclear researchatomic energy1960snuclear reactorenergy productionresearch facility https://avgeeks.videonest.co/videos/1835408/phxletsmeasure-silent-raw-N2rKBpq7P9 https://img.videonest.org/gamma/1835408_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835408_video_v5_360.mp4 PHXLetsMeasure (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1257 educational film16mm filmmeasurementvintagebaseball https://avgeeks.videonest.co/videos/1835409/phxavisitfromstnicholas-raw-UUPkE2kfwL https://img.videonest.org/gamma/1835409_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835409_video_v5_360.mp4 PHXAVisitFromStNicholas (raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 861 16mm filmchristmas animationvintage christmasst nicholastwas the night https://avgeeks.videonest.co/videos/1835410/rr306-6852-whRbyh4uzX https://img.videonest.org/gamma/1835410_thumbnail_resized_v2.webp https://gamma.videonest.org/1835410_original_360.mp4 RR306 6852 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 873 Telstarsatellitespace racecommunication technology1960sBell SystemJohn F Kennedyearly satellite https://avgeeks.videonest.co/videos/1835411/decisions-raw-silent-IAeBW04EAI https://img.videonest.org/gamma/1835411_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835411_video_v5_360.mp4 Decisions (raw, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1244 family1950svintagedecision makinghome life https://avgeeks.videonest.co/videos/1835412/gift-home-remodel-silent-raw-footage-iOn9pOrUoD https://img.videonest.org/gamma/1835412_thumbnail_resized_v2.webp https://gamma.videonest.org/1835412_original_360.mp4 Gift Home Remodel (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Silent footage documenting what appears to be a mid-century residential remodeling project from planning through completion — likely produced as a sponsored or promotional home-improvement film, possibly connected to Dutch Boy Paints. The footage opens with an intimate interior scene of a couple — a dark-haired woman and a man in a white shirt and tie — seated at a dining table together reviewing what appear to be architectural blueprints or design plans, establishing the project's starting point. The film then moves outdoors to the construction phase, showing a worker in a white t-shirt handling and installing lumber on scaffolding along the side of the house, capturing the framing or siding work in progress. Close-up detail shots follow, including a tight shot of hands installing an electrical ceiling fixture with wires and wooden joists visible overhead. A group inspection scene shows several people gathered near the partially built addition, surrounded by lumber and framing against a backdrop of leafy trees, as though the homeowners and contractors are reviewing progress together. Two men in suits are later seen crouching over something at ground level, apparently examining construction details or reviewing plans on site. The film then shifts to a shopping interlude, with the woman (now in a white hat) and her husband visiting what appears to be a building materials showroom, browsing a large display board covered with photographs, brochures, and home product samples, with a decorative advertising cutout visible in the background. Back at the house, close-up product shots prominently feature a can of Dutch Boy "Sash & Trim Color — Dusty Pink" paint, clearly a sponsored product placement. A floor installation sequence follows, showing a worker laying flooring with a box of "Pride Vinyl-Core Floor Tile" beside him on the subfloor. The film ends with an outdoor shot of the newly landscaped yard — the ground still freshly turned — with a contractor's sign reading "Watkin & Sibbald, Landscape Contractors" staked prominently among the soil, indicating the final phase of the remodel, before closing on a title card reading "The End." 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 433 home remodeldutch boy paint16mm filmvintage advertisingmid-century modernhome improvementsilent filmconstructionlandscapinginterior design https://avgeeks.videonest.co/videos/1835413/mark-of-the-clown-EyxrjrXBNO https://img.videonest.org/gamma/1835413_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835413_video_v5_360.mp4 Mark Of The Clown Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 953 16mm filmclown ministryvintagechurchclownfilm https://avgeeks.videonest.co/videos/1835414/phxbillyshelicopterride-silent-raw-DbDCpJs4PA https://img.videonest.org/gamma/1835414_thumbnail_resized_v2.webp https://gamma.videonest.org/1835414_original_360.mp4 PHXBillysHelicopterRide (silent, raw) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 441 helicopter16mm filmvintageaviationboyairplaneaircraftpilotflight https://avgeeks.videonest.co/videos/1835415/phximprovespelling-UixZwGjG6F https://img.videonest.org/gamma/1835415_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835415_video_v5_360.mp4 PHXImproveSpelling Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 1233 spellingeducationinstructional filmvintage16mm filmlearningwritingwords https://avgeeks.videonest.co/videos/1835416/honolulu-in-yukon-silent-sWl7J15Rbv https://img.videonest.org/gamma/1835416_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835416_video_v5_360.mp4 Honolulu In Yukon (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This vintage film documents mid-20th-century aviation and wilderness scenes across Northern Canada and the Yukon. It opens with detailed footage of a yellow helicopter's maintenance and flight preparations at an airfield, followed by animated maps tracing a northern flight route through Alberta, British Columbia, and the Yukon. The narrative transitions to serene outdoor activities such as fishing and camping, then showcases seaplane operations on remote mountain lakes. The film highlights rugged natural landscapes with aerial views of deep river canyons, mountain goats and Dall sheep navigating steep terrain, and grizzly bears foraging in lush wilderness. It concludes with intimate portraits of indigenous people, expansive mountain vistas, and a nostalgic closing title. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 601 yukonaviationbush planehelicopterwilderness16mm filmindigenous peoplenorthern canadafishingcampingmountain vistasgrizzly bearsdall sheep https://avgeeks.videonest.co/videos/1835417/phxinvertebrates-QN9QijQTZD https://img.videonest.org/gamma/1835417_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835417_video_v5_360.mp4 PHXInvertebrates Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:46.000Z yes A/V Geeks 16mm Films no 386 invertebratesmarine lifewildlifewormsjellyfishcrabscentipedeshellfishsnails https://avgeeks.videonest.co/videos/1835418/picking-rogue-river-pears-silent-1950s-NK5jAi8KDH https://img.videonest.org/gamma/1835418_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835418_video_v5_360.mp4 Picking Rogue River Pears (silent, 1950s?) Shows the process of picking Rogue River pears in Oregon, highlighting a team, possibly a family, engaged in the activity. It focuses on an older couple as they set up a ladder to reach the fruit, demonstrating proper picking techniques. The narrative includes details about the quality assessment of pears, distinguishing between those suitable for harvest and those that are not. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 478 Rogue Riverpear harvestfruit pickingvintage film1950sorchardOregonagriculturefruit16mm film https://avgeeks.videonest.co/videos/1835419/medieval-times-role-of-the-church-silent-raw-foota-ZaXUtIHn04 https://img.videonest.org/gamma/1835419_thumbnail_resized_v2.webp https://gamma.videonest.org/1835419_original_360.mp4 Medieval Times Role Of The Church (silent, raw footage) Silent raw footage from Medieval Times: Role Of The Church (1961) provides an in-depth look at the religious and cultural significance of the Church during the medieval era. Through a mix of historical reenactments and architectural studies, the footage explores grand Gothic cathedrals, illuminated manuscripts, religious figures, and the daily lives of monks, scribes, and peasants. The film highlights key elements such as stained glass windows, stone carvings, reliquaries, and church rituals while also depicting the role of clergy, bishops, and religious scholars in medieval society. With its focus on both spiritual and social influences, this series serves as an educational resource on the intersection of faith, art, and daily life in the Middle Ages. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 1052 Medieval TimesChurchGothic CathedralIlluminated ManuscriptMonkClergyStained GlassStone CarvingReliquaryChurch RitualsReligious Scholar https://avgeeks.videonest.co/videos/1835420/peacefulones-GBPWOTdl5A https://img.videonest.org/gamma/1835420_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835420_video_v5_360.mp4 PeacefulOnes Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 655 hopinative americanpuebloancientarizonakachinasnake danceold oraibiweavingindigenous culturesouthwest usa https://avgeeks.videonest.co/videos/1835421/boulder-dam-silent-PoFFwyzG6K https://img.videonest.org/gamma/1835421_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835421_video_v5_360.mp4 [Boulder Dam, silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Showcases the breathtaking landscapes around Lake Mead, featuring towering cliffs and rock formations. It highlights recreational boating activities, emphasizing leisure and exploration in this serene environment created by Boulder Dam, all while capturing the majestic canyons and rugged beauty of the area. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 883 Lake MeadBoulder DamBoat TourVintage FilmCanyonsLandscapesBoating16mm filmAmerican WestHoover DamArizonaNevada https://avgeeks.videonest.co/videos/1835422/alaska-silent-O6iZWu51Fp https://img.videonest.org/gamma/1835422_thumbnail_resized_v2.webp https://gamma.videonest.org/1835422_original_360.mp4 [Alaska, silent] Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A vivid visual sampler of Alaskan scenery and fauna. After a brief film leader, the footage opens with a breathtaking wide shot of a steep, heavily snow-draped mountain slope rising above a dark belt of spruce trees beneath a pale blue sky — an immediately striking introduction to the Alaskan landscape. The film then cuts to a body of icy, grey water where a waterfowl — likely a common merganser or similar diving duck, with a dark head and rust-and-white body — floats near a snow-covered bank while a seagull circles overhead in the overcast sky. A dramatic change of setting follows, with a group of six or seven skiers in dark winter gear gathered on a steep, heavily forested snowy slope, ski poles in hand, suggesting backcountry or sidecountry skiing. Wildlife returns as the central theme: two large white Dall sheep rams with thick curving horns are filmed resting on a rocky cliff ledge against a brilliant blue sky with bare-branched shrubs behind them. The film then shifts to a river fishing scene, with a person dressed entirely in red — hooded sweatshirt, hat, and waders — standing in a dark, still stream holding a fishing rod and displaying a freshly caught fish to the camera, flanked by dense forest. Back to wildlife, a sandhill crane with its characteristic red-capped head is filmed close up, pecking and foraging across a dry, grassy marsh flat. A pale-coated grizzly or brown bear — its blonde fur standing out against the lush green tundra vegetation — is seen foraging with its back to the camera. The film's most dramatic moment comes when a person in a red jacket and orange cap stands face-to-face at remarkably close range with a large bull caribou bearing impressive antlers, the two silhouetted against the blazing autumn tundra glowing red and orange. The film closes with a stunning close-up profile of that same bull caribou — its massive, wide-spreading rack filling the frame — moving steadily through the russet fall brush, a powerful finale to this vivid collection of Alaskan wilderness images.Spend limit reached · Manage 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 182 Alaska16mm filmvintage footagewildlifemountainsskiingcaribouDall sheepfishinggrizzly bearsandhill crane https://avgeeks.videonest.co/videos/1835423/bryce-canyon-silent-GBvm0arLds https://img.videonest.org/gamma/1835423_thumbnail_resized_v2.webp https://gamma.videonest.org/1835423_original_360.mp4 Bryce Canyon (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 168 Bryce CanyonNational ParkUtahAmerican WestHoodoosNatural BridgeColor Home Movies16mm film https://avgeeks.videonest.co/videos/1835424/pigments-and-people-silent-aebcL55LSZ https://img.videonest.org/gamma/1835424_thumbnail_resized_v2.webp https://gamma.videonest.org/1835424_original_360.mp4 Pigments And People (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 353 art galleryheistsilent comedy16mm filmvintage filmpaintingmuseumpolice https://avgeeks.videonest.co/videos/1835425/introducing-dorsett-1960-silent-7Ioz9hE-5W https://img.videonest.org/gamma/1835425_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835425_video_v5_360.mp4 Introducing Dorsett 1960 (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 477 Dorsett boats1960svintage boat16mm filmrunaboutsluxury boats https://avgeeks.videonest.co/videos/1835426/we-ll-get-there-somehow-r3b-silent-raw-footage-hUA9bs0dCv https://img.videonest.org/gamma/1835426_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835426_video_v5_360.mp4 We'll Get There Somehow R3B (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 491 Halliburtonoil wellcementingvintage filmoil industrytruck16mmoil workers https://avgeeks.videonest.co/videos/1835427/measurement-silent-raw-footage-1960s-7b43o26gFR https://img.videonest.org/gamma/1835427_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835427_video_v5_360.mp4 Measurement (silent, raw footage, 1960s) This film, set in the 1960s, showcases various scientific and engineering activities, particularly in physics and laboratory settings. It features individuals conducting experiments, using measurement tools, and operating specialized equipment. Scenes include students performing physics experiments with weights, scales, and yardsticks, as well as professionals working with control panels, gauges, and scientific instruments like microscopes and motor testers. The film highlights both hands-on experimentation and technological advancements of the era, illustrating precise measurements, calculations, and observations in a controlled environment. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 1010 1960sscienceexperimentsmeasurementphysicsvintagelabscientific instrumentsengineeringold film https://avgeeks.videonest.co/videos/1835428/a-true-story-about-hospitals-silent-3uuK1iZlLp https://img.videonest.org/gamma/1835428_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835428_video_v5_360.mp4 A True Story About Hospitals (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 424 hospitalchildrenvintage16mmmedicalnursespatient carex-rayLos Angeles https://avgeeks.videonest.co/videos/1835429/blitz-commercial-outtakes-silent-fsNDfHKOYz https://img.videonest.org/gamma/1835429_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835429_video_v5_360.mp4 Blitz commercial outtakes (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:45.000Z yes A/V Geeks 16mm Films no 682 Blitz beer16mm filmcommercial outtakesvintage advertisementbeer commercialWham-Obicycle stunts https://avgeeks.videonest.co/videos/1835430/multiplication-silent-raw-footage-1950s-RD-XXMxmep https://img.videonest.org/gamma/1835430_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835430_video_v5_360.mp4 Multiplication (silent, raw footage, 1950s) Silent raw footage from the educational film, Multiplicationffrom the 1950s is an educational film designed to teach elementary school students about multiplication through relatable, everyday scenarios. Produced by Coronet, the footage features a young boy working through math problems at his bedroom desk, using a pencil and paper to solve equations. Other scenes incorporate practical applications of multiplication, such as calculating newspaper deliveries, counting marbles, and observing a car’s speedometer. The film emphasizes foundational math skills, reinforcing problem-solving techniques and logical thinking in a mid-century classroom and home setting. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 706 multiplication1950seducational filmmathCoronetvintage educationelementary schoolraw footage https://avgeeks.videonest.co/videos/1835431/medieval-times-guilds-and-trade-silent-raw-footage-ffoCrllIud https://img.videonest.org/gamma/1835431_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835431_video_v5_360.mp4 Medieval Times: Guilds And Trade (silent, raw footage) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This silent 1960s footage is a richly layered educational documentary tracing the history of European trade, craftsmanship, and commerce from medieval times to the modern era, likely produced for classroom use. Set against the backdrop of a European city — identified as Essen, Germany — the film moves fluidly between museum exhibits and living history, opening with a family examining a model medieval sailing ship before plunging into reconstructed medieval marketplace scenes. Merchants examine maps, handle silk tunics, spices, leather shoes, and pewterware, while craftspeople demonstrate lacemaking on bobbins and cobbling in workshops. The film traces trade routes along canals and rivers, past castle-topped hills and clocktower squares, connecting medieval commerce to modern factory shoe production. Roman history is woven in dramatically — a Roman governor with orb and scepter, medieval soldiers storming Roman buildings, barbarians sacking a Roman workshop — illustrating the long arc of European economic and political power. International flags over a government building and crowded diplomatic meeting rooms anchor the story in the postwar European present, suggesting themes of economic cooperation and shared heritage. **Keywords:** 1960s, European history, medieval trade, commerce, craftsmanship, Essen Germany, canal city, lacemaking, cobbling, spice trade, silk, pewter, gondolas, Roman history, medieval soldiers, educational film, museum, marketplace, economic history, postwar Europe 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 1162 1960smedieval tradeeuropean historycraftsmanshipessen germanyguilds https://avgeeks.videonest.co/videos/1835432/maze-learning-in-white-rats-silent-hfOiKAVDaB https://img.videonest.org/gamma/1835432_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835432_video_v5_360.mp4 Maze Learning in White Rats (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This vintage black-and-white educational footage documents a series of scientific experiments focused on maze learning and navigation across various subjects, including white laboratory rats, mice, micro-robots, microscopic organisms, and even slugs. The footage captures detailed overhead and close-up views of these subjects as they explore complex grid-like mazes, demonstrating their problem-solving and spatial memory abilities through multiple trials. The film also includes demonstrations of early robotic maze navigation, mechanical maze solvers, and the construction of maze apparatuses, providing a comprehensive historical overview of behavioral and automated maze navigation research. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 919 rat mazemaze learninganimal behaviorvintage filmeducational footagescientific experimentslaboratory ratsspatial memory https://avgeeks.videonest.co/videos/1835433/man-injured-silent-2Ib5RkvQEN https://img.videonest.org/gamma/1835433_thumbnail_resized_v2.webp https://gamma.videonest.org/1835433_original_360.mp4 Man Injured (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. he footage explores critical themes of safety within the furniture manufacturing and woodworking industries. It begins by showcasing various filming locations associated with furniture companies, underlining the significance of maintaining safety protocols in these environments. The narrative progresses to a scene where an individual operates a table saw, illustrating the inherent dangers of woodworking machinery and the risks involved as hands come dangerously close to the saw blade. Following this, viewers witness a person skillfully handling a woodcutting machine, feeding plywood sheets with precision, further emphasizing the necessity of adhering to safety measures in industrial settings. The segment concludes with a transition to the aftermath of a woodworking injury, hinting at a larger investigation into safety practices and their implications both in professional and domestic spheres. #Workplace Safety #Woodworking Hazards #Table Saw Safety #Furniture Manufacturing #Injury Prevention Timeline 00:00:00 - 00:02:30 Workplace Safety in Furniture Manufacturing 00:00:43 A sign from the Furniture Manufacturers of California emphasizes the need to guard against hazardous tools in the industry, focusing on workplace safety. 00:00:53 A chair with a sign lists various furniture and fixture companies as filming locations, suggesting documentation of these businesses. 00:02:30 - 00:04:00 Table Saw Accident 00:02:30 A person is shown working with wooden boards on a table saw, indicating a woodworking task in a workshop setting. 00:03:51 The scene suggests an imminent accident as the person's hands are positioned dangerously close to the operating saw blade. 00:04:00 - 00:07:26 Woodcutting Machine Operation 00:04:21 A person operates a woodcutting machine, feeding plywood sheets into a cutter with precise handling to align and cut the boards accurately. 00:04:23 The individual carefully maneuvers a large sheet of plywood through a table saw using both hands, emphasizing caution and precision in a workshop setting. 00:07:00 The person continues to work with a table saw, guiding a piece of wood through the blade with a red guide fence for precision cutting, focusing on safety and accuracy. 00:07:26 - 00:11:10 Accident Scene Investigation 00:07:26 A hand is shown near a table saw with materials secured, indicating a potential woodworking accident and the importance of safety. 00:10:56 A dimly lit living room with armchairs and a lamp suggests a domestic environment where an incident may have occurred. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 670 workplace safetywoodworking hazardsfurniture manufacturingindustrial safetytable saw safety https://avgeeks.videonest.co/videos/1835434/map-skills-silent-raw-footage-1960s-1UOfzPtUPp https://img.videonest.org/gamma/1835434_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835434_video_v5_360.mp4 Map Skills (silent, raw footage, 1960s) Raw footage focused on geography, industry, transportation, and everyday life. Through a mix of classroom scenes, hands-on learning, and real-world examples, the footage captures students engaging with books and maps, highlighting traditional study habits of the era. The series also expands beyond the classroom, showcasing various industries, including farming, logging, steel production, urban development, and transportation methods like ships, trains, and cargo planes. With a distinctly mid-century aesthetic, these films provide a snapshot of 1960s education and infrastructure, emphasizing the connection between geography and human activity. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 604 1960seducationclassroomgeographymapsindustryfarmingloggingsteel productiontransportationurban development https://avgeeks.videonest.co/videos/1835435/stoneforest-vZ-ujpzKR3 https://img.videonest.org/gamma/1835435_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835435_video_v5_360.mp4 StoneForest Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 937 petrified forestnational parkarizonapetrified woodancient historynatural historygeological changedesert landscapepetroglyphsancient trees https://avgeeks.videonest.co/videos/1835436/phxdivisioniseasyareel-silent-raw-footage-0aOvz7Thu8 https://img.videonest.org/gamma/1835436_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835436_video_v5_360.mp4 PHXDivisionIsEasyAReel (silent, raw footage) PHXDivisionIsEasyAReel (silent, raw footage) Overview The footage presents an engaging exploration of division, featuring a variety of educational activities designed to enhance mathematical understanding. It begins with foundational concepts in division, supported by insights from F. Lynwood Wren, a mathematics professor. Viewers will see detailed demonstrations of basic division problems being solved on a chalkboard, emphasizing a methodical approach to arithmetic. A hand is shown using chalk to illustrate the step-by-step process, reinforcing the educational intent. Additionally, the footage captures children actively participating in learning experiences, such as arranging coins, managing a toy rental club, and solving math problems. The focus on hands-on activities enhances the learning environment. The segment also includes a demonstration of division, showcasing a young girl as she confidently tackles problems on a smaller chalkboard, further illustrating the application of division in a relatable context. Overall, the footage serves as a rich resource for those interested in educational mathematics, particularly division. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. #EducationalMathematics #Division #ChalkboardDemonstration #HandsOnLearning #FlynwoodWren Timeline 00:00:00 - 00:02:13 Educational Mathematics Content 00:00:00 The content is educational material on mathematics, focusing on division. 00:00:20 The material was developed with input from F. Lynwood Wren, a mathematics professor at George Peabody College for Teachers. 00:00:23 The footage is designed for instructional purposes and produced by Coronet Instructional Films, utilizing the RCA sound system. 00:02:13 - 00:04:00 Chalkboard Division Demonstration 00:02:13 A hand demonstrates dividing 39 by 3 on a chalkboard, illustrating the initial setup of a division problem. 00:02:51 The hand continues to write out the division problem, emphasizing the methodical approach to solving it. 00:02:59 The segment concludes with the hand solving 96 divided by 3, highlighting the steps of long division. 00:04:00 - 00:08:00 Learning with Objects and Chalkboard 00:05:24 A child is seen arranging coins into groups on a blue surface, demonstrating a basic math activity involving division or counting. 00:06:46 Two children are organizing a 'Toy Rental Club' in a room filled with toys, suggesting a collaborative and structured play environment. 00:07:29 A young boy stands at a chalkboard, actively writing mathematical equations, likely focusing on division problems in a classroom setting. 00:08:00 - 00:11:00 Division Demonstration 00:08:44 A hand draws a division problem on a blackboard, setting up the mathematical operation. 00:09:31 A young girl in a plaid dress stands next to a chalkboard displaying simple division problems, likely in an educational setting. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 661 divisionmathematicsretro educationchalkboardmath lesson https://avgeeks.videonest.co/videos/1835437/phxlivingandnonlivingthings-raw-footage-silent-195-zlIP3hBd9d https://img.videonest.org/gamma/1835437_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835437_video_v5_360.mp4 PHXLivingAndNonLivingThings (raw footage, silent, 1950s) The raw, silent footage from *Living and Non-Living Things* (1958, Coronet Films) presents a visual exploration of distinguishing between living organisms and inanimate objects. The scenes depict children interacting with nature, such as touching leaves, playing with dogs, feeding fish, and observing plants. There are recurring shots of a dachshund eating, boys sitting on the grass petting a dog, and a boy holding an object out to a dog, emphasizing the characteristics of living things. Non-living elements are also showcased, including rocks, cars, houses, and decorative ponds. The footage includes observational learning moments, with children examining nature, a man and woman discussing plants, and handwritten notes appearing on paper. Throughout, shooting slates are used to mark scenes, reinforcing an educational structure. The film aims to highlight the defining features of life, such as movement, growth, and sustenance, contrasting them with the static properties of non-living objects. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:44.000Z yes A/V Geeks 16mm Films no 1289 1950seducational filmscience educationliving thingsnon-living thingsvintage footagearchival film16mm filmcoronet films https://avgeeks.videonest.co/videos/1835438/oaunknownhomemovieswaterfowl3-cont-2BglQxo-pU https://img.videonest.org/gamma/1835438_thumbnail_resized_v2.webp https://gamma.videonest.org/1835438_original_360.mp4 OAunknownhomemoviesWaterfowl3 cont Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:43.000Z yes A/V Geeks 16mm Films no 134 pelicanswaterfowlbirdscrater lakenational park16mm film https://avgeeks.videonest.co/videos/1835439/oaunknownhomemovieswaterfowl3-M_KEGcMQto https://img.videonest.org/gamma/1835439_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835439_video_v5_360.mp4 OAunknownhomemoviesWaterfowl3 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:43.000Z yes A/V Geeks 16mm Films no 1171 16mm filmwaterfowlwildlife refugebirdsnaturenational parkvintage filmtravelsceneryhomemovies https://avgeeks.videonest.co/videos/1835440/phx-ourteachers-broll-W_qTx5DGh9 https://img.videonest.org/gamma/1835440_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835440_video_v5_360.mp4 PHX OurTeachers BRoll Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:41.000Z yes A/V Geeks 16mm Films no 481 classroomteacherstudents16mm filmvintageeducationschool1950slearning https://avgeeks.videonest.co/videos/1835441/phx-safedrivingstreets-aroll-RsIKBZsNqc https://img.videonest.org/gamma/1835441_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835441_video_v5_360.mp4 PHX SafeDrivingStreets ARoll Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:41.000Z yes A/V Geeks 16mm Films no 594 safe drivingdriving tips16mm filmvintage carsdriver educationtraffic safety https://avgeeks.videonest.co/videos/1835442/phx-rockymountainmammals-aroll-S9a_lbhQiS https://img.videonest.org/gamma/1835442_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835442_video_v5_360.mp4 PHX RockyMountainMammals ARoll Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:41.000Z yes A/V Geeks 16mm Films no 619 Rocky Mountainsmammalsbig horn sheepdeervintage film16mm filmanimal footage https://avgeeks.videonest.co/videos/1835443/phx-truckfarmcan2-zOIQ7--N2R https://img.videonest.org/gamma/1835443_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835443_video_v5_360.mp4 PHX TruckFarmCan2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:41.000Z yes A/V Geeks 16mm Films no 579 farm lifefarmingfamilyokratomatoestractorharvestingrural life16mm filmav geeks https://avgeeks.videonest.co/videos/1835444/the-industrial-revolution-in-england-1959-SGGjzUMmWW https://img.videonest.org/gamma/1835444_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835444_video_v5_360.mp4 The Industrial Revolution In England (1959) The film explores the Industrial Revolution in England, highlighting the stark contrast between rural life 200 years ago and the rapid industrialization that followed. Initially, most of the population engaged in primitive farming and domestic textile production, with low living standards. Key inventions like the spinning jenny, power loom, and steam engine drastically transformed manufacturing, shifting from home-based production to factories. While these advancements led to national prosperity and increased productivity, they also resulted in harsh working conditions and social struggles for the laboring class. Reform movements emerged to address these issues, ultimately leading to improved labor rights and conditions. Keywords Industrial Revolution, England, textile industry, spinning jenny, power loom, steam engine, manufacturing, factories, labor conditions, social reform 2026-04-28T16:36:40.000Z yes A/V Geeks 16mm Films no 1507 Industrial RevolutionEnglandtextile industryfactory systemsocial reformlabor conditionssteam enginepower loomspinning jenny https://avgeeks.videonest.co/videos/1835445/no-title-film-segment-fire-gfROH9C53P https://img.videonest.org/gamma/1835445_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835445_video_v5_360.mp4 no title film segment FIRE Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:40.000Z yes A/V Geeks 16mm Films no 116 sun energyphotosynthesisfossil fuelscoalpetroleumsolar energy16mm film https://avgeeks.videonest.co/videos/1835446/asharlemaddiction-cbK4gpoNGA https://img.videonest.org/gamma/1835446_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835446_video_v5_360.mp4 AsHarlemAddiction Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:39.000Z yes A/V Geeks 16mm Films no 1160 HarlemNew York City16mm filmstreet photographyvintage footage1970s https://avgeeks.videonest.co/videos/1835447/plantorganismemulsiondamagescratches-rormLWulwW https://img.videonest.org/gamma/1835447_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835447_video_v5_360.mp4 PlantOrganismEmulsionDamageScratches Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:39.000Z yes A/V Geeks 16mm Films no 1425 photosynthesisplant cellsplant tissuesplant organsplant growthplant developmentplant rootsplant stemsplant leavesseed productionseed germinationplant life cyclechlorophyllgreen plantsplant dispersal https://avgeeks.videonest.co/videos/1835448/306-5811-xlJIV7eZIB https://img.videonest.org/gamma/1835448_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835448_video_v5_360.mp4 306 5811 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 412 Hiroshima16mm filmarchival footagepeaceexhibitionJapanatoms for peaceatomic energy https://avgeeks.videonest.co/videos/1835449/geminiapollohdresourcereel-h-264-W3jf0voTQF https://img.videonest.org/gamma/1835449_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835449_video_v5_360.mp4 GeminiApolloHDResourceReel H 264 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 8146 NASAastronautsrocket launchspace explorationspace missionspace capsulemoon landingApolloGeminiProject Mercurylunar surfaceastronaut trainingspace programrocketlunar module https://avgeeks.videonest.co/videos/1835450/newzealand-march-april2001-ublX6007-d https://img.videonest.org/gamma/1835450_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835450_video_v5_360.mp4 NewZealand March April2001 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 3780 New Zealandglacierfjordsmountainswaterfallsaerial viewPancake RocksMilford Soundcoastal scenerysnowy mountainsrainforestboat tourhydroelectric powerChristchurch TramwayPaparoa National Park https://avgeeks.videonest.co/videos/1835451/unknown-title-foreign-language-likely-iran-revolut-nKeqCLxLZy https://img.videonest.org/gamma/1835451_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835451_video_v5_360.mp4 unknown title foreign language likely Iran Revolution footage Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 1921 IranIranian historyMohammad Reza PahlaviShah PahlaviWhite Revolutionmodernizationindustrial developmenteconomic developmentland reformagricultural reformeducationliteracy corpsKhuzestanoil nationalizationTehran https://avgeeks.videonest.co/videos/1835452/focusonlaosunderfiretoodamagedcopyrighted-O60WwISIxy https://img.videonest.org/gamma/1835452_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835452_video_v5_360.mp4 FocusOnLaosUnderFireTOODAMAGEDCOPYRIGHTED Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 837 LaosSoutheast Asia1970sDocumentaryHistoryLaotian Civil WarKodak16mm filmcold warneutral nation https://avgeeks.videonest.co/videos/1835453/coronet-dividing-2-Ek2FunfwhN https://img.videonest.org/gamma/1835453_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835453_video_v5_360.mp4 Coronet Dividing 2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:38.000Z yes A/V Geeks 16mm Films no 624 divisionmath16mm filmeducationarithmetic https://avgeeks.videonest.co/videos/1835454/79-hfc-120-GkTS0sE1RT https://img.videonest.org/gamma/1835454_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835454_video_v5_360.mp4 79 hfc 120 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 137 mountainmountains16mm filmvintagenaturescenicsnow capped mountainstreeslandscape https://avgeeks.videonest.co/videos/1835455/79-hfc-143-gT5dqTY_3E https://img.videonest.org/gamma/1835455_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835455_video_v5_360.mp4 79 hfc 143 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 130 lavavolcano16mm filmvintagegeologynatural disaster https://avgeeks.videonest.co/videos/1835456/79-hfc-118-i7tSX7HKzo https://img.videonest.org/gamma/1835456_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835456_video_v5_360.mp4 79 hfc 118 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 315 wildlifedeerbighorn sheepraccoonsducksbirdssalmonforestrivernature https://avgeeks.videonest.co/videos/1835457/corn-for-the-masses-maiz-para-las-masas-1950s-QkDd-DURAa https://img.videonest.org/gamma/1835457_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835457_video_v5_360.mp4 Corn For the Masses (Maiz Para Las Masas, 1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Presents a satirical take on a political campaign where the candidate, Borito, promises "corn for the masses" as a central theme of his platform. He emphasizes the importance of honesty and good governance, while the election atmosphere is filled with excitement and drama as citizens eagerly await the voting results. Ultimately, the candidate wins by a landslide, leading to celebrations and the promise of corn distribution to the public. Keywords politics, election, satire, governance, community, corn, campaign, democracy, voting, celebration 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 383 politicselectionsatirecorncampaigndemocracy16mm film https://avgeeks.videonest.co/videos/1835458/rrh-hf-214-r3-WS-Zh8VkAZ https://img.videonest.org/gamma/1835458_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835458_video_v5_360.mp4 RRH HF 214 R3 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 610 art educationHarlem YMCA16mm filmBlack artistssculpturedrawingpaintingart classvintage film https://avgeeks.videonest.co/videos/1835459/79-hfc-121-_Pss_SunHK https://img.videonest.org/gamma/1835459_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835459_video_v5_360.mp4 79 hfc 121 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 221 Pacific Northwest16mm filmcoastlinemountainswaterfallswinterriverAmerican Flag https://avgeeks.videonest.co/videos/1835460/306-6757-fTTpnIlWpL https://img.videonest.org/gamma/1835460_thumbnail_resized_v2.webp https://gamma.videonest.org/1835460_original_360.mp4 306 6757 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:37.000Z yes A/V Geeks 16mm Films no 524 1964 Democratic ConventionAtlantic City Airport1960spolitical conventionarchive filmnews film https://avgeeks.videonest.co/videos/1835461/rrh-hf-341x6-ADVxzbe8zR https://img.videonest.org/gamma/1835461_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835461_video_v5_360.mp4 RRH HF 341x6 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 350 Howard Universitydentistrydental school16mm film1930s https://avgeeks.videonest.co/videos/1835462/rrh-hf-265x2-yd2kMBfc7r https://img.videonest.org/gamma/1835462_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835462_video_v5_360.mp4 RRH HF 265x2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 684 16mm filmAfrican Americanruraleducationschool busfarmingcommunityhistorical footagevintageblack and white https://avgeeks.videonest.co/videos/1835463/rrh-hf-214x5-NDhwGh4Fg5 https://img.videonest.org/gamma/1835463_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835463_video_v5_360.mp4 RRH HF 214x5 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 581 ChristmasNew York Cityvintage16mm filmhistoricalholidaySalvation Armyart gallerypaintings https://avgeeks.videonest.co/videos/1835464/phx-thefirsteasterrabbit-h-264-oFkv_2sGBI https://img.videonest.org/gamma/1835464_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835464_video_v5_360.mp4 PHX TheFirstEasterRabbit H 264 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 1493 Easter RabbitRankin BassEasteranimated filmholiday specialEaster bunnySanta ClausEaster eggsvintage animationchildren's filmGrandpa Bunnyanimated cartoonEaster holidayspring timeEaster parade https://avgeeks.videonest.co/videos/1835465/the-american-negro-unfinished-reel-4-1962-swPZq65sKR https://img.videonest.org/gamma/1835465_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835465_video_v5_360.mp4 The American Negro (unfinished, reel 4, 1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the significant progress made in education for African Americans, focusing on the events in Little Rock, Arkansas, in 1957 when Black students faced violence while trying to integrate an all-white school. President Eisenhower intervened by sending federal troops to protect the students' rights, highlighting the federal government's commitment to upholding civil rights. The narrative emphasizes the gradual progress of school integration, despite ongoing resistance, with a mention of James Meredith's enrollment at the University of Mississippi in 1962, which mirrored the Little Rock events. This unfinished civil rights-era film details how segregation affects the daily lives of African Americans, and includes portions of interviews with James Farmer, Roy Wilkins, Whitney Young, and Ralph Metcalfe. Farmer, Wilkins, and Young were considered to be among the “Big Four” leaders in the U.S. civil rights movement, along with Martin Luther King, Jr. The film also describes the strides and challenges faced by African Americans in the areas of voting, housing, and education. The film was written by Louis Lomax, produced by Willard Van Dyke, directed by Graeme Ferguson, and narrated by Charles Gordone. Keywords education, integration, civil rights, Little Rock, federal troops, violence, segregation, James Meredith, University of Mississippi, President Eisenhower 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 83 civil rightsLittle Rockschool integrationJames MeredithUniversity of MississippiEisenhowerfederal troopssegregation https://avgeeks.videonest.co/videos/1835466/rrh-hf-333x6-LH170Mij3A https://img.videonest.org/gamma/1835466_thumbnail_resized_v2.webp https://gamma.videonest.org/1835466_original_360.mp4 RRH HF 333x6 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 586 African Americanblack history16mm filmvintage footagemid centuryleisureworkeducationcommunitysocial life https://avgeeks.videonest.co/videos/1835467/rrh-hf-333x4-enOACOkfhj https://img.videonest.org/gamma/1835467_thumbnail_resized_v2.webp https://gamma.videonest.org/1835467_original_360.mp4 RRH HF 333x4 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 128 Red Oak School16mm filmvintage schooleducationafrican american historyhistorical footage https://avgeeks.videonest.co/videos/1835468/rr1980172-4-1-wQoNVNoGq8 https://img.videonest.org/gamma/1835468_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835468_video_v5_360.mp4 RR1980172 4 1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 381 Flash GordonBuster CrabbeMing the MercilessSci-Fi SerialSpace AdventurePlanet Mongovintage science fiction16mm film https://avgeeks.videonest.co/videos/1835469/rrh-hf-176-ftnODo1Tzm https://img.videonest.org/gamma/1835469_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835469_video_v5_360.mp4 RRH HF 176 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 640 Harmon FoundationNegro ArtistsArt Exhibition1933African American ArtSculpturePaintingHarlem Renaissance https://avgeeks.videonest.co/videos/1835470/rrfc-fc-187-2ifFjRyX9_ https://img.videonest.org/gamma/1835470_thumbnail_resized_v2.webp https://gamma.videonest.org/1835470_original_360.mp4 RRFC FC 187 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 368 Fordson TractorBoll WeevilCotton BeltAgriculture HistoryPest ControlVintage Film16mm FilmFord Motor Company https://avgeeks.videonest.co/videos/1835471/rrh-hf-333x5-QsqzJc9Yrg https://img.videonest.org/gamma/1835471_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835471_video_v5_360.mp4 RRH HF 333x5 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 505 16mm filmschoolclassroomvintagechildreneducationplayteacherstudents1950safrican american https://avgeeks.videonest.co/videos/1835472/rr306-lss-633-1QiP5cxnJs https://img.videonest.org/gamma/1835472_thumbnail_resized_v2.webp https://gamma.videonest.org/1835472_original_360.mp4 RR306 LSS 633 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 464 16mm filmcity lifevintagecrowdschildrenworkstreet scene https://avgeeks.videonest.co/videos/1835473/rr342-usaf-47441-vdRX2_FZoy https://img.videonest.org/gamma/1835473_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835473_video_v5_360.mp4 RR342 USAF 47441 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 727 NORADCheyenne MountainCold WarUSAFSpace Defense197216mm film https://avgeeks.videonest.co/videos/1835474/un-un-5-188-10-special-QskBY-LD5o https://img.videonest.org/gamma/1835474_thumbnail_resized_v2.webp https://gamma.videonest.org/1835474_original_360.mp4 UN UN 5 188 10 Special Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 245 16mm filmhand fartnovelty act1933new york citymayoral racepoliticsvintage filmhistorical footagefiorello laguardia https://avgeeks.videonest.co/videos/1835475/rr342-usaf-29292-DyWFgDHy6I https://img.videonest.org/gamma/1835475_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835475_video_v5_360.mp4 RR342 USAF 29292 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 748 aeronautical research laboratorywright air development divisionlow light detectionproject cateyeusafwaddimage orthiconspace explorationartificial satellitesmoon surface https://avgeeks.videonest.co/videos/1835476/rr428-npc-56042-HItJpALLxo https://img.videonest.org/gamma/1835476_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835476_video_v5_360.mp4 RR428 NPC 56042 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 373 ChinatownNew York City1970sstreet scenescity lifevintage16mm film https://avgeeks.videonest.co/videos/1835477/rr306-lss-636-Yr5ZfjsrpO https://img.videonest.org/gamma/1835477_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835477_video_v5_360.mp4 RR306 LSS 636 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 402 16mm filmvintagecity streetchildren playinghistorical footageurban life https://avgeeks.videonest.co/videos/1835478/rrh-hf-333x2-c07XZSDWOc https://img.videonest.org/gamma/1835478_thumbnail_resized_v2.webp https://gamma.videonest.org/1835478_original_360.mp4 RRH HF 333x2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 436 african americaneducationsportsfarmingcommunitymusic16mm filmblack history https://avgeeks.videonest.co/videos/1835479/rrh-hf-444x2-KtR3YDvDap https://img.videonest.org/gamma/1835479_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835479_video_v5_360.mp4 RRH HF 444x2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:36.000Z yes A/V Geeks 16mm Films no 339 Harlem day campNew York City16mm filmchildrenplaygroundsportsartscrafts https://avgeeks.videonest.co/videos/1835480/rrh-hf-333x12-uRCiavHoqx https://img.videonest.org/gamma/1835480_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835480_video_v5_360.mp4 RRH HF 333x12 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 484 black artistssculpturepainting16mm filmBooker T Washingtonschool on wheels https://avgeeks.videonest.co/videos/1835481/jerusalem-Hq01DYlNFJ https://img.videonest.org/gamma/1835481_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835481_video_v5_360.mp4 Jerusalem Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 1639 Jerusalemcrusadesholy landchristianislam16mm filmold filmhistoryancient historymiddle east https://avgeeks.videonest.co/videos/1835482/oatigerfangs-h-264-3odL3Uq5dA https://img.videonest.org/gamma/1835482_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835482_video_v5_360.mp4 OATigerFangs H 264 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 528 Frank BuckTiger FangsJungle Adventure16mmVintage FilmClassic FilmTigersAnimal Attack https://avgeeks.videonest.co/videos/1835483/rr428-npc-10321-cfvqSRDmyF https://img.videonest.org/gamma/1835483_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835483_video_v5_360.mp4 RR428 NPC 10321 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 329 John Philip SousaLibrary of Congress1953memorabiliamilitarySemper Fidelismarch kingsheet music https://avgeeks.videonest.co/videos/1835484/rrh-hf-333x1-ugt0qt-GJy https://img.videonest.org/gamma/1835484_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835484_video_v5_360.mp4 RRH HF 333x1 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 659 youth programscommunity programshistorical footage16mm filmarchival film https://avgeeks.videonest.co/videos/1835485/chemistry-solutions-ionic-and-molecular-2nd-1983-s-a6IvF-gcO- https://img.videonest.org/gamma/1835485_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835485_video_v5_360.mp4 Chemistry: Solutions (Ionic and Molecular) 2nd, 1983 (silent) Chemistry: Solutions (Ionic and Molecular) 2nd, 1983 (silent) Overview This educational segment explores the scientific study of ionic and molecular solutions, utilizing visual aids to effectively illustrate fundamental concepts. It begins by introducing the basic principles of chemical solutions, showcasing how different elements interact and combine to form solutions, as well as detailing the molecular structure of water. The differences between ionic and molecular structures are clearly highlighted, emphasizing their representation and concentration within solutions. Additionally, a laboratory experiment is featured, demonstrating the principles of solubility through the interaction of carbon tetrachloride (CCl₄) and oil. This experiment is presented with clear labeling to enhance understanding, providing viewers with a practical illustration of the behavior of solutions and the factors influencing solubility. Overall, the segment serves as a comprehensive exploration of the characteristics and behaviors of ionic and molecular solutions. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. #Ionic Solutions #Molecular Solutions #Chemical Reactions #Solubility Experiment #Visual Learning Timeline 00:00:00 - 00:04:00 Introduction to Ionic and Molecular Solutions 00:01:20 The video begins with a scientific exploration of solutions, focusing on ionic and molecular types, presented with visual aids but no audio. 00:04:00 - 00:08:00 Introduction to Chemical Solutions 00:07:06 The segment begins with a visual representation of chemical solutions, focusing on how hydrogen atoms and other elements combine to form various solutions. 00:07:15 An animation further illustrates the molecular structure of water, showing one oxygen atom bonded to two hydrogen atoms, emphasizing its role as a solvent in chemical processes. 00:08:00 - 00:12:00 Ionic and Molecular Structures 00:08:51 The scene visually represents ionic and molecular structures, demonstrating interactions between different sized particles in a solution. 00:10:40 The movement of tree branches and leaves against the sky could metaphorically represent the dissolution process or the dispersal of molecules in a solution. 00:11:34 The segment displays bottles of sulfuric acid and hydrochloric acid, comparing their dilute and concentrated forms to highlight differences in their ionic and molecular structures. 00:12:00 - 00:22:41 Carbon Tetrachloride Experiment 00:18:57 A beaker of clear carbon tetrachloride (CCl ₄) is displayed in a laboratory setting, likely for a chemistry demonstration. 00:20:50 An experiment shows oil interacting with carbon tetrachloride (CCl ₄) in a beaker, illustrating solubility and solution behavior with labeled cards for clarity. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 1362 ionic solutionsmolecular solutionschemical reactionssolubilitychemistry educationscience experimentcarbon tetrachloride https://avgeeks.videonest.co/videos/1835486/cbgermansoldiersonhorses--ExdQU0JJy https://img.videonest.org/gamma/1835486_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835486_video_v5_360.mp4 CBGermanSoldiersOnHorses Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 457 German soldiershorseback ridinghorse training16mm filmsilent filmequestrianmilitaryworld war https://avgeeks.videonest.co/videos/1835487/rrh-hf-179-L6UmNtUrx2 https://img.videonest.org/gamma/1835487_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835487_video_v5_360.mp4 RRH HF 179 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 611 Xavier UniversityCatholic collegeAmerican education16mm filmHistoricalNew OrleansAfrican AmericanHigher educationTrack and field https://avgeeks.videonest.co/videos/1835488/rr306-5160-MNcvhPr1FH https://img.videonest.org/gamma/1835488_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835488_video_v5_360.mp4 RR306 5160 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 1126 Little Rock NineCivil RightsDesegregationArkansas1957EducationHistoryAfrican American history https://avgeeks.videonest.co/videos/1835489/rr306-lss-255-OVc-6vdBB9 https://img.videonest.org/gamma/1835489_thumbnail_resized_v2.webp https://gamma.videonest.org/1835489_original_360.mp4 RR306 LSS 255 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 353 vocational trainingjob trainingindustryeducation16mm filmblack and whitehistorical footage https://avgeeks.videonest.co/videos/1835490/rrh-hf-333x14-JMo1eUuRof https://img.videonest.org/gamma/1835490_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835490_video_v5_360.mp4 RRH HF 333x14 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 511 W.E.B. Du BoisNAACPCivil Rights MovementAfrican AmericanBlack HistoryActivist16mm film https://avgeeks.videonest.co/videos/1835491/rrh-hf-333x18-ZyMZYTBwwV https://img.videonest.org/gamma/1835491_thumbnail_resized_v2.webp https://gamma.videonest.org/1835491_original_360.mp4 RRH HF 333x18 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:35.000Z yes A/V Geeks 16mm Films no 80 16mm filmschooleducationstudentsblack and whitevintageGeorge P. Phenix School https://avgeeks.videonest.co/videos/1835492/phxclothesandyoulineandproportionokc-a-Z_M14MLny0 https://img.videonest.org/gamma/1835492_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835492_video_v5_360.mp4 PHXClothesAndYouLineAndProportionOKC A Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 598 1950sfashionclotheslineproportioncoronet filmsclothing16mm film https://avgeeks.videonest.co/videos/1835493/a-june-bride-1935-rSOzP7uuPE https://img.videonest.org/gamma/1835493_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835493_video_v5_360.mp4 A June Bride (1935) The film features a whimsical cartoon wedding scene, highlighting the emotions of love and commitment. It includes a catchy song about a bride and groom at their wedding, with playful lyrics about the ceremony and the vows exchanged. The atmosphere is joyful, celebrating the union of the couple. Keywords cartoon, wedding, love, commitment, bride, groom, vows, ceremony, joyful, music 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 320 cartoonweddingvintageclassic animation16mm filmfunny animals https://avgeeks.videonest.co/videos/1835494/psareel9uhd-americancancersociety-victayback-9VXZ3Ijxsz https://img.videonest.org/gamma/1835494_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835494_video_v5_360.mp4 PSAReel9UHD AmericanCancerSociety VicTayback Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 13 American Cancer SocietyVic Taybackcancer awarenessPSA16mm filmvintage ad https://avgeeks.videonest.co/videos/1835495/the-industrial-revolution-1942-vSsont4QtH https://img.videonest.org/gamma/1835495_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835495_video_v5_360.mp4 The Industrial Revolution (1942) Title and ending are clipped. Discusses the evolution of tools and technology from primitive hand labor to the industrial revolution, highlighting significant advancements in machinery and production methods. It emphasizes the transition from manual labor to mechanization, particularly in England during the late 17th century, which laid the foundation for industrialization. Key inventions, such as the spinning jenny and steam engines, revolutionized textile production and other industries, leading to the establishment of factories and a shift in labor dynamics. The text also notes the impact of these changes on society, including increased production, improved living standards, and the rise of new industries in America. Ultimately, it suggests that while machines have transformed labor, the human element remains essential in directing and managing these advancements. Keywords: industrial revolution, tools, technology, hand labor, machinery, production, England, inventions, factories, textile industry, mechanization, living standards, America, steam engines, spinning jenny, labor dynamics, human element. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 602 industrial revolutiontoolstechnologyhand labormachineryproductionEnglandinventionsfactoriestextile industrymechanizationliving standardsAmericasteam engineslabor https://avgeeks.videonest.co/videos/1835496/phxsafedrivingthedefensivedriverokc-b-E_LPk4BDNj https://img.videonest.org/gamma/1835496_thumbnail_resized_v2.webp https://gamma.videonest.org/1835496_original_360.mp4 PHXSafeDrivingTheDefensiveDriverOKC B Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 642 safe drivingdefensive drivingoklahoma cityvintage cars16mm film https://avgeeks.videonest.co/videos/1835497/phxsafedrivingtehniquesofaskilleddriverokc-a-MHnErHsebp https://img.videonest.org/gamma/1835497_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835497_video_v5_360.mp4 PHXSafeDrivingTehniquesOfASkilledDriverOKC A Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:34.000Z yes A/V Geeks 16mm Films no 621 safe drivingdriving techniquescar maintenancedriver education1950svintage film https://avgeeks.videonest.co/videos/1835498/aidez-a-prevenir-l-incendie-french-RS7UuZPMgn https://img.videonest.org/gamma/1835498_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835498_video_v5_360.mp4 Aidez à prévenir l'incendie (French) 2026-04-28T16:36:33.000Z yes A/V Geeks 16mm Films no 658 fire preventionsafety filmvintage film16mm filmPSApublic service announcement https://avgeeks.videonest.co/videos/1835499/revolutions-production-k-silent-8HIxHxpeuw https://img.videonest.org/gamma/1835499_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835499_video_v5_360.mp4 Revolutions Production K (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The footage explores the principle of revolution in geometry, detailing how objects change position relative to a fixed observer. It covers the behavior of lines and triangles when revolved around axes, methods to measure angles between planes, and applications of these principles in solving spatial problems. 2026-04-28T16:36:33.000Z yes A/V Geeks 16mm Films no 888 revolutiongeometryspatial problemsaxisplaneslinestrianglesangles https://avgeeks.videonest.co/videos/1835500/zp2601938-2-1-reorganzied-church-of-the-latter-day-UN5flfw5Pr https://img.videonest.org/gamma/1835500_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835500_video_v5_360.mp4 ZP2601938 2 1 Reorganzied Church of the Latter Day Saints Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:33.000Z yes A/V Geeks 16mm Films no 1034 Reorganized ChurchLatter-day SaintsMormon HistoryReligious History16mm film https://avgeeks.videonest.co/videos/1835501/polynesianfilmtitlecut-1JutNuqnAp https://img.videonest.org/gamma/1835501_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835501_video_v5_360.mp4 PolynesianFilmTitleCut Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:32.000Z yes A/V Geeks 16mm Films no 856 polynesianfishingboat buildingfarmingculturetraditional life16mm film https://avgeeks.videonest.co/videos/1835502/worldwar1-armynavyfootage-qQQugTaEeG https://img.videonest.org/gamma/1835502_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835502_video_v5_360.mp4 WorldWar1 ArmyNavyFootage Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:32.000Z yes A/V Geeks 16mm Films no 659 World War OneWWIArmyNavyMilitaryhistorical footageSignal CorpsUnited States ArmyUnited States NavyWorld War 1 https://avgeeks.videonest.co/videos/1835503/zp2602209-5-1-freeze-in--o-7LvDFzS https://img.videonest.org/gamma/1835503_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835503_video_v5_360.mp4 ZP2602209 5 1 Freeze In Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:32.000Z yes A/V Geeks 16mm Films no 1007 SearsFreezer16mmTraining filmVintageAdvertisingTime BankColdspotFreezing https://avgeeks.videonest.co/videos/1835504/ldspriesthoodrestoration-AyMxnkIRJr https://img.videonest.org/gamma/1835504_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835504_video_v5_360.mp4 LDSPriesthoodRestoration Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:32.000Z yes A/V Geeks 16mm Films no 1218 priesthood restorationJoseph SmithBook of MormonLatter-day SaintApostlesBaptismChurch History https://avgeeks.videonest.co/videos/1835505/chile-street-fighting-5Zb6GOWOgO https://img.videonest.org/gamma/1835505_thumbnail_resized_v2.webp https://gamma.videonest.org/1835505_original_360.mp4 Chile Street Fighting Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:32.000Z yes A/V Geeks 16mm Films no 121 ChileStreet FightingUnrestProtest16mm FilmHistorical FootageDemonstration https://avgeeks.videonest.co/videos/1835506/cb-dukeellingtonjamsession-flip-my-titles-ymKTjpAMLk https://img.videonest.org/gamma/1835506_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835506_video_v5_360.mp4 CB DukeEllingtonJamSession FLIP MY TITLES Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T16:36:31.000Z yes A/V Geeks 16mm Films no 177 Duke EllingtonJazzHarlem CatsJam Session16mm filmRay NanceRex StewartBen WebsterSonny GreerJoe NantonBarney Bigard https://avgeeks.videonest.co/videos/1835507/306-1714-revolution-betrayed-Ln3rkw85qC https://img.videonest.org/gamma/1835507_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835507_video_v5_360.mp4 306 1714 Revolution Betrayed Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:31.000Z yes A/V Geeks 16mm Films no 1517 CubaFidel CastroCommunismCold WarRevolution https://avgeeks.videonest.co/videos/1835508/home-movie-goose-story-RS3_7YmyRH https://img.videonest.org/gamma/1835508_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835508_video_v5_360.mp4 home movie: Goose Story Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:31.000Z yes A/V Geeks 16mm Films no 1510 goosegeesebirdnestinghuntingwildlifewaterfowlanimalbird watchingmigration https://avgeeks.videonest.co/videos/1835509/oaairtoairpart2-Cb7Yhho8-j https://img.videonest.org/gamma/1835509_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835509_video_v5_360.mp4 OAAirtoAirPart2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-28T16:36:31.000Z yes A/V Geeks 16mm Films no 560 biplanevintage aircraft16mm filmaerial footageaviation historytakeoffflight https://avgeeks.videonest.co/videos/1835510/and-we-are-back-8UambT7eh7 https://img.videonest.org/gamma/1835510_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835510_video_v5_360.mp4 And we are back.. Just a quick announcement to say that Google/Youtube gave me access to my channel and I hope to stream live at 1pm EDT today! 2026-04-28T16:19:15.000Z yes A/V Geeks 16mm Films no 49 16mm filmfilm restorationchannel updateyoutube access https://avgeeks.videonest.co/videos/1835511/the-smile-of-the-walrus-1978-5EEvZEdm49 https://img.videonest.org/gamma/1835511_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835511_video_v5_360.mp4 The Smile Of The Walrus (1978) This documentary follows the migration of Pacific walruses through the Bering Sea toward the Arctic, highlighting their vital role in the subsistence and culture of the Eskimo people of St. Lawrence Island. As Philippe Cousteau and the Calypso team observe the walrus migration, they document the precarious balance between traditional indigenous hunting practices and the species' conservation. The film features a poignant subplot involving the rescue and rehabilitation of an orphaned walrus calf named "Burke," whose care provides scientists with unique insights into the behavior and survival needs of these animals. Ultimately, the narrative reflects on the delicate future of the walrus, emphasizing that while their population is slowly recovering, their survival remains tethered to both the preservation of their icy habitat and responsible management of the human impact on their environment. Keywords: Walrus, Pacific, Migration, Arctic, Alaska, Bering Sea, Conservation, Indigenous Culture, Wildlife Documentary, Marine Biology, Calypso, Subsistence Hunting, Rehabilitation, Ecology. 2026-04-28T16:00:00.000Z yes A/V Geeks 16mm Films no 1332 WalrusPacificMigrationArcticAlaskaBering SeaEskimoIndigenous CultureWildlifeConservationCalypsoPhilippe Cousteau https://avgeeks.videonest.co/videos/1835512/invisible-handicap-dyslexia-ikogB5Zs0m https://img.videonest.org/gamma/1835512_thumbnail_resized_v2.webp https://gamma.videonest.org/1835512_original_360.mp4 Invisible Handicap - Dyslexia 2026-04-28T12:50:43.000Z yes A/V Geeks 16mm Films no 920 dyslexialearning disabilityspecial educationreadingeducation https://avgeeks.videonest.co/videos/1835513/ape-and-child-reel-one-duplicate-11fTIHYz8M https://img.videonest.org/gamma/1835513_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835513_video_v5_360.mp4 Ape And Child Reel One Duplicate Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:50:40.000Z yes A/V Geeks 16mm Films no 1070 apechildbaby16mm filmvintagechimpanzeefriendshiporphan work https://avgeeks.videonest.co/videos/1835514/pathenewssegments-NZN7chm30C https://img.videonest.org/gamma/1835514_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835514_video_v5_360.mp4 PatheNewsSegments Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:50:40.000Z yes A/V Geeks 16mm Films no 542 winter sportsvintage footageskiingice skatingbobsledcurlinghorse racingsnow https://avgeeks.videonest.co/videos/1835515/yankeesnewsegments-2_ycoqgs1M https://img.videonest.org/gamma/1835515_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835515_video_v5_360.mp4 YankeesNewSegments Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:50:13.000Z yes A/V Geeks 16mm Films no 770 Granny Hamner1950 World SeriesPhiladelphia PhilliesNew York Yankeesbaseball historyclassic baseballYankee StadiumLew Fonseca16mm film https://avgeeks.videonest.co/videos/1835516/consuelo-CWNFeP49b8 https://img.videonest.org/gamma/1835516_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835516_video_v5_360.mp4 Consuelo Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:50:13.000Z yes A/V Geeks 16mm Films no 1213 bilingual education16mm filmvintage filmfamilyschoollearningspanish languagecultural heritageold filmchildreneducation https://avgeeks.videonest.co/videos/1835517/as-brooklyn-3-6LvfNI_i8B https://img.videonest.org/gamma/1835517_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835517_video_v5_360.mp4 AS Brooklyn 3 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:47:56.000Z yes A/V Geeks 16mm Films no 777 16mm filmbrooklynvintagefamilychildren https://avgeeks.videonest.co/videos/1835518/as-brooklyn-2-tyWuO8He7E https://img.videonest.org/gamma/1835518_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835518_video_v5_360.mp4 AS Brooklyn 2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:47:56.000Z yes A/V Geeks 16mm Films no 890 brooklynworld's fairsummer campnew yorkvintage16mm filmfamilychildren https://avgeeks.videonest.co/videos/1835519/compilation-cow-cartoon-town-and-posing-footage-pt--qadsjsG4O https://img.videonest.org/gamma/1835519_thumbnail_resized_v2.webp https://gamma.videonest.org/1835519_original_360.mp4 Compilation Cow Cartoon Town And Posing Footage Pt 2 Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:47:17.000Z yes A/V Geeks 16mm Films no 164 16mm filmvintage footagearchival filmposingboychildhuman interest https://avgeeks.videonest.co/videos/1835520/the-crusades-1969-6U2T_84aL7 https://img.videonest.org/gamma/1835520_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835520_video_v5_360.mp4 The Crusades (1969) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This historical overview chronicles the era of the Crusades, a transformative two-century period ignited by the rise of Islam and the subsequent Western reaction to the capture of Jerusalem by Turkish forces. Spurred by Pope Urban II’s call to "free the Holy Land," waves of Europeans—ranging from pious peasants to ambitious noblemen—embarked on a series of grueling military campaigns fueled by religious fervor, the promise of salvation, and the desire for glory. Despite initial successes, the expeditions were marked by extreme brutality, devastating internal strife, catastrophic losses to disease and famine, and shifting power dynamics involving legendary figures like Saladin and King Louis IX. Ultimately, the Crusades evolved from religious crusades into broader power struggles, leading to the sacking of Constantinople and culminating in the eventual collapse of European control in the East, leaving a legacy of social and economic revolution that reshaped the medieval world. Keywords: Crusades, Jerusalem, Saladin, Medieval History, Holy Land, Religion, Feudalism, Pope Urban II, King Louis IX, Pilgrimage, Conflict, Faith, Middle Ages 2026-04-28T12:47:17.000Z yes A/V Geeks 16mm Films no 937 CrusadesMedieval HistoryHoly LandPope Urban IISaladinKing Louis IXJerusalemMiddle AgesReligionIslam https://avgeeks.videonest.co/videos/1835521/microphone-speaking-1969-sBIDaI6eSg https://img.videonest.org/gamma/1835521_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835521_video_v5_360.mp4 Microphone Speaking (1969) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film provides a comprehensive guide on proper microphone technique for public speakers, illustrating how to effectively use sound reinforcement systems to communicate with an audience. By showcasing various common mistakes—such as the "lusty larynx" approach, "microphone mastication," "strangulation," and "treadmill oratory"—the film highlights how poor positioning leads to feedback and muffled audio. It advocates for an "audience-oriented" approach, where the speaker maintains a natural posture, adjusts the microphone to a comfortable height, speaks in a conversational tone, and ensures clear delivery while utilizing visual aids appropriately. Ultimately, the film emphasizes that the microphone is a tool meant to enhance communication, not a challenge to be wrestled with, and suggests that simplicity and practice are the keys to effective public speaking and broadcasting. Keywords: microphone, public speaking, communication, feedback, public address system, presentation, orator, audio, broadcasting, technique 2026-04-28T12:47:17.000Z yes A/V Geeks 16mm Films no 850 microphone techniquepublic address systempresentation skillsspeaking tipsaudio feedback https://avgeeks.videonest.co/videos/1835522/drinking-driver-what-could-you-do-1977-nk2kicDCjn https://img.videonest.org/gamma/1835522_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835522_video_v5_360.mp4 Drinking Driver: What Could You Do? (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the dangerous intersection of social pressure, alcohol consumption, and irresponsible decision-making, using a series of reenactments to illustrate how easily preventable accidents can turn tragic. By highlighting common myths—such as the belief that exercise or coffee can sober a person up—and examining the psychological reluctance individuals feel toward intervening in a friend's risky behavior, the narrative emphasizes the "paradox of safety": the idea that preventing a catastrophe often goes unnoticed because the event never occurs. Through various scenarios, the film challenges the audience to consider the personal responsibility required to speak up and intervene before a situation escalates into a fatal accident. Keywords: drunk driving, traffic safety, alcohol education, accident prevention, social pressure, public service announcement, personal responsibility, sober driving, road safety, risk assessment 2026-04-28T12:47:17.000Z yes A/V Geeks 16mm Films no 777 drunk drivingalcohol educationtraffic safetypublic service announcementaccident preventionpersonal responsibility16mm film https://avgeeks.videonest.co/videos/1835523/modern-engines-and-energy-conservation-1978-qPD18sPIQ5 https://img.videonest.org/gamma/1835523_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835523_video_v5_360.mp4 Modern Engines And Energy Conservation (1978) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the fundamental principles of energy conversion by examining various types of engines and their mechanisms for performing work. It traces the evolution of technology from standard piston engines, which convert chemical energy into mechanical motion through combustion, to more efficient turbine and jet engines that utilize rotary motion and thrust. The narrative further addresses the limitations of air-breathing engines in space, leading to the development of self-contained rocket engines. Finally, the film looks toward the future of propulsion and power generation, highlighting emerging technologies like nuclear, ion, and solar engines that aim to harness energy more efficiently without relying on traditional combustion. Keywords: Engines, Energy Conversion, Piston Engines, Turbine Engines, Jet Propulsion, Rocketry, Mechanical Energy, Potential Energy, Thrust, Combustion, Nuclear Power, Solar Energy, Ion Propulsion. 2026-04-28T12:47:15.000Z yes A/V Geeks 16mm Films no 736 enginesenergy conversionpiston enginesjet propulsionrocket enginesnuclear energysolar energymechanical energypotential energythrustturbine engines https://avgeeks.videonest.co/videos/1835524/leo-beuerman-1969-AkGrDY6_vx https://img.videonest.org/gamma/1835524_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835524_video_v5_360.mp4 Leo Beuerman (1969) This documentary profile follows the life of Leo Berman, a man born with a physically restrictive, warped body that he views as his own lifelong prison. Despite being confined by his anatomy, Leo refuses to succumb to self-pity, finding purpose and independence through his hobbies—such as repairing clocks and writing—and his work as a street merchant. By modifying his own tractor and maneuvering a cart through town to sell small goods, Leo sustains himself and rejects charity, embodying an indomitable spirit. Ultimately, the film illustrates how Leo transforms his profound adversity into a source of dignity, proving that even within the most limiting circumstances, the human heart can find freedom through persistence, self-reliance, and compassion for others. Keywords: disability, independence, resilience, human spirit, merchant, adversity, autobiography, determination, self-reliance, documentary 2026-04-28T12:47:15.000Z yes A/V Geeks 16mm Films no 782 disabilityindependenceresiliencehuman spiritself-reliance16mm film https://avgeeks.videonest.co/videos/1835525/discovering-electronic-music-1970-sw5cOHmaIa https://img.videonest.org/gamma/1835525_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835525_video_v5_360.mp4 Discovering Electronic Music (1970) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary explores the evolution of music in the technological age, focusing on how electronic synthesizers and computers have revolutionized sound creation. The narrator explains that electronic music offers composers unprecedented creative freedom, allowing them to produce complex rhythms, unique pitches, and innovative sound qualities that traditional instruments cannot replicate. By manipulating fundamental elements such as waveforms, envelopes, and filters, musicians can synthesize entirely new textures or imitate natural and traditional sounds. Ultimately, the film highlights how electronic equipment and computer-assisted composition serve as powerful tools, acting as a bridge between the precision of technology and the artistic vision of the composer. Keywords: electronic music, synthesizers, oscillators, computer music, wave forms, sound engineering, music technology, composition, filters, notation 2026-04-28T12:47:13.000Z yes A/V Geeks 16mm Films no 1401 electronic musicsynthesizermusic technologysound synthesis1970s https://avgeeks.videonest.co/videos/1835526/playground-safety-as-simple-as-abc-6eJTwrFdhi https://img.videonest.org/gamma/1835526_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835526_video_v5_360.mp4 Playground Safety As Simple As ABC Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:47:12.000Z yes A/V Geeks 16mm Films no 914 NavajoNative AmericanSouthwestCultureHistoryTraditionsReservationLong WalkDinetahNavajo Nation https://avgeeks.videonest.co/videos/1835527/black-history-lost-stolen-or-strayed-pz1NvTp4Pc https://img.videonest.org/gamma/1835527_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835527_video_v5_360.mp4 Black History Lost Stolen Or Strayed Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. AV GEEKS respects the rights of copyright holders and is committed to complying with applicable copyright laws. Some of the materials available on this website may be classified as orphan works, which means that the copyright owner is unknown or has not been identified despite a reasonable search. Let us know if you are a rights holder, we don't mean to infringe on your rights. 2026-04-28T12:47:12.000Z yes A/V Geeks 16mm Films no 1512 Black historystereotypesidentityracismvintage filmAfrican Americandiscrimination https://avgeeks.videonest.co/videos/1835528/nutrition-food-for-thought-1981-IaaBwDThpf https://img.videonest.org/gamma/1835528_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835528_video_v5_360.mp4 Nutrition: Food For Thought (1981) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film uses a humorous narrative featuring the eccentric Dr. Hans von Strudel to debunk the idea that a single "nutrition pill" can replace the necessity of eating real food. The narrator explains that beyond just providing fuel, eating is a social activity that offers sensory pleasure and psychological satisfaction. The film proceeds to break down the science of nutrition, identifying the five essential categories—carbohydrates, fats, proteins, minerals, and vitamins—and detailing their specific roles in maintaining health, growth, and energy levels. It concludes by advocating for a balanced diet based on the four basic food groups and emphasizes the importance of consistent meal habits, such as eating a healthy breakfast and choosing nutritious snacks. Keywords: nutrition, balanced diet, carbohydrates, fats, proteins, minerals, vitamins, food groups, health, digestion, wellness, healthy eating, metabolism, nutrients 2026-04-28T12:46:52.000Z yes A/V Geeks 16mm Films no 934 nutritionbalanced dietfood groupsvitaminsmineralshealthy eatingnutrientsDr. Von Strudel https://avgeeks.videonest.co/videos/1835529/nepalese-tea-worker-of-the-himalayas-1971-X3xkXvHS72 https://img.videonest.org/gamma/1835529_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835529_video_v5_360.mp4 Nepalese Tea Worker Of The Himalayas (1971) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary follows the daily life of 15-year-old Casor and his family, who work as laborers on a tea estate in the Indian Himalayas. Through their arduous routine—which includes picking tea leaves on steep slopes, performing essential estate tasks, and walking miles to school—the film highlights the family's deep commitment to education as a means of escaping poverty. Despite the financial challenges of mountain living, the family maintains a strong cultural and religious identity, balancing their Buddhist traditions and household responsibilities with a collective, unwavering ambition to help Casor achieve his dream of becoming an engineer. Keywords: Himalayas, tea estate, education, family life, Nepal, labor, Buddhism, poverty, ambition, mountain living, tradition, tea production 2026-04-28T12:46:18.000Z yes A/V Geeks 16mm Films no 810 Himalayastea workerNepalfamily lifeBuddhismeducationtea estate https://avgeeks.videonest.co/videos/1835530/portrait-of-a-vandal-1978-Wt5CXA5_uR https://img.videonest.org/gamma/1835530_thumbnail_resized_v2.webp https://gamma.videonest.org/1835530_original_360.mp4 Portrait Of A Vandal (1978) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This educational film serves as a cautionary tale about the consequences of vandalism, following a group of boys who commit senseless acts of destruction against a peer’s home. Through a series of vignettes, the narrative illustrates how peer pressure and the desire to "fit in" can turn ordinary, well-meaning teenagers into vandals who inflict pain on others. As the boys struggle with guilt, secrecy, and eventual discovery by the police, the film emphasizes the devastating ripple effects their actions have on their families and their own futures. Ultimately, it serves as a moral lesson, urging young viewers to resist the temptation of destructive group behavior and to take responsibility for their choices before they lead to irreparable damage. Keywords: Vandalism, peer pressure, accountability, juvenile delinquency, morality, consequences, education, responsibility, choices, guilt 2026-04-28T12:46:01.000Z yes A/V Geeks 16mm Films no 733 vandalismpeer pressurejuvenile delinquencyaccountability1970seducation https://avgeeks.videonest.co/videos/1835531/one-misstep-career-over-this-workplace-safety-film-h_-CJN3FsV https://img.videonest.org/gamma/1835531_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835531_video_v5_360.mp4 One Misstep. Career Over. This Workplace Safety Film Doesn't Pull Any Punches Car accidents are the #1 killer. You know that. You're careful on the road. But the #2 cause of workplace injury and death? Falling. Something so ordinary, so mundane, so embarrassingly simple — that most people never see it coming until they're already on the ground. This vintage workplace safety film holds absolutely nothing back. Slick floors. Cluttered walkways. Overreaching. Unstable platforms. That one ladder everyone's been meaning to replace. It's all here — along with the brutal truth about what a single fall can cost you: chronic pain, lost wages, and in the worst cases, your life. This isn't scare tactics. This is just math. Watch it. Send it to someone who skips safety briefings. Send it to your boss. Send it to the guy who always takes shortcuts on the ladder. 🪜 Because the floor is a lot further down than you think. 📽️ Scanned from the original film and preserved for history. Like and subscribe to support our archival work. 2026-04-28T12:26:08.000Z yes A/V Geeks 16mm Films no 533 workplace safetyfall preventionsafety filmvintage filmindustrial safetyladder safetyslips trips falls https://avgeeks.videonest.co/videos/1835532/elementary-natural-science-owls-1976-QXzwQspNWS https://img.videonest.org/gamma/1835532_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835532_video_v5_360.mp4 Elementary Natural Science: Owls (1976) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Owls are highly specialized nocturnal predators found in diverse environments across the globe, uniquely adapted for silent flight and exceptional night hunting. Equipped with sensitive vision, keen hearing, and specialized talons, these birds play a vital role in maintaining ecological balance by controlling rodent and small wildlife populations. While they vary significantly in size and behavior—ranging from the aggressive, continent-wide great horned owl to the small, burrowing, or day-active varieties—they all share complex nesting habits and the biological necessity of regurgitating indigestible prey remains as pellets. Despite their success as hunters, owl populations remain vulnerable to human impact, including habitat loss, pesticide use, and illegal hunting, underscoring the importance of protecting these vital nocturnal avian predators. Keywords: Owls, nocturnal, predators, raptors, hunting, wildlife, ecosystem, ornithology, conservation, habitat. 2026-04-28T12:26:08.000Z yes A/V Geeks 16mm Films no 931 OwlsRaptorsBirds of PreyOrnithologyWildlife https://avgeeks.videonest.co/videos/1835533/young-perch-1981-77uBUvQmK- https://img.videonest.org/gamma/1835533_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835533_video_v5_360.mp4 Young Perch (1981) This documentary explores the life cycle of the perch, tracing its development from the spawning process to maturity. After a female deposits her eggs in the branches of a lake, she guards them from predators until they hatch into fry, which initially rely on a yolk sac for sustenance before transitioning to a diet of plankton. The film highlights the high mortality rate of young fish due to various predators and environmental factors, emphasizing their need to consume significant amounts of food to grow quickly. As they mature, the perch develop their characteristic stripes and fins, learning to navigate the dangers of the lake—including larger predatory fish like pike—until they reach adulthood after several years. Keywords: perch, fish, life cycle, spawning, nature, aquatic ecosystem, survival, predator, fry, development 2026-04-28T12:26:05.000Z yes A/V Geeks 16mm Films no 832 perchfishlife cycleaquatic ecosystempredator https://avgeeks.videonest.co/videos/1835534/what-ecologists-do-1971-gP-pC0jfYH https://img.videonest.org/gamma/1835534_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835534_video_v5_360.mp4 What Ecologists Do (1971) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary explores the field of ecology by examining the decline of the bald eagle population, which serves as a cautionary tale regarding the dangers of environmental pollution and bioaccumulation. Through the example of poisoned insects causing reproductive failure in eagles, the film illustrates how chemicals travel through the food chain, highlighting the interconnectedness of all living organisms and their environment. It details the complex methods ecologists use to study these delicate ecosystems, including sampling, trapping, tagging, and monitoring environmental conditions. Ultimately, the film emphasizes that because human activity significantly alters the natural world, the work of ecologists is essential to understanding these relationships, correcting environmental mistakes, and ensuring the long-term survival of all species, including humans. Keywords: ecology, environment, bald eagle, bioaccumulation, food chain, pollution, conservation, scientific research, sampling, biodiversity, ecosystem, nature, habitats 2026-04-28T12:26:05.000Z yes A/V Geeks 16mm Films no 869 ecologybald eaglebioaccumulationfood chainpollutionconservationecosystemecological researchsamplinghabitats https://avgeeks.videonest.co/videos/1835535/small-predatory-animals-1973-IPbUyHEIc4 https://img.videonest.org/gamma/1835535_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835535_video_v5_360.mp4 Small Predatory Animals (1973) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the biological characteristics and behavioral patterns of various predatory mammals, including weasels, mink, raccoons, and gray foxes. It highlights how these animals utilize specialized physical traits—such as sharp canine teeth for hunting and highly developed senses—to capture prey and maintain their place in the food chain. While some species like weasels and mink are strict carnivores, others like raccoons and gray foxes are omnivorous, demonstrating a diverse range of dietary habits. Ultimately, the documentary emphasizes the vital role these predators play in maintaining ecological balance and advocates for their protection and respect within the natural world. Keywords: Predators, Carnivores, Omnivores, Wildlife, Ecosystem, Mammals, Weasels, Mink, Raccoons, Gray Foxes, Ecology, Food Chain, Nature, Biology. 2026-04-28T12:26:05.000Z yes A/V Geeks 16mm Films no 749 PredatorsCarnivoresOmnivoresWeaselsMinkRaccoonsFoxesEcosystemFood ChainBiologyWildlife https://avgeeks.videonest.co/videos/1835855/principles-of-development-1950-GJCrYtWvyM https://img.videonest.org/gamma/1835855_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1835855_video_v5_360.mp4 Principles Of Development (1950) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film provides a comprehensive overview of the fundamental principles of child development, emphasizing that growth is a continuous, orderly, and predictable process that proceeds from general to specific responses. It explains how physical, mental, and motor developments are intrinsically linked, often occurring in stages defined by "laws of developmental direction" that move from the head downward to the extremities. The documentary highlights that while every child follows a universal pattern, individual differences arise due to factors like heredity, environment, health, and personality. Ultimately, the film posits that development is driven by the interaction between maturation—the biological unfolding of innate traits—and learning through practice, encouraging parents to recognize and respect the "right time" for a child to master new skills to foster their fullest potential. Keywords: Child development, Maturation, Learning, Growth patterns, Developmental psychology, Individual differences, Motor skills, Stages of growth, Parenting, Heredity, Environment, Cognitive development 2026-04-29T16:00:00.000Z yes A/V Geeks 16mm Films no 960 child developmentgrowth patternsdevelopmental psychologymaturationlearningmotor skillsheredityenvironmentparenting https://avgeeks.videonest.co/videos/1837110/kindness-to-others-silent-raw-footage-1950s-Q63xVKlnw0 https://img.videonest.org/gamma/1837110_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837110_video_v5_360.mp4 Kindness To Others (silent, raw footage, 1950s) This 1950s film offers a warm and structured glimpse into mid-century childhood, school life, and home routines. It follows a young boy’s experience with illness, from being cared for by his mother and a visiting doctor to his recovery and return to daily activities. Meanwhile, classroom scenes showcase children learning through art and teacher-led discussions, emphasizing traditional education methods. The schoolyard is alive with energetic play, including tetherball, merry-go-round rides, and slides. Everyday moments—like a mailman rescuing a cat, family meals, and a mother serving breakfast—capture the simplicity and structure of 1950s family life, where children were guided by nurturing parents, teachers, and community figures. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T14:00:01.000Z yes A/V Geeks 16mm Films no 1489 1950schildhoodschool lifefamily lifehome routinesillnessdoctor visitclassroom scenestraditional educationschoolyard playtetherballmerry-go-roundmailmanrescuing catfamily meals https://avgeeks.videonest.co/videos/1837111/diet-raw-footage-silent-1959-64Moskw4Yo https://img.videonest.org/gamma/1837111_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837111_video_v5_360.mp4 Diet (raw footage, silent, 1959) This footage from the 1950s captures a staged classroom and cafeteria setting, likely from an educational or instructional film. The sequences predominantly feature teenage boys and girls engaging in typical school activities such as reading, speaking, and interacting in class. Shooting slates appear frequently, marking different takes. In the cafeteria, students carry trays, eat meals, and some are seen sneaking snacks like candy bars. There are also moments of social interaction, with students looking through books together, talking, laughing, and gathering their belongings. The scenes, though routine, provide a glimpse into the structured and disciplined school environment of the 1950s, reflecting both academic and social aspects of teenage life during the era. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T14:00:01.000Z yes A/V Geeks 16mm Films no 1441 1950sdietraw footageschoolinstructional filmteenagersMusilA/V Geeks https://avgeeks.videonest.co/videos/1837112/animals-are-different-and-alike-silent-raw-footage-likw937ayI https://img.videonest.org/gamma/1837112_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837112_video_v5_360.mp4 Animals Are Different And Alike (silent, raw footage, 1960s) This 1960s film captures a nostalgic and gentle exploration of childhood curiosity and connection with animals on a farm. Two young boys interact with a variety of creatures, from pet birds, dogs, and cats to farm animals like cows, chickens, and horses. They observe goldfish in a bowl, play with toy animal figurines, and examine insects like grasshoppers and worms. The film showcases moments of companionship between the boys and their pets, as well as the simple joys of outdoor life, highlighting an era when children engaged closely with nature and animals in their everyday adventures. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:14.000Z yes A/V Geeks 16mm Films no 688 1960sfarm animalspetsvintage filmchildhooddogscatsbirdscowschickenshorsesinsects https://avgeeks.videonest.co/videos/1837113/autoprobe-silent-3qgXSi4J_T https://img.videonest.org/gamma/1837113_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837113_video_v5_360.mp4 Autoprobe (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 319 CobiltAutoprobesemiconductorwafermicrochipelectronics16mm filmvintage technology https://avgeeks.videonest.co/videos/1837114/it-doesn-t-hurt-silent-raw-footage-1950s-vceFRugjU1 https://img.videonest.org/gamma/1837114_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837114_video_v5_360.mp4 It Doesn't Hurt (silent, raw footage, 1950s) This 1950s educational film focuses on personal hygiene, particularly dental care, through the daily routines of children. A young girl is shown brushing her teeth, washing her face, and caring for her doll’s hygiene, while interactions with another girl highlight playful yet instructive moments about proper brushing habits. Scenes at a dining table emphasize table manners, including how to cut pancakes properly. The film also includes a visit to the dentist’s office, reinforcing the importance of dental health. A mix of live-action sequences and close-up images of teeth with cavities suggests an instructional approach, possibly aimed at teaching children about maintaining good oral hygiene. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 676 1950shygienedental caretable mannerseducational filmvintage16mm filmoral hygienechildrendentist https://avgeeks.videonest.co/videos/1837115/falling-waters-of-yosemite-silent-MnDMnSx2-o https://img.videonest.org/gamma/1837115_thumbnail_resized_v2.webp https://gamma.videonest.org/1837115_original_360.mp4 Falling Waters Of Yosemite (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 925 Yosemitewaterfallsnational parkcalifornia16mm filmvintage footagecascade fallribbon fallbridalveil fallyosemite fallsindian creek fallsierra point https://avgeeks.videonest.co/videos/1837116/cantigny-silent-vkwQQyDnRw https://img.videonest.org/gamma/1837116_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837116_video_v5_360.mp4 Cantigny (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 470 CantignyWorld War IWWI16mm filmUS ArmyAmerican Expeditionary ForcesFranceFrench TanksEmpire Safety Film Co.1918Western FrontTrench Warfare https://avgeeks.videonest.co/videos/1837117/line-and-plane-relationships-pt1-1961-T0Subrr9kd https://img.videonest.org/gamma/1837117_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837117_video_v5_360.mp4 Line And Plane Relationships Pt1 (1961) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A~15-minute silent educational film produced by Rensselaer Polytechnic Institute (RPI) on the topic of descriptive geometry — specifically the spatial relationships between lines and planes. It opens with a title card reading "Rensselaer Polytechnic Institute Presents" against a dark teal background, then transitions into an introduction using a close-up of a real physical model: a dark metallic sculptural object with angular edges meeting at precise angles, resembling a prototype used to demonstrate geometric concepts tangibly. The bulk of the film alternates between two modes of presentation. The first is 2D animated diagrams — glowing blue lines drawn at various angles within a framed rectangular field against a dark background — used to illustrate concepts like parallel lines, intersecting lines, and lines at various angles relative to a reference plane. The second, more prominent mode is elegant 3D-rendered or physically constructed models featuring translucent blue planes (flat rectangular surfaces representing geometric planes) combined with glowing white or metallic rods representing lines in space. These 3D setups are shown from multiple viewpoints and demonstrate key concepts such as a line lying within a plane, a line perpendicular to a plane, a line intersecting a plane at a point, and lines that are parallel to or oblique to a given plane. Throughout the video, labeled diagrams appear — often with numbered points (1, 2, 3, 4, 5) and notations like "TL" (true length) — and the film frequently uses split-screen or multi-panel compositions to show the same geometric configuration from several different orthographic views simultaneously (labeled "View 5," etc.), as is standard in engineering drawing and descriptive geometry instruction. The demonstrations build progressively in complexity, moving from a single flat plane floating in space to multi-plane configurations with multiple lines passing through, across, or parallel to them. The video ends with a final series of 3D model shots showing lines rising from a horizontal plane at various angles before fading out. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 919 descriptive geometryline and planespatial relationshipsengineering drawing16mm filmRPIRensselaer Polytechnic Institute https://avgeeks.videonest.co/videos/1837118/story-of-shoes-a-silent-ca-1941-T6PeU-77Cb https://img.videonest.org/gamma/1837118_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837118_video_v5_360.mp4 Story of Shoes, A (silent, ca. 1941) A Story of Shoes (1941) provides a detailed, step-by-step look at the craftsmanship and manufacturing process behind stylish 1940s footwear. Through rich visuals of leatherwork and industrial machinery, the film captures the meticulous techniques used in shoemaking, from cutting and shaping to stitching and finishing. The footage showcases the era’s elaborate production methods, including the use of heavy-duty machines that, while effective, posed safety risks to workers. The film’s silent format, supplemented by title cards, enhances its documentary style, offering a glimpse into the footwear industry of the time. The final products resemble classic designs, reminiscent of vintage bowling shoes, reflecting both the fashion and function of 1940s footwear. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 1453 shoe making1940sleather workcraftsmanshipvintage footwearindustrial machineryshoe factory https://avgeeks.videonest.co/videos/1837119/falling-water-1960s-VB-XBtL07h https://img.videonest.org/gamma/1837119_thumbnail_resized_v2.webp https://gamma.videonest.org/1837119_original_360.mp4 Falling Water (1960s) "Falling Water," designed by architect Frank Lloyd Wright, is a house built over a waterfall in the Eastern United States. Completed over 35 years ago, it exemplifies a harmonious design that integrates natural elements, minimizing environmental impact. The structure features bold concrete and steel elements that blend seamlessly with the surrounding landscape, showcasing stunning views and creating a unique aesthetic. Its owner, Edgar J. Kaufmann Jr., donated the property to the public, ensuring its preservation as a monument to architecture and nature for future generations. Keywords Falling Water, Frank Lloyd Wright, architecture, nature, environmental preservation, design, Eastern United States, Edgar J. Kaufmann Jr., masterpiece, ecological significance Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 241 Falling WaterFrank Lloyd WrightarchitecturenatureEastern United States1960shouse https://avgeeks.videonest.co/videos/1837120/batting-fundamentals-silent-raw-footage-1940s-QsS6ygQx4w https://img.videonest.org/gamma/1837120_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837120_video_v5_360.mp4 Batting Fundamentals (silent, raw footage, 1940s) This 1940s instructional baseball film focuses on batting techniques, featuring extensive slow-motion footage and diagrams illustrating proper form. It meticulously examines players’ stances, swings, and bunting positions, using arrows and outlines to highlight key movements. The film includes high-angle shots of games, close-ups of hands gripping the bat, and repeated sequences of swings for analysis. Intertitles provide guidance, and experimental upside-down and reverse shots add variety. The film concludes with game footage showing players hitting, running bases, and scoring, reinforcing the technical lessons demonstrated throughout. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 3308 batting fundamentalsbaseball skillsbaseballbattingbaseball swingbaseball techniquebaseball instructionsbaseball trainingswingbatting stancebaseball gripbat selectionbuntingvintage baseballbaseball bat https://avgeeks.videonest.co/videos/1837121/eastern-europe-an-introduction-raw-silent-_zZnOEMS-_ https://img.videonest.org/gamma/1837121_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837121_video_v5_360.mp4 Eastern Europe An Introduction (raw, silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:13.000Z yes A/V Geeks 16mm Films no 790 Eastern Europe16mm filmvintage footageold filmhistoricalarchivescitieslandscapesEastern Blocpeople https://avgeeks.videonest.co/videos/1837122/middle-atlantic-states-silent-raw-footage-1950s-P3SMRAua8S https://img.videonest.org/gamma/1837122_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837122_video_v5_360.mp4 Middle Atlantic States (silent, raw footage, 1950s) Raw footage from an educational travelogue, offering a visual journey through the Mid-Atlantic region of the United States. Capturing the era’s industrial, agricultural, and urban landscapes, the footage highlights coal mines, refineries, bustling city streets, and rural farmlands. Scenes include workers loading cargo, factory assembly lines, college campuses, and iconic metropolitan skylines, providing insight into daily life, economic activities, and transportation systems of the time. With an emphasis on Americana and mid-century industry, this series presents a nostalgic yet informative look at the region’s geographic and cultural significance. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:11.000Z yes A/V Geeks 16mm Films no 1176 Mid-Atlantic1950sindustrycoal miningmanufacturingcitiesfarmstransportationskylinesAmericanaraw footagevintage film16mm film https://avgeeks.videonest.co/videos/1837123/immigration-silent-1921-jrG-TsapJL https://img.videonest.org/gamma/1837123_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837123_video_v5_360.mp4 Immigration (silent, 1921) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This silent black-and-white film documents the challenging journey of a European farming family, the Bernards, as they struggle with rural life and eventually receive financial aid to immigrate to America. The film portrays their departure by ship, hopeful visions of the 'Land of Freedom,' and the realities of immigrant life upon arrival in New York Harbor. It includes scenes of processing at Ellis Island, urban life in early 20th-century New York City, and the social challenges immigrants face. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 901 silent filmimmigrationellis islandnew york city1920seuropean immigrantsamerican dreamfamily16mm filmimmigrant life https://avgeeks.videonest.co/videos/1837124/william-shakespeare-1955-sdrmUnNhD_ https://img.videonest.org/gamma/1837124_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837124_video_v5_360.mp4 William Shakespeare (1955) The film explores the life of William Shakespeare, starting from his birth in April 1564 in Stratford-upon-Avon. It details his early years, education, marriage to Anne Hathaway, and the birth of his children. The narrative highlights his rise as a playwright and actor in London, showcasing his contributions to the Elizabethan stage, including the creation of iconic works like "Hamlet" and "Macbeth." The film also touches on personal tragedies, such as the death of his son Hamnet, and concludes with Shakespeare's retirement to Stratford, his legacy, and the eventual burning of the Globe Theatre. Keywords William Shakespeare, Stratford-upon-Avon, Elizabethan stage, playwright, actor, Anne Hathaway, Hamnet, Globe Theatre, personal tragedy, legacy Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 1447 William ShakespeareStratford-upon-AvonElizabethan eraGlobe TheatreEnglish LiteraturePlaywrightActorAnne HathawayHamnet ShakespeareShakespearean plays https://avgeeks.videonest.co/videos/1837125/god-s-christmas-gift-1958-DoFx5hB15P https://img.videonest.org/gamma/1837125_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837125_video_v5_360.mp4 God's Christmas Gift (1958) The film revolves around a Christmas-themed conversation between family members, emphasizing the importance of love as the greatest gift during the holiday season. A teacher, Mrs. Howard, hints at a special gift related to the birth of Jesus that doesn’t cost money and can bring joy to others. The children engage in activities like creating a nativity scene and donating toys, ultimately realizing that the gift of love is what truly embodies the spirit of Christmas. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 821 christmas giftgift of lovenativity scenechristmas cookiesfamily film1950svintage christmasreligious film https://avgeeks.videonest.co/videos/1837126/by-the-sea-1971-E4ewC_COeN https://img.videonest.org/gamma/1837126_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837126_video_v5_360.mp4 By The Sea (1971) "By the Sea," directed by Joern Gerdts in 1971, is a visually immersive film that artfully captures the essence and diverse atmospheres of the seashore. Lasting 14 minutes, this color film offers a contemplative journey through a series of serene and dynamic coastal scenes. It masterfully juxtaposes the lively motion of the ocean and the vibrant activities of people on the beach with the tranquil life of marine animals and the natural beauty of the shoreline. The film is noted for its purely visual exploration of the seashore, enhanced by the soothing sounds of the sea and restful music, making it an ideal backdrop for contemplation or creative projects. The use of superimpositions, slow dissolves, and stills superimposed over live action is skillfully handled, enriching the visual experience and emphasizing the film's poetic quality. Recommended by the Landers Review for its ability to motivate and inspire, "By the Sea" serves as a comprehensive study of marine and shore life, appealing to viewers of all ages and making it a valuable educational tool for teaching about nature. The film covers a variety of subjects, including marine animals and the general study of nature, showcasing the richness and variety of life both above and beneath the sea's surface. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 827 seashoremarine lifecoastal scenes16mm filmoceanbeachnatureseadiving https://avgeeks.videonest.co/videos/1837127/ecology-basic-concepts-silent-raw-footage-1970s-OXLTknui6h https://img.videonest.org/gamma/1837127_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837127_video_v5_360.mp4 Ecology: Basic Concepts (silent, raw footage,1970s) This 1970s nature film captures the delicate interactions of wildlife in a pond ecosystem. It features a frog as a central subject, resting on tree trunks and lily pads, swimming, and hunting insects. The film also showcases various creatures, including a snake, a turtle, fish, slugs, and a salamander, highlighting predator-prey relationships as a snake attacks a frog and a frog eats a bug. Scenes of blooming flowers, water lilies, and grasses frame the natural setting, while close-ups of animals crawling along the ground provide an intimate look at small-scale life. The film offers a serene yet dynamic portrait of pond life, emphasizing the interconnectedness of its inhabitants. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 1434 frogsnaketurtlepond lifeecosystem1970snature filmwildlifesalamanderslugsfishwater liliespredator prey https://avgeeks.videonest.co/videos/1837129/pontiac-advertising-cW1wGxWZGO https://img.videonest.org/gamma/1837129_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837129_video_v5_360.mp4 Pontiac Advertising Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 420 Pontiac1955 Pontiaccar advertisingvintage carclassic car ad https://avgeeks.videonest.co/videos/1837130/space-probes-exploring-our-solar-system-1964-GwvS9f_FqE https://img.videonest.org/gamma/1837130_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837130_video_v5_360.mp4 Space Probes Exploring Our Solar System (1964) The film details the history and technology behind space probes, starting with the unsuccessful launch of Pioneer 1 in 1958. It highlights various missions, including the Russian Lunic series and American Pioneer probes, that explored the moon and other celestial bodies. The advancements in rocket technology allowed for more sophisticated probes, capable of conducting detailed studies of the moon and planets like Venus and Mars. The film also discusses the significance of telemetry in transmitting data back to Earth and the dangers posed by the Earth's magnetosphere and solar radiation. Keywords space probes, Pioneer 1, Lunic series, telemetry, interplanetary travel, Venus, Mars, magnetosphere, solar radiation, moon exploration 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 638 space probesPioneer 1Lunic seriestelemetrysolar systemVenusMarsmoon explorationrocket technology https://avgeeks.videonest.co/videos/1837131/handwriting-silent-raw-footage-1960s-nnfBkriijH https://img.videonest.org/gamma/1837131_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837131_video_v5_360.mp4 Handwriting (silent, raw footage, 1960s) This 1960s educational film captures a structured classroom setting where a woman, likely a teacher, instructs students using a book. The film includes close-ups of students writing at their desks and extreme close-ups of hands forming letters and numbers, sometimes in reverse, possibly highlighting a study on handwriting techniques. The repeated use of a clapboard suggests a formal production process. The film also features a historical reenactment with men in period costumes engaging in writing tasks, drawing a connection between past and present writing practices. Through a mix of classroom instruction, detailed shots of writing, and historical references, the film appears to explore the evolution and techniques of writing education. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 1489 handwritingeducation1960sclassroomvintage film16mm filmwritinghistorical reenactmentpenmanshipteacher https://avgeeks.videonest.co/videos/1837132/gion-festival-silent-tRDBludJuR https://img.videonest.org/gamma/1837132_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837132_video_v5_360.mp4 Gion Festival (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:57:10.000Z yes A/V Geeks 16mm Films no 324 Gion FestivalKyotoJapanJapanese CultureVintage Film16mm FilmFestival FloatsTraditionParade https://avgeeks.videonest.co/videos/1837133/work-and-energy-silent-1928-SPIUZHR3uD https://img.videonest.org/gamma/1837133_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837133_video_v5_360.mp4 Work And Energy (silent, 1928) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:55:38.000Z yes A/V Geeks 16mm Films no 891 work and energygeneral science1928 filmsilent filmcoal formationsteam engineturbine enginepower plantenergy transformation16mm filmav geeks https://avgeeks.videonest.co/videos/1837134/blue-monday-silent-Ivpox7UUUF https://img.videonest.org/gamma/1837134_thumbnail_resized_v2.webp https://gamma.videonest.org/1837134_original_360.mp4 Blue Monday (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:55:38.000Z yes A/V Geeks 16mm Films no 640 vintage advertisingsoap commerciallaundryhousehold chores16mm film https://avgeeks.videonest.co/videos/1837135/bombs-rock-italy-silent-1940s-S9__mT9NDn https://img.videonest.org/gamma/1837135_thumbnail_resized_v2.webp https://gamma.videonest.org/1837135_original_360.mp4 Bombs Rock Italy! (silent, 1940s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film depicts the devastation of bombings in Italy, showcasing aerial views of destruction and ground-level scenes of chaos. It also highlights the strategic movements of Allied forces in Sicily, featuring soldiers in combat and the stark contrast of urban life amid wartime turmoil, emphasizing th... #ItalyWartime #Bombings #AlliedForces #WorldWarII #UrbanChaos Timeline 00:00:27 - 00:03:25 Bombing in Italy 00:00:27 An aerial view shows explosions lighting up an Italian cityscape, illustrating the immediate impact of a bombing event. 00:01:32 A ground-level scene in Italy depicts a wide street with buses and pedestrians, offering a glimpse of urban life amidst the historical context. 00:02:12 An aerial view reveals the widespread destruction and smoke in an Italian city, highlighting the aftermath of the explosions. 00:03:25 - 00:05:57 Allied Troops Advance in Sicily 00:03:25 A title card announces the movement of Allied troops across Sicily during a historical military operation, focusing on World War II events. 00:03:43 Lieutenant General Patton is shown going ashore to lead a military campaign as part of the wartime operation in Italy. 00:04:01 Soldiers in military attire are depicted on a tank, equipped with gear and weapons, indicating readiness for action in a wartime setting. 00:05:57 - 00:09:49 Wartime Italy 00:05:57 A soldier takes cover on a chaotic battlefield, surrounded by explosions, dust, and debris, illustrating the harsh conditions of military conflict. 00:07:44 Military personnel are shown in a tense interaction, their uniforms and expressions conveying the urgency and seriousness of a wartime setting in Italy. 00:08:28 A soldier stands alert with a rifle in an urban setting, ready for action, with the background architecture suggesting a wartime environment in Italy. 00:09:24 A bustling Italian street shows military personnel and civilians interacting, with soldiers carrying equipment and vehicles lining the street, reflecting a tense atmosphere amid ordinary urban life. 2026-04-30T13:55:38.000Z yes A/V Geeks 16mm Films no 590 ItalySicilyWorld War IIbombingAllied forcesGeneral Patton https://avgeeks.videonest.co/videos/1837136/phx-safetyinwinter-broll-qu2xplNpHW https://img.videonest.org/gamma/1837136_thumbnail_resized_v2.webp https://gamma.videonest.org/1837136_original_360.mp4 PHX SafetyInWinter BRoll Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-04-30T13:55:31.000Z yes A/V Geeks 16mm Films no 366 sleddingice skatingsnowball fightwintervintage film16mmsnowwinter sportschildren https://avgeeks.videonest.co/videos/1837137/the-american-negro-unfinished-reel-5-1962-JdQnGCx_FS https://img.videonest.org/gamma/1837137_thumbnail_resized_v2.webp https://gamma.videonest.org/1837137_original_360.mp4 The American Negro (unfinished, reel 5, 1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Discusses the experiences of students in an integrated high school in Indiana, highlighting the absence of racial conflict and the positive interactions among students of different races. It emphasizes the importance of open discussions about race relations in education, the pride in African heritage among Black Americans, and the belief in the possibility of improving race relations in the U.S. The speaker reflects on the historical struggles for equality and the ongoing pursuit of civil rights, ultimately expressing hope for unity and progress. This unfinished civil rights-era film details how segregation affects the daily lives of African Americans, and includes portions of interviews with James Farmer, Roy Wilkins, Whitney Young, and Ralph Metcalfe. Farmer, Wilkins, and Young were considered to be among the “Big Four” leaders in the U.S. civil rights movement, along with Martin Luther King, Jr. The film also describes the strides and challenges faced by African Americans in the areas of voting, housing, and education. The film was written by Louis Lomax, produced by Willard Van Dyke, directed by Graeme Ferguson, and narrated by Charles Gordone. Keywords integration, race relations, education, heritage, equality, American ideal, civil rights, racial harmony, community, pride 2026-04-30T13:07:11.000Z yes A/V Geeks 16mm Films no 427 integrationrace relationscivil rightsequality1960s https://avgeeks.videonest.co/videos/1837138/pueblo-incident-speech-at-the-united-nations-paris-loXX906E9E https://img.videonest.org/gamma/1837138_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1837138_video_v5_360.mp4 Pueblo Incident Speech at the United Nations / Paris Peace Talks Footage (silent, 1968) Pueblo Incident Speech at the United Nations / Paris Peace Talks Footage This unedited film shows U.S. Ambassador Arthur Goldberg speaking to the United Nations Security Council on January 26th, 1968 about the Pueblo incident; and various shots of US delegate W. Averell Harriman at the Paris Peace Talks. Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This unedited film captures significant moments from January 26, 1968, as U.S. Ambassador Arthur Goldberg addresses the United Nations Security Council regarding the Pueblo incident. His speech highlights the diplomatic tensions and concerns surrounding the event. Additionally, the footage includes various shots of U.S. delegate W. Averell Harriman participating in the Paris Peace Talks, emphasizing the key diplomatic efforts undertaken during this pivotal year in U.S. foreign relations. The film serves as a historical record of the political climate and negotiations occurring during this time. #Pueblo Incident #UN Security Council #Paris Peace Talks #Diplomatic History #Arthur Goldberg Timeline 00:00:00 - 00:04:00 Diplomatic Engagements of 1968: Pueblo Incident and Paris Peace Talks 00:00:24 U.S. Ambassador Arthur Goldberg addresses the United Nations Security Council regarding the Pueblo incident, followed by scenes of U.S. delegate W. Averell Harriman at the Paris Peace Talks. 00:01:18 The footage captures U.S. Ambassador Arthur Goldberg speaking to the UN Security Council about the Pueblo incident while U.S. delegate W. Averell Harriman participates in the Paris Peace Talks. 00:02:00 An individual operates a film camera, documenting the significant diplomatic events of 1968, including the UN Security Council speech and the Paris Peace Talks. 00:04:00 - 00:07:09 Pueblo Incident and Paris Peace Talks 00:04:03 U.S. Ambassador Arthur Goldberg addresses the United Nations Security Council about the Pueblo incident while U.S. delegate W. Averell Harriman attends the Paris Peace Talks. 00:04:56 A busy and tense scene outside a venue suggests preparations for international diplomatic engagements, possibly related to the Paris Peace Talks or the Pueblo incident. 00:05:27 U.S. Ambassador Arthur Goldberg speaks to the UN Security Council regarding the Pueblo incident, and U.S. delegate W. Averell Harriman is seen during the Paris Peace Talks in a street scene, possibly in Paris. 00:05:44 A crowd gathers outside a building, likely during the 1968 Paris Peace Talks, indicating public interest in the diplomatic activities inside. 2026-04-30T13:07:08.000Z yes A/V Geeks 16mm Films no 429 Pueblo IncidentUN Security CouncilParis Peace TalksArthur GoldbergW. Averell Harriman1968Diplomatic HistoryCold War History https://avgeeks.videonest.co/videos/1837139/pathegram-news-digest-silent-hh1CQdVFM3 https://img.videonest.org/gamma/1837139_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1837139/pathegram-news-digest-silent-hh1CQdVFM3 Pathegram News Digest (silent) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. #SevereFlood #TownHistory #IndustrialInnovation #SailingRegatta #EverydayLife Timeline 00:00:05 This segment may feature a collection of news clips or stories from various events—possibly historic or significant—as part of a news digest. 00:00:21 A town is submerged by floodwaters, with streets and buildings partially underwater, showing a severe flooding event that has affected local infrastructure and daily life. 00:00:25 A town is engulfed by floodwaters, with streets barely visible and water reaching the tops of street signs and lampposts, illustrating the extreme severity of the flood. 00:00:28 People stand in front of a shop labeled "Pasar California," surrounded by rising floodwaters, capturing the impact of the flood in a commercial area. 00:00:47 This scene presents a historical black-and-white image of a busy city street with vintage cars passing by and a large fallen tree, suggesting a possible natural event. 00:01:18 A group of workers is shown assembling an aircraft, focusing on the nose section, in a large-scale industrial environment. 00:02:20 Someone operates a small boat equipped with an outboard motor across a frozen, snowy landscape, suggesting early innovation in winter transportation. 00:02:43 Several sailboats are shown gliding through the water with their sails full, indicating a regatta or sailing event. 00:03:06 A sailboat navigates open waters with a large spinnaker, showcasing the power of wind propulsion and active crew management. 2026-04-30T12:56:02.000Z yes A/V Geeks 16mm Films no 286 vintage newsreelsilent filmfloodaircraft assemblysailing regattahistorical footageindustrial innovationwinter transportation https://avgeeks.videonest.co/videos/1841721/av-geeks-16mm-lunch-4-30-2026-nWTiF1QH9D https://img.videonest.org/gamma/1841721_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1841721_video_v5_360.mp4 AV Geeks 16mm Lunch 4-30-2026 Buh bye April! #avgeeks #16mmfilms 2026-04-30T16:49:37.000Z yes A/V Geeks 16mm Films no 4561 16mm filmvintage filmeducational filmdairy productschemical changewomen's healthhygienefilm projectormilkchemistrynutritionexercisebeauty tipsmilitary womenA/V Geeks https://avgeeks.videonest.co/videos/1841722/gates-of-heaven-1978-SraOkhbnq7 https://img.videonest.org/gamma/1841722_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1841722_video_v5_360.mp4 Gates Of Heaven (1978) This film explores the architectural and spiritual significance of Gothic cathedrals, framing them as a profound human attempt to mirror divine order and symbolize the structure of the universe. During the 12th-century "springtime of civilization," European society channeled its collective faith and energy into constructing these monumental edifices, using geometry, intricate iconography, and light to bridge the gap between the earthly and the eternal. Beyond their role as sites of worship, cathedrals served as the holistic centers of medieval life—functioning as schools, civic hubs, and encyclopedias of human knowledge—until the shifting tides of history and the rise of new worldviews transformed them from living centers of meaning into enduring, yet silent, monuments of a bygone era. Ultimately, the documentary suggests that while the Gothic dream was transient, the cathedrals remain powerful testaments to the timeless human longing to find purpose, unity, and communion with the creator. Keywords: Gothic architecture, cathedrals, Middle Ages, faith, divine order, Chartres, Canterbury, symbolism, spirituality, Christian history, sacred geometry, iconography, human destiny 2026-04-30T16:00:00.000Z yes A/V Geeks 16mm Films no 1118 gothic architecturecathedralsmiddle agesdivine orderspiritualChartresCanterbury https://avgeeks.videonest.co/videos/1844809/makeup-for-theater-1950-E4i6wjlglG https://img.videonest.org/gamma/1844809_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1844809_video_v5_360.mp4 Makeup For Theater (1950) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film demonstrates theatrical makeup application techniques for both women and men, emphasizing the importance of checking makeup under stage lighting. For women, it details applying a grease paint base, blending rouge, accentuating eyes with shadow and liner, defining eyebrows, and shaping lips with rouge, followed by powdering to set the makeup. For men, it shows a similar process using a stick foundation, darker shades for rouge and eyeshadow, and a softened lip application, all to achieve the desired character portrayal. Keywords: theatrical makeup, stage makeup, grease paint, foundation, rouge, eyeshadow, eyeliner, eyebrows, lips, powder, character portrayal, women's makeup, men's makeup 2026-05-03T16:00:00.000Z yes A/V Geeks 16mm Films no 786 theatrical makeupstage makeup1950s makeupvintage beautymen's makeupwomen's makeupgrease painteyeshadowrougeeyeliner https://avgeeks.videonest.co/videos/1844811/av-geeks-16mm-lunch-5-1-2026-oXgB9chgQY https://img.videonest.org/gamma/1844811_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1844811_video_v5_360.mp4 AV Geeks 16mm Lunch 5-1-2026 Welcome May! We support you! Workers are what made our country great! #avgeeks #16mmfilms 2026-05-03T15:35:10.000Z yes A/V Geeks 16mm Films no 3828 16mm filmvintage filmdigestive systemhuman bodyAustralian wildlifeKangaroosItalyItalian historyindustrial progresstourismfilm projectornutrientsenzymesNorthern ItalySouthern Italy https://avgeeks.videonest.co/videos/1850740/av-geeks-16mm-lunch-5-4-2026-Ltpq8Gib97 https://img.videonest.org/gamma/1850740_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1850740_video_v5_360.mp4 AV Geeks 16mm Lunch 5-4-2026 Mondays are better in May and when there's 16mm films to watch! #avgeeks #16mmfilms Silent Compilation Reel Children of the Fields Animals of Asia Community Helpers: Police Officers 2026-05-05T06:24:08.000Z yes A/V Geeks 16mm Films no 4127 16mm filmsilent filmeducational filmvintage filmchild laborfarm workersanimals of asiasoutheast asiapolice officerpolice trainingcommunity helpersAsian wildliferural lifefamilyArizona https://avgeeks.videonest.co/videos/1850749/a-v-geeks-16mm-lunch-4-28-2026-VjGfNo_cUI https://img.videonest.org/gamma/1850749_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1850749_video_v5_360.mp4 A/V Geeks 16mm Lunch 4/28/2026 I made a mistake and now I'm back showing you 16mm films on our channel! #avgeeks #16mmfilms Oops I Made A Mistake! Mister, You Made A Big Mistake! Thief To Forgive A Thief 2026-05-04T18:59:08.000Z yes A/V Geeks 16mm Films no 4128 16mm filmav geeksvintage filmforgivenesstheftcrimeChristian filmrehabilitationhospitalmedical billingmaking mistakeseducational filmblack and white filmshort filmpatient care https://avgeeks.videonest.co/videos/1850760/project-nekton-1960-Fb0Mp3gZLl https://img.videonest.org/gamma/1850760_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1850760_video_v5_360.mp4 Project Nekton (1960) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. On January 23, 1960, the bathyscaphe Trieste made history by reaching the deepest known point of the Earth's oceans, the Challenger Deep in the Mariana Trench. The dive, which lasted approximately 8.5 hours, saw scientists and Navy personnel descend to a record-breaking depth of 37,800 feet. This groundbreaking achievement allowed for unprecedented study of the deep-sea environment, including temperature, currents, and biological samples. The mission also aimed to test new equipment and techniques for deep-sea exploration, with the potential for military applications and insights into dumping radioactive waste. Despite the extreme conditions and the discovery of life at such depths, including a fish and a sole, the dive was largely uneventful, though the occupants experienced cold temperatures and the unusual sight of a fine silt cloud upon landing. Keywords: deep-sea exploration, Mariana Trench, Challenger Deep, bathyscaphe, Trieste, world record, oceanography, scientific research, Navy, submersible, deep dive 2026-05-04T16:00:00.000Z yes A/V Geeks 16mm Films no 1052 deep-sea explorationMariana TrenchChallenger DeepbathyscapheTriesteworld recordoceanographyscientific researchNavysubmersibledeep diveJacques PiccardDon WalshProject Nekton https://avgeeks.videonest.co/videos/1862768/av-geeks-16mm-lunch-5-6-2026-S4uEcpCegy https://img.videonest.org/gamma/1862768_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1862768_video_v5_360.mp4 AV Geeks 16mm Lunch 5 6 2026 Driving while showing you 16mm films? How is that possible? #avgeeks #16mmfilms 2026-05-06T17:00:06.000Z yes A/V Geeks 16mm Films no 3448 A/V Geeks16mm LunchPrelinger Archivesanimated filmsMonsantoemployee benefitsoil industryfarmingcivil defenseCold Waremergency preparednessoilpetroleumanimationretro animation https://avgeeks.videonest.co/videos/1862769/discovering-ideas-for-art-1965-ktFZ5FMXnB https://img.videonest.org/gamma/1862769_thumbnail_resized_v2.webp https://gamma.videonest.org/1862769_original_360.mp4 Discovering Ideas For Art (1965) This film explores the process of discovering artistic inspiration by teaching viewers how to look closely at the world around them. It emphasizes observing the variations of objects, examining their individual parts like shape, color, line, texture, pattern, and light and dark areas, and then creatively interpreting and transforming these observations through simplification, alteration, and invention. The core message is that careful observation, combined with imaginative use of what is seen, is the key to generating exciting and original artwork. Keywords: art, inspiration, observation, looking, variety, parts, shape, color, line, texture, pattern, light, dark, simplification, alteration, invention, creativity, world, objects, drawing, painting, cutout, design. 2026-05-06T16:00:00.000Z yes A/V Geeks 16mm Films no 905 art inspirationart education16mm filmobservational skillsart techniquescreative process https://avgeeks.videonest.co/videos/1862770/unlocking-music-s-future-synths-computers-and-endl-Qgxk_exKN3 https://img.videonest.org/gamma/1862770_thumbnail_resized_v2.webp https://gamma.videonest.org/1862770_original_360.mp4 Unlocking Music's Future: Synths, Computers, and Endless Creative Sound! #shorts Explore the limitless horizons of electronic music. Synthesizers and computers are transforming sound, unlocking unprecedented creative potential for artists worldwide. #ElectronicMusic #MusicProduction #Synthesizers #DigitalAudio 2026-05-06T02:22:25.000Z yes A/V Geeks 16mm Films no 51 Electronic MusicMusic ProductionSynthesizersDigital AudioComputer MusicCreative Sound https://avgeeks.videonest.co/videos/1862771/technology-s-grip-how-it-s-reshaping-music-creatio-W_BkW-B2R7 https://img.videonest.org/gamma/1862771_thumbnail_resized_v2.webp https://gamma.videonest.org/1862771_original_360.mp4 Technology's Grip: How It's Reshaping Music Creation FOREVER! #shorts Explore how technology is transforming the way we create and consume music. From AI-generated melodies to immersive listening platforms, the soundscape is evolving. #TechInMusic #MusicProduction #DigitalAudio #FutureOfMusic 2026-05-06T02:19:29.000Z yes A/V Geeks 16mm Films no 23 technologymusic creationAI musicdigital audiofuture of musicmusic productionsoundscapeimmersive audio https://avgeeks.videonest.co/videos/1862772/a-v-geeks-16mm-lunch-5-5-2026-E2pzq3pYG5 https://img.videonest.org/gamma/1862772_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1862772_video_v5_360.mp4 A/V Geeks 16mm Lunch 5-5-2026 This is a backup show in case I can't get back to the archive in time. #avgeeks #16mmfilms 2026-05-05T17:00:06.000Z yes A/V Geeks 16mm Films no 4198 16mm filmAV GeeksSkylabmagnetismmagnetic fieldNASAspace explorationOwen Garriottscience educationoscillationsmagnetsdemonstrationphysicsEarth's magnetic fieldelectromagnetism https://avgeeks.videonest.co/videos/1867165/av-geeks-16mm-lunch-5-7-2026-oGZ-Vq_IWJ https://img.videonest.org/gamma/1867165_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1867165_video_v5_360.mp4 AV Geeks 16mm Lunch 5-7-2026 Feeling good about showing you some 16mm films today! Are you up for it? #16mmfilms #avgeeks 2026-05-07T16:59:51.000Z yes A/V Geeks 16mm Films no 3931 16mm filmAV GeeksOregon TrailSkylabSwitzerlandwagon trainpioneer lifewestward expansionspace experimentsmagnetic fieldwater skiingvintage footageNASAfilm projectorAmerican history https://avgeeks.videonest.co/videos/1867166/annual-festival-of-the-dead-1967-VYugWaFKtZ https://img.videonest.org/gamma/1867166_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1867166_video_v5_360.mp4 Annual Festival Of The Dead (1967) Shows scenes of the African Festival of the Dead by the Dogon Tribe of the Mali Highlands in former French Africa. Documents mock battles between soldiers and villagers and records the dance movements used by the warriors to enact the accomplishments of their departed comrades. Observes the slaughtering of a goat and the sacrificial meal. Contains no narration. 2026-05-07T16:00:00.000Z yes A/V Geeks 16mm Films no 789 Dogon TribeMaliAfricaFestival of the Dead1967African CultureSacrificeRitualWarrior DanceMock Battle https://avgeeks.videonest.co/videos/1867910/av-geeks-16mm-lunch-5-7-2026-nZzYWxL4xb https://img.videonest.org/gamma/1867910_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1867910_video_v5_360.mp4 AV Geeks 16mm Lunch 5-7-2026 Feeling good about showing you some 16mm films today! Are you up for it? #16mmfilms #avgeeks 2026-05-08T17:16:13.000Z yes A/V Geeks 16mm Films no 4250 https://avgeeks.videonest.co/videos/1867911/av-geeks-16mm-lunch-5-8-2026-OygBYIBnsZ https://img.videonest.org/gamma/1867911_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1867911_video_v5_360.mp4 AV Geeks 16mm Lunch 5 8 2026 Watching retro TV commercials on a Friday! #16mmfilms #avgeeks 2026-05-08T17:00:26.000Z yes A/V Geeks 16mm Films no 3671 https://avgeeks.videonest.co/videos/1867912/lake-of-perch-1981-L9BOb9A6UA https://img.videonest.org/gamma/1867912_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1867912_video_v5_360.mp4 Lake Of Perch (1981) Animated. This film documents the cyclical life within a lake through the changing seasons. It begins in autumn, highlighting the abundant oxygen produced by water plants which supports the fish, emphasizing the need for them to eat heartily before winter. As temperatures drop, the plants decay, plankton diminishes, and fish, being cold-blooded, slow down or hibernate, like frogs and carp, to survive the colder months. During winter, under the ice, life becomes scarce and the fish struggle to find food, with the old and weak perishing. Spring's arrival brings warmer temperatures and renewed activity, as hibernating creatures awaken and plant life flourishes. By summer, the lake is teeming with life, with dense aquatic vegetation providing shelter and sustenance for various fish species. Keywords: lake, winter, autumn, spring, summer, fish, plants, plankton, oxygen, hibernation, cold-blooded, temperature, ice, food, life cycle, seasons 2026-05-08T16:00:00.000Z yes A/V Geeks 16mm Films no 708 lakefishperchlife cycleseasons16mm https://avgeeks.videonest.co/videos/1887657/pageant-in-steel-1959-4HkY1YS2np https://img.videonest.org/gamma/1887657_thumbnail_resized_v2.webp https://gamma.videonest.org/1887657_original_360.mp4 Pageant In Steel (1959) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film showcases the transformative impact of sheet steel in modern life, contrasting it with older, heavier iron materials. Through a demonstration at a "pageant of steel," viewers see how sheet steel, enabled by innovations like the continuous mill, has revolutionized everyday objects. From lighter, more efficient gardening tools and outdoor furniture to components for cars and appliances, the exposition highlights how advancements in steel production, like those at Bethlehem Steel, have made steel versatile and integral to contemporary living, changing life in just two generations. Keywords: Sheet steel, iron, continuous mill, exposition, steel production, Bethlehem Steel, modern life, innovation, manufacturing, everyday objects 2026-05-11T04:00:00.000Z yes A/V Geeks 16mm Films no 603 sheet steelsteel productionBethlehem Steelsteel millcontinuous millironindustry1950smanufacturing https://avgeeks.videonest.co/videos/1887658/african-art-and-sculpture-1971-3VtFgdkAgs https://img.videonest.org/gamma/1887658_thumbnail_resized_v2.webp https://gamma.videonest.org/1887658_original_360.mp4 African Art and Sculpture (1971) This film explores the rich history and culture of ancient Africa through its art. It emphasizes that art served as the primary form of communication and historical record-keeping in the absence of a written language. The documentary showcases various artistic expressions, including wood carvings, ivory sculptures, metalwork, and ceremonial masks, explaining their significance and the meanings behind their forms. Through interviews with Brother Alatunji, the film delves into the symbolism embedded in African art, revealing how it represented life, death, spirituality, and societal values, offering insights into the advanced aesthetic sensibilities and unique worldview of ancient African peoples. Keywords: African art, ancient history, sculpture, painting, traditions, symbolism, heritage, wood carving, ivory carving, metalwork, lost wax method, animals, fertility, tools, utensils, masks, ceremonial dances, ancestors, spirituality, cultural expression 2026-05-10T16:00:00.000Z yes A/V Geeks 16mm Films no 1267 african artancient historysculpturecultural heritagesymbolism https://avgeeks.videonest.co/videos/1887659/strictly-personal-1953-UblCMrchfh https://img.videonest.org/gamma/1887659_thumbnail_resized_v2.webp https://gamma.videonest.org/1887659_original_360.mp4 Strictly Personal (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film emphasizes the importance of maintaining peak physical condition for women in the military, connecting it to overall effectiveness and well-being. It covers various aspects of health and hygiene, including proper nutrition, exercise, rest, and relaxation techniques. The film also addresses common concerns and misconceptions, particularly those related to women's health, menstruation, and menopause, offering practical advice and debunking myths. Furthermore, it delves into personal grooming and presentation, from skincare and haircare to makeup and uniform maintenance, all framed within the context of military discipline and attractiveness, asserting that these qualities are not exclusively masculine. Keywords: physical fitness, military women, health, hygiene, nutrition, exercise, rest, relaxation, menstruation, menopause, personal grooming, uniform, attractiveness, well-being, self-discipline 2026-05-09T17:00:00.000Z yes A/V Geeks 16mm Films no 2103 physical fitnessmilitary womenwomen's healthhygienepersonal groomingself-disciplinevintage film https://avgeeks.videonest.co/videos/1888066/av-geeks-16mm-lunch-5-11-2026-EFUBMwwTUQ https://img.videonest.org/gamma/1888066_thumbnail_resized_v2.webp https://gamma.videonest.orghttps:.videonest.co/1888066_video_v5_360.mp4 AV Geeks 16mm Lunch 5 11 2026 Lunch is great! So are 16mm TV commercials! #avgeeks #16mmfilms 2026-05-11T17:00:06.000Z yes A/V Geeks 16mm Films no 3718 vintage commercials16mm filmtv commercialscerealdog foodcoffeetoothpasteTexacoparliament cigarettesstudebaker 1957scope mouthwashcharminpampers diapersgrape nutsklean shine https://avgeeks.videonest.co/videos/1898589/house-of-toys-1950s-rLOO1TFptF https://img.videonest.org/gamma/1898589_thumbnail_resized_v2.webp https://gamma.videonest.org/1898589_original_360.mp4 House Of Toys (1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. *House of Toys* (directed by Edward Dew,) is a black-and-white Christian dramatic short from what appears to be the late 1950s or early 1960s. It follows Bob, a idealistic young man who volunteers at an inner-city church under Pastor Webster, working with troubled youth in a poverty-stricken neighborhood. When Bob goes on vacation to his affluent family's lakeside summer home, he faces mounting pressure from his father to abandon his calling and pursue a lucrative, comfortable career. Simultaneously, his girlfriend Marcia — a privileged young woman raised far from poverty — struggles to accept the sacrifices that life alongside Bob would demand: no suburban house, no material comfort, only a modest flat in the city devoted to serving others. The conflict deepens when Mrs. Baldwin, a wealthy woman, delivers a pivotal speech about the emptiness of a life measured in trophies and playthings. Her words transform Marcia, who chooses to embrace Bob's faith-driven path. The film reaches its climax when word arrives that Pastor Webster has been injured in a gang fight, prompting Bob and a newly committed Marcia to return to the inner city together, reaffirming their shared purpose. Keywords: Christian faith, inner city ministry, youth work, juvenile delinquency, gang violence, vocational calling, materialism vs. purpose, sacrifice, suburban comfort, class divide, social work, 1950s/1960s, black-and-white film, moral drama, redemption, religious dedication, urban blight, coming-of-age, relationship conflict, community outreach 2026-05-16T16:00:39.000Z yes A/V Geeks 16mm Films no 1737 Christian faithinner city ministryyouth workjuvenile delinquencymaterialism vs purposesacrificeclass dividesocial workmoral dramareligious dedication https://avgeeks.videonest.co/videos/1898590/av-geeks-16mm-lunch-5-15-2026-F9MPE9r4ET https://img.videonest.org/gamma/1898590_thumbnail_resized_v2.webp https://gamma.videonest.org/1898590_original_360.mp4 AV Geeks 16mm Lunch 5-15-2026 Are Fridays really that special when you try to watch 16mm films everyday? #16mmfilms #avgeeks 2026-05-16T06:12:46.000Z yes A/V Geeks 16mm Films no 3890 16mm filmvintage footagehistoryrocket enginesWWIImilitary trainingculturearchaeologycritical thinkingspace explorationeducational filmhistorical footagecompilationtechnologyancient artifacts https://avgeeks.videonest.co/videos/1898591/egypt-cradle-of-civilization-1962-U3prcYOL0T https://img.videonest.org/gamma/1898591_thumbnail_resized_v2.webp https://gamma.videonest.org/1898591_original_360.mp4 Egypt: Cradle Of Civilization (1962) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Summary: "EgyptCradleOfCivilization" is a short documentary that traces the origins and rise of ancient Egyptian civilization along the Nile River. It begins by establishing the fertile "Fertile Crescent" of the Middle East — a strip of life-sustaining land amid arid desert — and notes that some 5,000 years ago, one of humanity's earliest great civilizations emerged along the Nile. The film describes how prehistoric Egyptians lived as scattered tribal hunters and herders, entirely dependent on the Nile's waters, and how the river's annual floods both threatened and enriched them. This shared challenge of taming the Nile spurred tribal cooperation, leading to political unification under the pharaohs and the birth of organized society. The documentary then highlights the pillars of this civilization: monumental stone architecture (pyramids and temples like Karnak) built as tombs and tributes to gods; hieroglyphic writing and the invention of papyrus paper that enabled the spread of knowledge in medicine, mathematics, and religion; and a structured daily life evidenced through vivid wall paintings showing herdsmen, hunters, charioteers, and lively feasts. The pharaoh stood as a divine ruler, supported by priests and nobles, and though only royalty lived in luxury, homes were solid and life was culturally rich. The film concludes by asserting that Egyptian civilization profoundly shaped ancient Greece, which in turn influenced Rome and ultimately modern Western civilization — making ancient Egypt, in every sense, the cradle of civilization. Keywords: Ancient Egypt, Nile River, cradle of civilization, pharaohs, Fertile Crescent, pyramids, hieroglyphics, papyrus, irrigation, unification, Karnak temple, archaeology, agriculture, religion, architecture, ancient history, Dinka people, prehistoric civilization, Egyptian culture, Nile floods 2026-05-16T04:00:13.000Z yes A/V Geeks 16mm Films no 656 Ancient EgyptNile RiverCradle of civilizationPharaohsPyramidsKarnakHieroglyphicsPapyrusAncient historyEgyptian culture https://avgeeks.videonest.co/videos/1898592/av-geeks-16mm-lunch-5-14-2026-sLyMMG3KSC https://img.videonest.org/gamma/1898592_thumbnail_resized_v2.webp https://gamma.videonest.org/1898592_original_360.mp4 AV Geeks 16mm Lunch 5-14-2026 Oof!! Hard drives are nearly double what they were a year ago! Even though we have a lot of 16mm film, we use hard drives to hold the digitized film files that we share on this channel. #16mmfilms #avgeeks 2026-05-15T20:29:45.000Z yes A/V Geeks 16mm Films no 4246 16mm filmrhythmmovementartplastic manufacturingindustrial processeseducationhistorynaturevisual artmaterial sciencechemistrylearningvintage filmAV Geeks https://avgeeks.videonest.co/videos/1898593/a-trip-to-the-planets-1963-T-vcw3TSqk https://img.videonest.org/gamma/1898593_thumbnail_resized_v2.webp https://gamma.videonest.org/1898593_original_360.mp4 A Trip To The Planets (1963) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film takes viewers on an imaginary journey 20 years into the future, exploring the planets of our solar system. Starting with a launch from Earth, the narrative visits Mercury, Venus, Mars, Jupiter, and Saturn, detailing scientific facts about each celestial body, from their atmospheric conditions and temperatures to their unique geological features and moons. The film emphasizes the vastness of space, the complexities of interplanetary travel, and the potential for life beyond Earth, concluding with a return to our home planet and a hopeful look towards future exploration. Keywords: Space travel, Solar System, Planets, Astronomy, Future, Exploration, Science Fiction, NASA, Mercury, Venus, Earth, Mars, Jupiter, Saturn, Uranus, Neptune, Pluto. 2026-05-15T16:00:08.000Z yes A/V Geeks 16mm Films no 913 Space travelSolar SystemPlanetsAstronomyFutureExplorationScience FictionNASAMercuryVenusMarsJupiterSaturn https://avgeeks.videonest.co/videos/1898594/using-the-pocket-calculator-1978-UPVApNzn1A https://img.videonest.org/gamma/1898594_thumbnail_resized_v2.webp https://gamma.videonest.org/1898594_original_360.mp4 Using The Pocket Calculator (1978) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explains the versatility of pocket calculators, from basic arithmetic to specialized functions like programming and scientific calculations. It guides viewers on how to choose the right calculator based on their needs and budget, highlighting features like key feedback, durability, algebraic entry, display readability, and warranties. The tutorial then demonstrates how to perform the four fundamental operations (addition, subtraction, multiplication, and division) with clear examples and practical applications. It also touches upon more advanced concepts such as order of operations (PEMDAS/BODMAS) and the use of percentage, square root, and memory functions, emphasizing the importance of understanding the underlying math to effectively utilize these tools. Keywords: Calculator, arithmetic, addition, subtraction, multiplication, division, programming, scientific calculator, algebraic calculator, percentage, square root, order of operations, manual computation. 2026-05-15T04:00:08.000Z yes A/V Geeks 16mm Films no 1041 calculatorpocket calculatormatharithmeticscientific calculatorprogrammingtutorialhow tovintage tech1970seducation https://avgeeks.videonest.co/videos/1898595/av-geeks-16mm-lunch-5-13-2026-NXy21C08Gs https://img.videonest.org/gamma/1898595_thumbnail_resized_v2.webp https://gamma.videonest.org/1898595_original_360.mp4 AV Geeks 16mm Lunch 5-13-2026 Thinking about 16mm films while watching 16mm films is what we do! #16mmfilms #avgeeks 2026-05-14T06:15:13.000Z yes A/V Geeks 16mm Films no 4000 16mm filmfilm projectorvintage filmWestinghouseelectrificationtechnologysciencenaturebiologyastronomyeducational filmhistorical footagemicroscopymetamorphosisAV Geeks https://avgeeks.videonest.co/videos/1898596/a-v-geeks-16mm-lunch-4-29-2026-qv4A5g_cBI https://img.videonest.org/gamma/1898596_thumbnail_resized_v2.webp https://gamma.videonest.org/1898596_original_360.mp4 A/V Geeks 16mm Lunch 4/29/2026 Day 2 of having our channel back! #avgeeks #16mmfilms Energy Seekers Goodbye Lynn House of Toys 2026-05-13T19:50:09.000Z yes A/V Geeks 16mm Films no 4502 https://avgeeks.videonest.co/videos/1898597/av-geeks-16mm-lunch-5-12-2026-Jqd5CnBWLC https://img.videonest.org/gamma/1898597_thumbnail_resized_v2.webp https://gamma.videonest.org/1898597_original_360.mp4 AV Geeks 16mm Lunch 5-12-2026 Back at the archive watching 16mm films with you! #16mmfilms #avgeeks 2026-05-13T19:50:01.000Z yes A/V Geeks 16mm Films no 3347 16mm filmvintage footagearchival footagedocumentaryfilm historyAV Geekseducational contentchildren playinglaw enforcementTurkeyglaciershistorytravelculturerecreation https://avgeeks.videonest.co/videos/1898832/understanding-our-earth-glaciers-1977-qBJgtc5yND https://img.videonest.org/gamma/1898832_thumbnail_resized_v2.webp https://gamma.videonest.org/1898832_original_360.mp4 Understanding Our Earth: Glaciers (1977) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Understanding Our Earth: Glaciers is a classroom educational film that introduces students to the science of glaciology through the voice of a narrator who describes Alaska — "a paradise of glaciers" — as a starting point for exploration. The film explains how glaciers form when snow accumulates over many years in high-altitude or high-latitude regions where summers are too short and cool for all the snow to melt, eventually compressing into slow-moving rivers of ice. It covers the different types of glaciers, particularly valley glaciers found in places like Alaska, the Canadian and American Rockies, and the Andes, as well as the massive continental ice sheets near the South Pole, where scientists work at research stations. The film walks through how glaciers move and erode the landscape, calving icebergs into the sea, depositing glacial till, and sculpting features still visible across North America today — from the lake basins of the Midwest and gravel hills of New England to broad U-shaped valleys. It closes by touching on the concept of ice ages, noting that some scientists believe the periodic triggering of new ice ages remains an open scientific question. 2026-05-17T04:00:00.000Z yes A/V Geeks 16mm Films no 652 glaciersglaciologyice agegeologyearth sciencealaskaandesrockiesantarcticaerosioncalvingeducational film1977 https://avgeeks.videonest.co/videos/1901737/av-geeks-16mm-lunch-5-18-2026-aadKZ5n3UW https://img.videonest.org/gamma/1901737_thumbnail_resized_v2.webp https://gamma.videonest.org/1901737_original_360.mp4 AV Geeks 16mm Lunch 5-18-2026 A start of the work week isn't a cause for concern when you are breaking it up with some classic 16mm films! #16mmfilms #avgeeks 2026-05-18T15:58:01.000Z yes A/V Geeks 16mm Films no 4392 https://avgeeks.videonest.co/videos/1901738/cascade-animation-commercials-reel-2-circa-1957-2sa3eXmmRs https://img.videonest.org/gamma/1901738_thumbnail_resized_v2.webp https://gamma.videonest.org/1901738_original_360.mp4 Cascade Animation Commercials, Reel 2 (circa 1957) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Cool Ad LM animated letters over live action J Wax - live middle / anim start Raid - white rain - live and amin new Chiffon - good voice Swift Chapin Wesix spot - too many techniques, horrid! 2026-05-18T16:00:34.000Z yes A/V Geeks 16mm Films no 479 animationcommercialsvintage1950sKool-AidJ-WaxRaidChiffonadvertisinganimated letterslive actionproduct ads https://avgeeks.videonest.co/videos/1901739/pirro-and-the-magnet-1948-dI7m7kpcqu https://img.videonest.org/gamma/1901739_thumbnail_resized_v2.webp https://gamma.videonest.org/1901739_original_360.mp4 Pirro and The Magnet (1948) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Description of science and the properties of magnetism featuring Pirro, a clown marionette. 2026-05-18T04:00:21.000Z yes A/V Geeks 16mm Films no 537 https://avgeeks.videonest.co/videos/1901740/father-of-the-space-age-1976-EM-o5shT-n https://img.videonest.org/gamma/1901740_thumbnail_resized_v2.webp https://gamma.videonest.org/1901740_original_360.mp4 Father Of The Space Age (1976) This documentary chronicles the life and groundbreaking work of Robert Hutchings Goddard, the American pioneer of rocketry. It details his early fascination with space travel, inspired by science fiction, and his dedicated, often solitary, pursuit of rocket technology. Despite facing skepticism and limited resources, Goddard achieved significant milestones, including launching the world's first liquid-propellant rocket in 1926. The film highlights his meticulous research, numerous patents, and the eventual recognition of his contributions, which laid the foundation for modern space exploration, including the moon landing. Keywords: Robert Hutchings Goddard, rocketry, space exploration, liquid-propellant rocket, Smithsonian, pioneering scientist, innovation, history, moon landing. 2026-05-18T04:00:10.000Z yes A/V Geeks 16mm Films no 876 Robert GoddardRocketrySpace ExplorationPioneering ScientistLiquid PropellantInnovationHistoryMoon LandingSmithsonianScience Documentary https://avgeeks.videonest.co/videos/1901741/learn-subtraction-football-cards-example-made-easy-XzUyLsNeFn https://img.videonest.org/gamma/1901741_thumbnail_resized_v2.webp https://gamma.videonest.org/1901741_original_360.mp4 Learn Subtraction: Football Cards Example Made Easy #shorts See a practical math problem: 297 trading cards minus 76. The step-by-step solution reveals you have 221 cards left. Learning math in action! #MathProblems #Subtraction #RealLifeMath #CardCollection 2026-05-17T20:44:13.000Z yes A/V Geeks 16mm Films no 22 subtractionmath problemstrading cardsreal life mathcard collectionlearning mathfootball cards https://avgeeks.videonest.co/videos/1901742/choosing-the-best-personal-calculator-key-features-y9QW8MvfPa https://img.videonest.org/gamma/1901742_thumbnail_resized_v2.webp https://gamma.videonest.org/1901742_original_360.mp4 Choosing the Best Personal Calculator: Key Features Explained! #shorts Picking a personal calculator? Consider its functions, budget, key feel, and durability. Ensure an algebraic entry and a clear display. A good warranty is key for rapid, economic repairs. #CalculatorTips #TechBuying #Gadgets #Electronics 2026-05-17T20:42:00.000Z yes A/V Geeks 16mm Films no 101 personal calculatorcalculator featurestech buyinggadgetscalculator tipsalgebraic entryclear displaycalculator durabilitycalculator warrantykey feel https://avgeeks.videonest.co/videos/1901743/new-frontiers-1935-VRck9OXRxM https://img.videonest.org/gamma/1901743_thumbnail_resized_v2.webp https://gamma.videonest.org/1901743_original_360.mp4 New Frontiers (1935) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. An early 20th century film, sponsored by Westinghouse, showcasing the wonders and ease of life using appliances and machines powered by electricity. 2026-05-17T16:00:15.000Z yes A/V Geeks 16mm Films no 994 https://avgeeks.videonest.co/videos/1902329/janet-and-the-genie-1967-eUCl1XHIWP https://img.videonest.org/gamma/1902329_thumbnail_resized_v2.webp https://gamma.videonest.org/1902329_original_360.mp4 Janet And The Genie (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Follows a field trip of a high school home economics student through meat packing, poultry processing, apple packing, egg grading and dairy plants. Includes shopping tips from the Consumer and Marketing Service of the Department of Agriculture. 2026-05-19T04:00:24.000Z yes A/V Geeks 16mm Films no 1709 Janet and Genie1967 filmhome economicsfield tripmeat packingpoultry processingapple packingegg gradingdairy plantconsumer tipsUSDAfood production https://avgeeks.videonest.co/videos/1902330/korea-performing-arts-the-wonderful-world-of-kim-s-fJ6LxGjQ54 https://img.videonest.org/gamma/1902330_thumbnail_resized_v2.webp https://gamma.videonest.org/1902330_original_360.mp4 Korea: Performing Arts- The Wonderful World Of Kim Sung Hee (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film offers a glimpse into the world of Korean performing arts, specifically traditional dance and music, through the eyes of Kim Sunungi. It traces her journey from a young girl with a dream to a performer at the National Theater in Seoul. The narrative highlights the evolution of Korean arts, from ancient court performances and folk traditions like mask dances and farmer's dances, to their preservation and reinterpretation in modern Korea. The film emphasizes the deep cultural significance of these arts, their connection to history, nature, and the Korean spirit, and the blending of past and present that defines the contemporary Korean cultural landscape. Keywords: Korean traditional dance, Korean traditional music, Kim Sunungi, folk dance, court dance, mask dance, farmer's dance, Pansori, Kayagum, National Theater, Seoul, cultural heritage, history, nature, past and present. 2026-05-19T04:00:20.000Z yes A/V Geeks 16mm Films no 1283 Korean traditional danceKorean traditional musicKim Sunungifolk dancecourt dancemask dancefarmer's dancePansoriKayagumNational TheaterSeoulcultural heritagehistorynaturepast and present https://avgeeks.videonest.co/videos/1910494/av-geeks-16mm-lunch-5-22-2026-rAMcVOeWFJ https://img.videonest.org/gamma/1910494_thumbnail_resized_v2.webp https://gamma.videonest.org/1910494_original_360.mp4 AV Geeks 16mm Lunch 5-22-2026 Watching 16mm films about our past is much better than reading headlines about our present. #16mmfilms #avgeeks 2026-05-21T18:08:16.000Z yes A/V Geeks 16mm Films no 4325 https://avgeeks.videonest.co/videos/1910497/the-story-of-my-life-by-mr-shoe-silent-1930s-s_bwqSrZC8 https://img.videonest.org/gamma/1910497_thumbnail_resized_v2.webp https://gamma.videonest.org/1910497_original_360.mp4 The Story of My Life by Mr Shoe (silent, 1930s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. A detailed description of the shoe manufacturing process (circa 1930s) at an industrial scale. Includes charming animated characters and detailed sequences of the stages and parts needed for shoe construction. 2026-05-22T16:00:15.000Z yes A/V Geeks 16mm Films no 914 https://avgeeks.videonest.co/videos/1910500/av-geeks-16mm-lunch-5-21-2026-4fSXg6R588 https://img.videonest.org/gamma/1910500_thumbnail_resized_v2.webp https://gamma.videonest.org/1910500_original_360.mp4 AV Geeks 16mm Lunch 5-21-2026 Even though we are on the verge of a 3 day (4 day?) weekend, we still have lots of films to watch! #16mmfilms #avgeeks 2026-05-22T06:16:31.000Z yes A/V Geeks 16mm Films no 4113 https://avgeeks.videonest.co/videos/1910502/chemical-change-1958-t0xo5fJTeI https://img.videonest.org/gamma/1910502_thumbnail_resized_v2.webp https://gamma.videonest.org/1910502_original_360.mp4 Chemical Change (1958) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the concept of chemical change, differentiating it from physical change through various examples. It illustrates how chemical changes involve the formation of new substances with different properties, such as wood burning into ash and smoke, or mercury combining with oxygen to form mercuric oxide. Conversely, physical changes, like ice melting or mercury expanding, alter the form but not the chemical identity of a substance. The film demonstrates how chemical reactions can be reversed, as seen when mercuric oxide is broken down into mercury and oxygen, or when silver sulfide (tarnish) is removed from silver. It also touches upon how understanding chemical changes helps in agriculture, for example, by identifying soil acidity through litmus paper tests, and highlights the beauty and practical applications of chemical transformations in the world around us. Keywords: chemical change, physical change, new substances, elements, compounds, mercury, oxygen, mercuric oxide, silver, sulfur, silver sulfide, tarnish, iron, rust, iron oxide, carbon, fire, acid, base, litmus paper, agriculture, fertilizer 2026-05-22T04:00:06.000Z yes A/V Geeks 16mm Films no 702 https://avgeeks.videonest.co/videos/1910504/dimension-1967-9hlYGO9yiF https://img.videonest.org/gamma/1910504_thumbnail_resized_v2.webp https://gamma.videonest.org/1910504_original_360.mp4 Dimension (1967) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the concept of dimensions, starting with our familiar three-dimensional world and then delving into the theoretical existence of a fourth dimension. It uses analogies of lower-dimensional worlds and the mathematics of a tesseract to illustrate how objects and experiences would differ in higher dimensions. The film suggests that a fourth dimension could allow for seemingly impossible feats, such as transforming handedness, escaping enclosed spaces, and perceiving the "inside" of objects from the "outside." Ultimately, it poses the question of whether this fourth dimension is a reality or merely a mathematical concept. Keywords: dimensions, three-dimensional world, four-dimensional, tesseract, point, line, square, cube, handedness, prison, perception, mathematics, spatial reasoning, theoretical physics 2026-05-21T16:00:12.000Z yes A/V Geeks 16mm Films no 997 https://avgeeks.videonest.co/videos/1910506/av-geeks-16mm-lunch-5-20-2026-iXGYuuWYG0 https://img.videonest.org/gamma/1910506_thumbnail_resized_v2.webp https://gamma.videonest.org/1910506_original_360.mp4 AV Geeks 16mm Lunch 5-20-2026 The middle of the work week is an excellent time to devote your attention to old 16mm films! #16mmfilms #avgeeks 2026-05-21T12:59:51.000Z yes A/V Geeks 16mm Films no 4047 https://avgeeks.videonest.co/videos/1910508/av-geeks-16mm-lunch-5-19-2026-wL_troTruC https://img.videonest.org/gamma/1910508_thumbnail_resized_v2.webp https://gamma.videonest.org/1910508_original_360.mp4 AV Geeks 16mm Lunch 5-19-2026 It's actual film being scanned and you see the results! #16mmfilms #avgeeks 2026-05-21T12:59:46.000Z yes A/V Geeks 16mm Films no 3998 https://avgeeks.videonest.co/videos/1910510/zoo-animals-in-rhyme-1965-uy1wmxNr1a https://img.videonest.org/gamma/1910510_thumbnail_resized_v2.webp https://gamma.videonest.org/1910510_original_360.mp4 Zoo Animals In Rhyme (1965) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the zoo and highlights the various activities and unique characteristics of different animals, from the playful monkeys and lumbering elephants to the agile kangaroos and towering giraffes. The narrative repeatedly questions why the lion remains unusually quiet and still, contrasting his behavior with the energetic antics of the other creatures. Ultimately, the mystery is solved: the lion awakens and performs a mighty roar and display for the delighted children who have come to watch him, revealing that his initial stillness was due to a lack of an audience, and his true wild nature emerges when observed. Keywords: Zoo, animals, lion, monkeys, elephants, kangaroos, giraffes, bears, fox, wolf, behaviors, observation, performance, roar. 2026-05-21T04:00:34.000Z yes A/V Geeks 16mm Films no 638 https://avgeeks.videonest.co/videos/1910513/emilio-en-espana-1-el-telegrama-spanish-1965-rKoO5kSYK- https://img.videonest.org/gamma/1910513_thumbnail_resized_v2.webp https://gamma.videonest.org/1910513_original_360.mp4 Emilio En Espana: 1 El Telegrama (Spanish, 1965) The story revolves around a family eagerly awaiting the arrival of Emilio, their grandson, who is traveling from Mexico. A telegram from Emilio's father, Adolfo, announces his imminent arrival in Seville, although he will first stop in Madrid due to flight limitations. The family is overjoyed and plans to inform Ignacio, who will also be in Madrid to meet Emilio. The conversation touches upon travel arrangements, with a preference for the train over a plane, and the need to book seats for the upcoming journey. Keywords: grandson, telegram, arrival, family, travel, Madrid, Seville, train, reservation 2026-05-20T16:00:37.000Z yes A/V Geeks 16mm Films no 232 https://avgeeks.videonest.co/videos/1910515/reading-and-critical-thinking-1967-E8LsRZGIjl https://img.videonest.org/gamma/1910515_thumbnail_resized_v2.webp https://gamma.videonest.org/1910515_original_360.mp4 Reading And Critical Thinking (1967) This film teaches the audience how to engage in critical thinking when reading by emphasizing the importance of considering the author's point of view, background, and word choices. It illustrates how different perspectives and the subjective nature of language can lead to varied interpretations of the same information. The film encourages readers to distinguish between facts and opinions, be wary of misleading quotes or sales tactics, and utilize structural clues like author introductions and end-of-chapter questions to identify key information. Ultimately, it aims to empower viewers to become more discerning and analytical readers by understanding and evaluating the source and presentation of information. Keywords: critical thinking, author's point of view, facts vs. opinion, interpretation, media literacy, reading comprehension, word choice, context, bias, verification 2026-05-20T04:00:20.000Z yes A/V Geeks 16mm Films no 858 https://avgeeks.videonest.co/videos/1912348/rhythm-and-movement-in-art-1969-vqyrsvDISD https://img.videonest.org/gamma/1912348_thumbnail_resized_v2.webp https://gamma.videonest.org/1912348_original_360.mp4 Rhythm And Movement In Art (1969) This film explores the fundamental role of rhythm and movement in art, drawing parallels between natural phenomena and artistic creation. It demonstrates how artists utilize various elements like line, color, light, and form to evoke a sense of rhythm and motion. Through examples from different art forms, including painting, sculpture, architecture, and film, the transcript highlights techniques such as repetition, alternation, and accent to create dynamic visual experiences that engage the viewer's eye and imbue static works with life. Keywords: rhythm, movement, art, repetition, line, color, light, shadow, form, shape, curves, straight lines, diagonals, alternation, radial, spiral, accent, variation, sculpture, architecture, painting, film, visual elements, nature, life, artistic creation. 2026-05-24T04:00:10.000Z yes A/V Geeks 16mm Films no 1165 https://avgeeks.videonest.co/videos/1912349/meet-mr-termite-silent-1950s-aXQyS9I45C https://img.videonest.org/gamma/1912349_thumbnail_resized_v2.webp https://gamma.videonest.org/1912349_original_360.mp4 Meet Mr Termite (silent, 1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Meet Mr. Termite is a vintage silent footage for an educational documentary short film produced by F. H. Clough that explores the biology and destructive impact of termites across the United States. Using animated title cards, striking macro photography, and location footage, the film introduces termite castes — including winged swarmers and worker termites — and documents their colony behavior before pivoting to the catastrophic property damage they cause, from hollowed-out home foundations and destroyed books to compromised railroad ties, telephone poles, and electrical transmission towers. A US map illustrates their wide geographic range, and an on-site structural inspection underscores the economic stakes, making the film a broad warning about termites as a nationwide threat to both private property and public infrastructure. 2026-05-23T16:00:18.000Z yes A/V Geeks 16mm Films no 582 https://avgeeks.videonest.co/videos/1912350/reading-in-the-humanities-1967-Y2E0Y4Snhh https://img.videonest.org/gamma/1912350_thumbnail_resized_v2.webp https://gamma.videonest.org/1912350_original_360.mp4 Reading In The Humanities (1967) This film aims to demystify the concept of "bookworms" by illustrating that it refers to anyone who enjoys reading. It explains that effective reading, particularly in the humanities, involves more than just moving your eyes across the page. Viewers are encouraged to adjust their reading speed based on the material's difficulty, actively seek main ideas and details, and use context clues to understand varied language. The film emphasizes that by employing these strategies, readers can unlock the rich experiences and knowledge offered by history, literature, and art, transforming reading into a rewarding and enjoyable pursuit. Keywords: bookworm, reading, humanities, history, literature, fine arts, philosophy, speed reading, main idea, details, context clues, cause and effect, poetry, imagery, language, engagement 2026-05-23T04:00:04.000Z yes A/V Geeks 16mm Films no 847 https://avgeeks.videonest.co/videos/1913788/av-geeks-16mm-lunch-5-26-2026-vBQGuf61BZ https://img.videonest.org/gamma/1913788_thumbnail_resized_v2.webp https://avgeeks.videonest.co/videos/1913788/av-geeks-16mm-lunch-5-26-2026-vBQGuf61BZ AV Geeks 16mm Lunch 5-26-2026 Technology! A newish Mac and new install of OBS. What could possibly go wrong? #16mmfilms #avgeeks 2026-05-26T16:50:18.000Z yes A/V Geeks 16mm Films no 3904 16mm filmsrural educationtraffic safetyfootballteen romancevintage footagearchivaleducationfarm lifeschoolhousedriver education1948sports historyteen dramarelationships https://avgeeks.videonest.co/videos/1913789/av-geeks-16mm-lunch-5-25-2026-A9MUPjY1Ry https://img.videonest.org/gamma/1913789_thumbnail_resized_v2.webp https://gamma.videonest.org/1913789_original_360.mp4 AV Geeks 16mm Lunch 5-25-2026 Have the day off! Maybe go for a picnic! #16mmfilms #avgeeks 2026-05-26T06:16:33.000Z yes A/V Geeks 16mm Films no 3766 16mm filmvintage filmpicnicchildrenfamilyreligious storiesanimationLord's Prayertemptationhealthy eatingchildhoodnaturecomedymoral lessonBible stories https://avgeeks.videonest.co/videos/1913790/the-sandia-story-1960-ZwIlxlHDsq https://img.videonest.org/gamma/1913790_thumbnail_resized_v2.webp https://gamma.videonest.org/1913790_original_360.mp4 The Sandia Story (1960) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film chronicles the work of Sandia Laboratory, from its origins in the atomic age to its present-day role in developing practical nuclear weapons systems. It highlights the collaborative efforts between Sandia, Los Alamos, and Lawrence Radiation Laboratory, emphasizing the rigorous research, engineering, testing, and quality control involved in creating these sophisticated defense tools. Beyond military applications, the film touches upon the potential peaceful uses of atomic energy and the importance of continuous scientific advancement for both national security and future industrial progress. The narrative follows a new engineer's journey, showcasing the security protocols, the diverse expertise of the staff, and the intricate processes involved in transforming nuclear explosive systems into deployable weapons. Keywords: nuclear weapons, atomic age, Sandia Laboratory, Los Alamos, Lawrence Radiation Laboratory, engineering, research and development, defense, security, testing, innovation, scientific progress, peaceime applications, weapons systems, nuclear energy 2026-05-26T04:00:34.000Z yes A/V Geeks 16mm Films no 2000 Sandia Laboratorynuclear weaponsatomic ageresearch and developmentengineeringtestingnational defenseLos Alamosmilitary technologysciencelaboratorymanufacturingquality controlinnovationscientific progress https://avgeeks.videonest.co/videos/1913791/know-the-cause-1954-DXDcAWCQWp https://img.videonest.org/gamma/1913791_thumbnail_resized_v2.webp https://gamma.videonest.org/1913791_original_360.mp4 Know The Cause (1954) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film emphasizes the critical role firefighters play in investigating the causes of fires, going beyond just extinguishment. It highlights that understanding how fires start is essential for prevention and successful prosecution of arsonists. Firefighters are urged to be observant, report any unusual circumstances or evidence they encounter at a fire scene, as this information is vital for arson investigators. The film details various motives and methods behind arson, including fires for profit, revenge, to cover other crimes, and those set by pyromaniacs, underscoring the importance of firefighters' observations in identifying these patterns and aiding in investigations. Keywords: Arson, Fire Investigation, Firefighter Observation, Evidence Collection, Fire Prevention, Incendiary Fires, Pyromania, Motive, Suspicious Circumstances, Arson Investigator 2026-05-25T04:00:29.000Z yes A/V Geeks 16mm Films no 2004 firefightersarsonfire investigationevidencepreventionarson investigatorsfire scenesmotivespyromaniaincendiary fires https://avgeeks.videonest.co/videos/1913792/reading-in-the-math-and-science-areas-1967-lVqfL9FTxw https://img.videonest.org/gamma/1913792_thumbnail_resized_v2.webp https://gamma.videonest.org/1913792_original_360.mp4 Reading In The Math And Science Areas (1967) This film emphasizes the crucial role of reading comprehension in understanding mathematics and science. It argues that mastery of these subjects goes beyond rote memorization and involves the ability to interpret symbols, understand context, and visualize concepts presented in texts, diagrams, and experiments. The film uses examples ranging from simple arithmetic problems and recipe adjustments to complex scientific principles and computer operations to illustrate how effective reading skills are fundamental to scientific discovery and technological advancement. Keywords: reading comprehension, mathematics, science, symbols, diagrams, experiments, hypothesis, scientific method, problem-solving, computer, technology, education 2026-05-24T16:00:23.000Z yes A/V Geeks 16mm Films no 955 reading comprehensionmathematicssciencesymbolsdiagramsexperimentsscientific methodproblem-solvingtechnologyeducation1960svintage film https://avgeeks.videonest.co/videos/1915449/chroniques-de-france-132-1-1970s-french-fdKcCTS54d https://img.videonest.org/gamma/1915449_thumbnail_resized_v2.webp https://gamma.videonest.org/1915449_original_360.mp4 Chroniques De France 132-1 (1970s, French) The Royal Château of Saint-Germain-en-Laye, after centuries of transformations, became dedicated to Celtic studies by Napoleon I. It now houses significant donations and collections, serving as a major global center for the study of the Quaternary period, alongside its department on the Gauls. Recent renovations of its prehistoric and Paleolithic art sections offer a glimpse into a lesser-known aspect of civilization, from the Bronze Age's abundant gold to the impactful discovery of iron. The spread of Celtic tribes in Western Europe, with those in France known as Gauls, is illuminated by their tombs, which reveal customs of burial with personal effects and provisions. The presence of Italo-Greek artifacts indicates extensive trade between the Gauls and the Mediterranean world. Despite Roman influence after the conquest of Gaul, Gallic art retained its unique character, as seen in items like the golden helmet of Enfretville and the characteristic torque necklaces. The fall of the Roman Empire ushered in the poorly understood Merovingian civilization. Keywords: Château de Saint-Germain-en-Laye, Celtic studies, Quaternary, Gauls, prehistory, Paleolithic art, Bronze Age, Iron Age, Celtic tribes, Gallic civilization, tombs, trade, Mediterranean, Roman influence, Merovingian civilization. 2026-05-28T04:00:37.000Z yes A/V Geeks 16mm Films no 446 GaulsCelticRomanMerovingianPrehistoryArchaeologyFranceMuseumAntiquitiesBronze AgeIron Age https://avgeeks.videonest.co/videos/1915450/av-geeks-16mm-lunch-5-27-2026-R82ftaEtNC https://img.videonest.org/gamma/1915450_thumbnail_resized_v2.webp https://gamma.videonest.org/1915450_original_360.mp4 AV Geeks 16mm Lunch 5-27-2026 Going to do some live scanning/streaming today - fingers crossed. You can watch and see if it works! #16mmfilms #avgeeks 2026-05-27T16:53:43.000Z yes A/V Geeks 16mm Films no 4525 16mm filmvintage filmmapsspace explorationastronomyeducationgeographyfilmmakinghistorydocumentaryvintage footagearchival footagesciencenavigationconversation https://avgeeks.videonest.co/videos/1915451/a-new-wrinkle-safety-on-wheels-1950s-ZEDB1Vx38d https://img.videonest.org/gamma/1915451_thumbnail_resized_v2.webp https://gamma.videonest.org/1915451_original_360.mp4 A New Wrinkle -- Safety on Wheels (1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film highlights the danger of tire blowouts, which are a significant cause of fatal accidents. It explains how a blowout causes a tire to slip off the rim, leading to loss of control. To address this, a new wheel design was developed with grooves that firmly secure the tire bead to the rim, even after a blowout. Tests demonstrated that cars equipped with these grooved wheels, known as "Miracle Wheels," maintained control even at high speeds after a tire was intentionally blown out. The film concludes by emphasizing the safety benefits and affordability of this innovation, which can be applied to existing wheels to prevent accidents and save lives. Keywords: tire blowout, car safety, accident prevention, wheel design, Miracle Wheel, tire bead, rim, loss of control, high-speed test, grooved wheel 2026-05-27T04:00:32.000Z yes A/V Geeks 16mm Films no 488 tire blowoutcar safetyaccident preventionwheel designMiracle Wheeltire beadrimloss of controlhigh-speed testgrooved wheelautomotive historyvintage car https://avgeeks.videonest.co/videos/1916419/av-geeks-16mm-lunch-5-28-2026-nqGl30MJWc https://img.videonest.org/gamma/1916419_thumbnail_resized_v2.webp https://gamma.videonest.org/1916419_original_360.mp4 AV Geeks 16mm Lunch 5-28-2026 It's going to be a good day when you've got 16mm films to watch! #16mmfilms #avgeeks 2026-05-29T06:31:29.000Z yes A/V Geeks 16mm Films no 4061 grammarpronounspunctuationeducationlanguage artsfilmstripparts of speechlinguisticswritingsentence structureanimationstorytellingVersaillescommunityhistorical sites https://avgeeks.videonest.co/videos/1916420/consumption-of-food-1946-uxh34_jmMI https://img.videonest.org/gamma/1916420_thumbnail_resized_v2.webp https://gamma.videonest.org/1916420_original_360.mp4 Consumption Of Food (1946) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film discusses the importance of nutrition and the global food problem. It highlights the essential food elements needed for healthy living, including carbohydrates, fats, proteins, vitamins, and minerals, and explains that a balanced diet requires variety. The film then contrasts the average diets in the United States, Europe, and Asia, revealing significant nutritional deficiencies in Asia and parts of Europe and the Americas. It identifies population growth, unequal distribution of resources, limited cultivated land, and ingrained food habits as key challenges to achieving adequate food for everyone, emphasizing that solutions require addressing production, distribution, and changing attitudes through education. Keywords: nutrition, balanced diet, food elements, carbohydrates, proteins, vitamins, minerals, calories, malnutrition, food production, food distribution, population growth, food habits, global food problem 2026-05-29T04:00:11.000Z yes A/V Geeks 16mm Films no 652 nutritionbalanced dietfood elementsglobal food problemmalnutritionfood productionfood distributioncarbohydratesproteinsvitaminsmineralscalorieshealthy livingfood habits https://avgeeks.videonest.co/videos/1916916/av-geeks-16mm-lunch-5-29-2026-u8TGCu5Hpa https://img.videonest.org/gamma/1916916_thumbnail_resized_v2.webp https://gamma.videonest.org/1916916_original_360.mp4 AV Geeks 16mm Lunch 5-29-2026 Friday? sure. 16mm films? Definitely!! #16mmfilms #avgeeks 2026-05-28T18:56:08.000Z yes A/V Geeks 16mm Films no 4428 16mm filmsvintage carautomotive repairsteering geartravelParishome buildingbrickconstructionvintage travelfamily lifemanufacturingarchitecturedocumentarychildren https://avgeeks.videonest.co/videos/1917154/geography-of-hawaii-and-alaska-1970-UlqbB33waE https://img.videonest.org/gamma/1917154_thumbnail_resized_v2.webp https://gamma.videonest.org/1917154_original_360.mp4 Geography Of Hawaii And Alaska (1970) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the unique characteristics of Alaska and Hawaii, the 49th and 50th states of the United States. It details Alaska's history, from its purchase from Russia to the gold rush and its eventual statehood, highlighting its vast geography, diverse landforms, and natural resources like oil and timber. The narrative also covers the challenges of transportation in Alaska and the lifestyles of its people, from the tundra dwellers to those in its growing cities. For Hawaii, the film touches upon its volcanic origins, its history of unification and territorial status, and its transformation into a state. It emphasizes Hawaii's agricultural industries, particularly sugar cane and pineapple production, the diverse population shaped by immigration, and its growing importance in national defense and tourism. Both states are presented as vital transportation hubs connecting the East and Asia with the Western world, each with distinct developmental paths and growing populations. Keywords: Alaska, Hawaii, statehood, geography, resources, history, gold rush, oil, timber, transportation, agriculture, tourism, volcanoes, culture, economy, population, Pearl Harbor, Mount McKinley 2026-05-30T04:00:22.000Z yes A/V Geeks 16mm Films no 918 AlaskaHawaiiGeographyStatehoodResourcesHistoryGold RushOilTimberTransportationAgricultureTourismVolcanoesCultureEconomy https://avgeeks.videonest.co/videos/1918467/goodbye-lynn-1972-JKetnWg_di https://img.videonest.org/gamma/1918467_thumbnail_resized_v2.webp https://gamma.videonest.org/1918467_original_360.mp4 Goodbye Lynn (1972) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film depicts a young woman, Lynn, grappling with an unexpected pregnancy and the profound internal and external conflicts it creates. While her family's daily routines remain unchanged, Lynn experiences a deep sense of disorientation and paradox, feeling both connected to nature and alienated by the artificiality of social expectations. She struggles with the conflicting advice from friends and family regarding her options—abortion, keeping the baby, or adoption—and the judgment she faces from society, her peers, and even herself after her boyfriend leaves. The narrative highlights her isolation, her fear of losing her identity, and the immense pressure of making life-altering decisions with no clear right answer, all while trying to maintain her composure. Keywords: pregnancy, teen pregnancy, societal pressure, abortion, adoption, family, friends, identity, confusion, isolation, decision-making, paradox, judgment, personal conflict 2026-06-01T04:00:09.000Z yes A/V Geeks 16mm Films no 1287 https://avgeeks.videonest.co/videos/1918468/verify-information-avoid-misleading-quotes-shorts-cHwETTiQ6h https://img.videonest.org/gamma/1918468_thumbnail_resized_v2.webp https://gamma.videonest.org/1918468_original_360.mp4 Verify Information: Avoid Misleading Quotes #shorts Don't accept quotes out of context. Always verify facts from other sources and check for supporting evidence before believing a statement. #InformationVerification #CriticalThinking #FactChecking #MediaLiteracy 2026-05-31T16:20:09.000Z yes A/V Geeks 16mm Films no 22 verify informationmisleading quotesfact checkingcritical thinkingmedia literacyquotes out of contextsupporting evidence https://avgeeks.videonest.co/videos/1918469/critical-thinking-fact-vs-opinion-road-signs-expla-A2Y50-oTiR https://img.videonest.org/gamma/1918469_thumbnail_resized_v2.webp https://gamma.videonest.org/1918469_original_360.mp4 Critical Thinking: Fact vs. Opinion Road Signs Explained #shorts Navigate the path to critical thinking by distinguishing fact from opinion. Understand author viewpoints, recognize biases, and verify information for true comprehension. Don't be misled by out-of-context quotes. #CriticalThinking #ReadingSkills #FactVsOpinion #InformationLiteracy #StudyTips 2026-05-31T16:18:30.000Z yes A/V Geeks 16mm Films no 90 fact vs opinioncritical thinkinginformation literacyreading skillsauthor viewpointbiasverify informationcomprehensionmisleading quotesstudy tips https://avgeeks.videonest.co/videos/1918470/sewing-simple-seams-1947-89SFRs2000 https://img.videonest.org/gamma/1918470_thumbnail_resized_v2.webp https://gamma.videonest.org/1918470_original_360.mp4 Sewing Simple Seams (1947) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film demonstrates various methods for finishing plain seams, emphasizing their importance in creating well-tailored garments with a professional appearance. It covers techniques like pinking, overcasting, stitching the edges, binding with tape, catch stitching for heavy materials, and decorative top stitching. Each method is explained with step-by-step instructions, including preparation, stitching, and pressing, with variations suitable for different fabric types and garment designs. The core message is that mastering simple seam finishes is fundamental to achieving high-quality sewing results. Keywords: sewing, seams, garment construction, fabric finishing, pinking, overcasting, stitching, binding, catch stitch, top stitching, pressing, tailoring, dressmaking 2026-05-31T04:00:01.000Z yes A/V Geeks 16mm Films no 624 sewingseamsgarment constructionfabric finishingpinkingovercastingstitchingbindingcatch stitchtop stitchingtailoringdressmaking https://avgeeks.videonest.co/videos/1921608/av-geeks-16mm-lunch-6-2-2026-TBnSZHV-rs https://img.videonest.org/gamma/1921608_thumbnail_resized_v2.webp https://gamma.videonest.org/1921608_original_360.mp4 AV Geeks 16mm Lunch 6-2-2026 C'mon YouTube! Give us a break! We're just watching old 16mm films! #16mmfilms #avgeeks 2026-06-03T06:13:35.000Z yes A/V Geeks 16mm Films no 3611 16mm filmeducational filmhospital hygieneinfection controlwartime nutritiongoldfish careresponsibilitypublic healthmedical historybacteriasanitationA/V Geeksfilm projectorchannel promotionvintage film https://avgeeks.videonest.co/videos/1921609/the-human-body-digestive-system-1980-2nd-ed-6C7fzGwHrS https://img.videonest.org/gamma/1921609_thumbnail_resized_v2.webp https://gamma.videonest.org/1921609_original_360.mp4 The Human Body: Digestive System (1980, 2nd ed) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The digestive system breaks down food into nutrients that cells can use for growth, repair, and energy. This process begins in the mouth with chewing and saliva, then moves to the esophagus, stomach, small intestine, and large intestine. In the stomach, food is mixed with gastric juices, and in the small intestine, it's further broken down by enzymes from the pancreas and liver, with nutrients then absorbed into the bloodstream. The large intestine reabsorbs water, and undigested material is eliminated. This entire process, coupled with the body's cellular metabolism, ensures that the body receives the essential vitamins, minerals, proteins, carbohydrates, and fats needed for life. Keywords: digestion, digestive system, nutrients, cells, mouth, saliva, enzymes, esophagus, stomach, gastric juices, small intestine, liver, pancreas, bile, absorption, blood, large intestine, water, metabolism, vitamins, minerals, proteins, carbohydrates, fats 2026-06-03T04:00:13.000Z yes A/V Geeks 16mm Films no 962 https://avgeeks.videonest.co/videos/1921610/av-geeks-16mm-lunch-6-1-2026-part-2-LLbK7n3Fkl https://img.videonest.org/gamma/1921610_thumbnail_resized_v2.webp https://gamma.videonest.org/1921610_original_360.mp4 AV Geeks 16mm Lunch 6-1-2026 Part 2 Welcome June. There's a seat in the back. Join us and watch some classic 16mm films. #16mmfilms #avgeeks 2026-06-02T06:38:08.000Z yes A/V Geeks 16mm Films no 2049 cycling safetybicycle safetycivil defensenuclear falloutradiationvintage filmeducational filmpreparednessroad safetytraffic safetyCold Waremergency kitfallout shelterbike maintenancechildren cycling https://avgeeks.videonest.co/videos/1921611/av-geeks-16mm-lunch-6-1-2026-Hl0NZc2cLQ https://img.videonest.org/gamma/1921611_thumbnail_resized_v2.webp https://gamma.videonest.org/1921611_original_360.mp4 AV Geeks 16mm Lunch 6-1-2026 Welcome June. There's a seat in the back. Join us and watch some classic 16mm films. #16mmfilms #avgeeks 2026-06-02T05:42:01.000Z yes A/V Geeks 16mm Films no 2048 16mm filmdinosaursfossilspaleontologyeducationhealth educationgermstelecommunicationsautomotive safetyastronomyanimationdocumentaryfamilyclassroomteacher https://avgeeks.videonest.co/videos/1921612/energy-seekers-1980-X4a2D2Ac-d https://img.videonest.org/gamma/1921612_thumbnail_resized_v2.webp https://gamma.videonest.org/1921612_original_360.mp4 Energy Seekers (1980) The film explores the critical need for new energy sources due to the dwindling availability of cheap fossil fuels. It highlights various innovative approaches to harness energy, including wind farms with large turbines, advancements in nuclear fusion for an inexhaustible supply, and the liquefaction of coal. The documentary also examines the potential of extracting oil from shale and tar sands, cultivating oil-producing plants, and utilizing corn and other grains for ethyl alcohol fuel. Geothermal energy from natural steam vents and the Earth's internal heat is presented, along with the promising development of cars running on hydrogen, derived from water. Furthermore, the film discusses the use of fallen timber and fast-growing trees as fuel, and the innovative conversion of methane gas from landfills and garbage into a usable energy source. Finally, it emphasizes the immense potential of solar energy, from heating systems and solar panels to photovoltaic cells that directly convert sunlight into electricity, as well as large-scale solar thermal power towers. The overarching message is that ingenuity and conservation are key to securing future energy needs, with a multitude of solutions rather than a single answer. Keywords: energy, sun, wind, fossil fuels, nuclear power, fusion, coal, oil, shale, tar sands, geothermal, hydrogen, solar energy, photovoltaic cells, conservation 2026-06-02T04:00:30.000Z yes A/V Geeks 16mm Films no 720 energy sourcesrenewable energysolar energywind powernuclear fusiongeothermal energyhydrogen fuelbiomass fuelcoal liquefactionshale oiltar sandsconservation1980s technology https://avgeeks.videonest.co/videos/1922308/av-geeks-16mm-lunch-6-3-2026-30f1GQAgq_ https://img.videonest.org/gamma/1922308_thumbnail_resized_v2.webp https://gamma.videonest.org/1922308_original_360.mp4 AV Geeks 16mm Lunch 6-3-2026 Traveling doesn't mean we won't show you some stuff on 16mm film. Here's a bunch of TV commercials to digest. #16mmfilms #avgeeks 2026-06-03T17:00:25.000Z yes A/V Geeks 16mm Films no 3611 vintage commercials16mm filmold commercialsvintage adsTV ads1950s advertising1960s advertising1970s advertising1980s advertisingproduct demonstrationhousehold productsfood commercialsautomotive advertisingvintage advertisingcommercials compilation https://avgeeks.videonest.co/videos/1925772/italy-progress-amidst-the-past-1966-IcWReymjdE https://img.videonest.org/gamma/1925772_thumbnail_resized_v2.webp https://gamma.videonest.org/1925772_original_360.mp4 Italy: Progress Amidst The Past (1966) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film has some serious color fading issues. Modern Italy is a nation of stark contrasts, grappling with significant regional disparities between its industrialized north and agricultural south. While the north, particularly Milan, offers opportunities for young people in commerce and industry, the south faces challenges of poverty, limited fertile land, and a reliance on traditional farming methods. The government is working to address these issues by encouraging industrial development, improving infrastructure, and promoting tourism, which serves as a vital source of income across the country. Despite these challenges, Italians are leveraging their traditions of art and inventiveness to build a more prosperous future, as evidenced by the revitalized cities and growing industries that seek to bridge the economic gap between the regions. Keywords: Italy, North, South, industry, agriculture, poverty, economy, modernization, contrast, tourism, infrastructure, development 2026-06-07T04:00:34.000Z yes A/V Geeks 16mm Films no 1204 ItalyNorth ItalySouth ItalyIndustryAgricultureEconomyModernizationContrastTourismInfrastructureDevelopment1960sEuropean history https://avgeeks.videonest.co/videos/1925773/av-geeks-16mm-lunch-6-5-2026-P_L5wIbLtF https://img.videonest.org/gamma/1925773_thumbnail_resized_v2.webp https://gamma.videonest.org/1925773_original_360.mp4 AV Geeks 16mm Lunch 6-5-2026 Hanging out in Sag Harbor NY and want to watch some films about Long Island! #16mmfilms #avgeeks 2026-06-06T06:14:45.000Z yes A/V Geeks 16mm Films no 4260 Sag HarborLong Island16mm filmswhaling historyvintage footagecommunityindustryhistorical footageDocumentaryArchivesAmerican economyPost-war growthNewspaper industryAmusement ParksConey Island https://avgeeks.videonest.co/videos/1925774/children-of-the-fields-1973-0SfymsQ37v https://img.videonest.org/gamma/1925774_thumbnail_resized_v2.webp https://gamma.videonest.org/1925774_original_360.mp4 Children Of The Fields (1973) This film follows a family navigating the challenges of migrant farm work, focusing on the daily lives of children like Joanne and Nina. The narrative captures moments of schooling, family interactions, and the harsh realities of their transient existence as they prepare for a move to California for seasonal work. The children experience both the joys of play and the anxieties associated with their parents' labor and their uncertain future, all while dealing with the practicalities of finding adequate housing and adapting to new environments. Keywords: migrant labor, farm work, children, education, family, California, housing, transience, seasonal work, daily life 2026-06-06T04:00:38.000Z yes A/V Geeks 16mm Films no 1185 migrant laborfarm workchildrenfamilyCaliforniatransienceseasonal workdaily lifeeducationhousing https://avgeeks.videonest.co/videos/1925775/if-we-lived-on-the-moon-silent-1930s-4D-uGQv4kH https://img.videonest.org/gamma/1925775_thumbnail_resized_v2.webp https://gamma.videonest.org/1925775_original_360.mp4 If We Lived On The Moon (silent, 1930s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The exploration of the Moon reveals its rugged terrain and potential for human settlement, alongside a demonstration of gravitational differences between Earth and the Moon. Aerial imagery and scenes of lunar exploration showcase the desolate landscapes and the vastness of space, highlighting the unique challenges and wonders of living on the Moon. 2026-06-05T04:00:20.000Z yes A/V Geeks 16mm Films no 613 MoonSpaceLunarGravity1930sSilent FilmVintageScienceExplorationAstronomy https://avgeeks.videonest.co/videos/1925776/av-geeks-16mm-lunch-6-4-2026-DlhJfJWtKN https://img.videonest.org/gamma/1925776_thumbnail_resized_v2.webp https://gamma.videonest.org/1925776_original_360.mp4 AV Geeks 16mm Lunch 6-4-2026 Potato chips and snacking instead of lunch!? #16mmfilms #avgeeks 2026-06-04T17:00:06.000Z yes A/V Geeks 16mm Films no 3980 potato chipspsychology experimentoperant conditioningparadevintage footagechild developmentfood productionmanufacturinghealthy eating80s fashioncommunity eventlearningbehavioral psychologyfood preparationmarching band https://avgeeks.videonest.co/videos/1925777/children-of-the-wagon-train-1960-NhHLxWmuP8 https://img.videonest.org/gamma/1925777_thumbnail_resized_v2.webp https://gamma.videonest.org/1925777_original_360.mp4 Children Of The Wagon Train (1960) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film follows the Daniels family as they embark on the arduous 2,000-mile journey along the Oregon Trail from Independence, Missouri, aiming for either the gold fields of California or the farmlands of Oregon. The narrative, seen through the eyes of 14-year-old Jim, details the daily challenges of wagon train life, including harsh weather, scarce resources, sickness, and encounters with Native Americans. The family faces personal tragedies, such as the death of Jim's sister Susan, which deeply impacts his mother. Despite the hardships and the constant threat of the unknown, the journey instills a sense of community and determination among the settlers, who press westward with hopes for a better future. Keywords: Oregon Trail, wagon train, pioneers, westward expansion, California Gold Rush, frontier, hardship, family, journey, settlers, Native Americans, survival, democracy, freedom. 2026-06-04T04:00:00.000Z yes A/V Geeks 16mm Films no 1135 Oregon TrailWagon trainPioneersWestward expansionCalifornia Gold RushFrontierHardshipFamilyJourneySettlersNative AmericansSurvivalDemocracyFreedom https://avgeeks.videonest.co/videos/1926125/animals-of-asia-1980-O35Ofli46D https://img.videonest.org/gamma/1926125_thumbnail_resized_v2.webp https://gamma.videonest.org/1926125_original_360.mp4 Animals Of Asia (1980) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary explores the diverse wildlife of Southeast Asia, highlighting its unique inhabitants and their adaptations to the tropical environment. The film showcases arboreal apes like gibbons and langurs, ground-dwelling macaques, and nocturnal lorises. It also features fascinating creatures such as the armored pangolin, the hunting monitor lizard, and the diminutive mouse deer. The video further details jungle fowl, hornbills, fruit bats, and even flying lizards and snakes that have evolved unique methods of locomotion. Larger animals like spotted deer, tigers, gaur, rhinoceros, and elephants are presented, along with specialized aquatic life like the mudskipper and the distinct proboscis monkey. Finally, the film touches upon the critically endangered orangutans, emphasizing the beauty and wonder of Asia's animal kingdom. Keywords: Southeast Asia, wildlife, apes, gibbons, langurs, macaques, lorises, pangolin, monitor lizard, mouse deer, jungle fowl, hornbill, fruit bats, flying lizard, flying snake, flying lemur, spotted deer, tiger, sarus cranes, gaur, rhinoceros, elephants, mudskipper, proboscis monkey, orangutan, tropical climate, arboreal, nocturnal, camouflage, adaptation, biodiversity 2026-06-08T04:00:20.000Z yes A/V Geeks 16mm Films no 974 Southeast Asia wildlifeAsian animalsPrimateGibbonTigerElephantPangolinMonitor lizardMouse deerOrangutanTropical animalsZoology https://avgeeks.videonest.co/videos/1930380/av-geeks-16mm-lunch-6-9-2026-w2dL1nQThc https://img.videonest.org/gamma/1930380_thumbnail_resized_v2.webp https://gamma.videonest.org/1930380_original_360.mp4 AV Geeks 16mm Lunch 6-9-2026 Back at the archive where stacks and stacks of 16mm films are begging to be screened! #16mmfilms #avgeeks 2026-06-10T06:11:55.000Z yes A/V Geeks 16mm Films no 3693 16mm filmvintage filmsmilitary historyroad safetyhealth awarenesschildrenautomotiveWorld War IIhypertensionfilm archivingAV Geekseducationlifestyledocumentarytechnology https://avgeeks.videonest.co/videos/1930381/chroniques-de-france-118-3-french-1970s-upgf2W3t-n https://img.videonest.org/gamma/1930381_thumbnail_resized_v2.webp https://gamma.videonest.org/1930381_original_360.mp4 Chroniques De France 118-3 (French, 1970s) Maurice Jobert was a multi-talented individual who was deeply involved in the cultural and political landscape of his time. A conductor, film musician, Front Populaire supporter, and critic, he was also a lawyer and a Catholic antifascist. Jobert saw sound film as a revolutionary opportunity for composers, advocating for popular music that enriched visual impressions rather than merely explaining them. He believed film music should be sensitive to the precise moment an image needs poetic extension, and that its sonic nature should take precedence over intellectual or metaphysical qualities. His significant output included numerous film scores, stage music, ballets, and concert works, with his film themes becoming iconic to pre-war French cinema. Jobert's dedication to the art form contributed to the prestige and integrity of French filmmaking. Keywords: Maurice Jobert, film music, conductor, composer, sound film, popular music, French cinema, 1930s, Front Populaire, Catholic antifascist 2026-06-09T04:00:21.000Z yes A/V Geeks 16mm Films no 846 Maurice Jaubertfilm musicconductorcomposersound filmpopular musicFrench cinema1930sFront PopulaireCatholic antifascist https://avgeeks.videonest.co/videos/1930382/av-geeks-16mm-lunch-6-8-2026-GdZQhCrrDJ https://img.videonest.org/gamma/1930382_thumbnail_resized_v2.webp https://gamma.videonest.org/1930382_original_360.mp4 AV Geeks 16mm Lunch 6-8-2026 Skip's just waking up but wants to make sure we have a 16mm streaming show for you to watch! #avgeeks #16mmfilms 2026-06-08T17:00:06.000Z yes A/V Geeks 16mm Films no 4250 vintage commercials16mm filmold advertisementsretro adsTexacoAlpha-BitsVicksHardee'sCrest toothpastefood commercialsproduct promotionvintage advertisingbreakfast cerealgasolinecoffee https://avgeeks.videonest.co/videos/1940457/av-geeks-16mm-lunch-6-10-2026-9nhcAsYG1w https://img.videonest.org/gamma/1940457_thumbnail_resized_v2.webp https://gamma.videonest.org/1940457_original_360.mp4 AV Geeks 16mm Lunch 6-10-2026 I'm an A/V Geek. Watching old 16mm films, is what I do. #16mmfilms #avgeeks 2026-06-11T06:26:20.000Z yes A/V Geeks 16mm Films no 4362 https://avgeeks.videonest.co/videos/1940458/reading-directions-on-maps-silent-filmstrip-C82Tf5zknq https://img.videonest.org/gamma/1940458_thumbnail_resized_v2.webp https://gamma.videonest.org/1940458_original_360.mp4 Reading Directions On Maps (silent, filmstrip) Read along! 2026-06-11T04:00:30.000Z yes A/V Geeks 16mm Films no 400 https://avgeeks.videonest.co/videos/1940459/animals-of-north-america-1979-HfsCeRPUc6 https://img.videonest.org/gamma/1940459_thumbnail_resized_v2.webp https://gamma.videonest.org/1940459_original_360.mp4 Animals Of North America (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary explores the diverse wildlife of North America, introducing viewers to a variety of fascinating creatures that inhabit the continent. From the majestic bison, once numbering in the millions, to the industrious beaver building dams and the intelligent crow, the film highlights the unique adaptations and behaviors of these animals. It showcases plains dwellers like prairie dogs and pronghorns, large mammals such as elk and moose, and predatory animals like wolves and bears. The program also touches upon smaller creatures, including skunks, opossums, bats, and various birds like geese and hummingbirds, as well as reptiles and amphibians like snakes, toads, and turtles, ultimately emphasizing the rich tapestry of life and encouraging viewers to appreciate and learn about the wild neighbors in their own areas. Keywords: North America, wildlife, bison, prairie dog, pronghorn, elk, moose, wolf, bear, mountain lion, bobcat, skunk, opossum, beaver, bat, goose, heron, hummingbird, songbird, crow, snake, rattlesnake, toad, frog, amphibian, reptile, turtle. 2026-06-10T21:03:12.000Z yes A/V Geeks 16mm Films no 859 https://avgeeks.videonest.co/videos/1940963/av-geeks-16mm-lunch-6-11-2026-6sTOrO478V https://img.videonest.org/gamma/1940963_thumbnail_resized_v2.webp https://gamma.videonest.org/1940963_original_360.mp4 AV Geeks 16mm Lunch 6-11-2026 oof.. it's hot outside, we're going to stay cool inside in the dark with 16mm films. #16mmfilms #avgeeks 2026-06-10T20:32:15.000Z yes A/V Geeks 16mm Films no 3867 educational filmnutritionvintage filmchildrenfeminism16mm filmsarchivesnumber recognitionhealthy eatingsocial commentarydocumentaryhistoryactivism Louise Weiss4-H https://avgeeks.videonest.co/videos/1942031/servicing-the-1949-passenger-car-steering-gear-sil-vwwwchbrzK https://img.videonest.org/gamma/1942031_thumbnail_resized_v2.webp https://gamma.videonest.org/1942031_original_360.mp4 Servicing The 1949 Passenger Car Steering Gear (silent, filmstrip) Made by Jam Handy for General Motors' mechanics. Read along! 2026-06-12T04:00:16.000Z yes A/V Geeks 16mm Films no 478 Chevrolet steering1949 ChevroletSteering gear serviceAutomotive repairClassic car maintenanceJam Handy filmGeneral MotorsSteering adjustmentCar repairVehicle maintenance https://avgeeks.videonest.co/videos/1943797/av-geeks-16mm-lunch-6-12-2026-ndPvVHjEea https://img.videonest.org/gamma/1943797_thumbnail_resized_v2.webp https://gamma.videonest.org/1943797_original_360.mp4 AV Geeks 16mm Lunch 6-12-2026 The end of the work week means nothing if you watch 16mm films all the time! #16mmfilms #avgeeks 2026-06-13T07:10:35.000Z yes A/V Geeks 16mm Films no 4102 16mm filmvintage filmPariskittenearly childhood educationtrain travelsocial gatheringchild developmenthistoricalstreet scenenursery schoolplayeducationtraveloguevintage https://avgeeks.videonest.co/videos/1943798/animals-of-australia-1979-fe9bQFbpy8 https://img.videonest.org/gamma/1943798_thumbnail_resized_v2.webp https://gamma.videonest.org/1943798_original_360.mp4 Animals Of Australia (1979) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This documentary explores the diverse wildlife of Australia, moving beyond the iconic kangaroo to showcase the country's unique fauna. It highlights various bird species like parrots, emus, and the remarkable malleefowl with its temperature-controlled nesting mounds. The film delves into the life cycle of marsupials, from the birth of a tiny kangaroo joey to its growth and independence. It also introduces other fascinating creatures such as echidnas, platypuses, wombats, gliders, and rainforest inhabitants. Finally, it touches upon Australia's coastal and marine life, including penguins and the Great Barrier Reef, emphasizing the interconnectedness of its animal communities. Keywords: Australia, wildlife, marsupials, kangaroos, emus, parrots, malleefowl, echidnas, platypus, Great Barrier Reef, unique animals, biodiversity. 2026-06-13T04:00:02.000Z yes A/V Geeks 16mm Films no 1119 AustraliawildlifeanimalsfaunakangaroosparrotsemusmalleefowlechidnasplatypuswombatsGreat Barrier Reefbiodiversity https://avgeeks.videonest.co/videos/1944788/nomads-of-the-jungle-malaya-1948-mi_4H6u_LI https://img.videonest.org/gamma/1944788_thumbnail_resized_v2.webp https://gamma.videonest.org/1944788_original_360.mp4 Nomads of the Jungle - Malaya (1948) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film depicts the life of a nomadic family in the Malay Peninsula's rainforest. The narrative follows the son of the chief as he learns about his people's traditions, including hunting, gathering, building shelters from natural materials like bamboo and palm leaves, and fishing. The family utilizes the jungle's resources extensively, from food and water to crafting tools and transporting goods. The story highlights their journey to a trading post to exchange jungle products for essential items from the outside world, emphasizing community, hard work, and respect for their environment and elders. Keywords: Rainforest, Nomads, Indigenous people, Malay Peninsula, Hunting, Gathering, Traditional life, Bamboo, Palm leaves, Trading post, Family, Culture, Survival. 2026-06-15T04:00:25.000Z yes A/V Geeks 16mm Films no 1257 https://avgeeks.videonest.co/videos/1944789/a-different-way-1953-6BOstDhWOP https://img.videonest.org/gamma/1944789_thumbnail_resized_v2.webp https://gamma.videonest.org/1944789_original_360.mp4 A Different Way (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. 2026-06-14T16:00:04.000Z yes A/V Geeks 16mm Films no 1712 LutheranChurchSynod1950sMid-centuryVintage film16mm filmReligiousLifeFamily https://avgeeks.videonest.co/videos/1946444/av-geeks-16mm-lunch-6-17-2026-gPku8vtvjK https://img.videonest.org/gamma/1946444_thumbnail_resized_v2.webp https://gamma.videonest.org/1946444_original_360.mp4 AV Geeks 16mm Lunch 6-17-2026 We are all eating lunch and watching films over here! Join us for the fun! #16mmfilms #avgeeks 2026-06-17T15:47:27.000Z yes A/V Geeks 16mm Films no 4974 https://avgeeks.videonest.co/videos/1946445/av-geeks-16mm-lunch-6-16-2026-9BRPn_pp9Q https://img.videonest.org/gamma/1946445_thumbnail_resized_v2.webp https://gamma.videonest.org/1946445_original_360.mp4 AV Geeks 16mm Lunch 6-16-2026 So many films just showed up! Our front room is filled with new stuff to watch! Join us! #16mmfilms #avgeeks 2026-06-17T06:16:08.000Z yes A/V Geeks 16mm Films no 4511 https://avgeeks.videonest.co/videos/1946446/the-sleep-of-babies-1970-HxAQFiuX2Y https://img.videonest.org/gamma/1946446_thumbnail_resized_v2.webp https://gamma.videonest.org/1946446_original_360.mp4 The Sleep of Babies (1970) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film introduces the concept that newborn sleep is not a single, unchanging state, but rather consists of two distinct types: active sleep and quiet sleep. Researchers are studying infant sleep because the organization of sleep patterns and specific behaviors during sleep can indicate rapid maturational changes and predict future learning and perception. The film details the characteristics of each sleep type, including observable behaviors like facial movements, body movements, vocalizations, and physiological indicators like respiration and brain electrical activity (EEG). Methods for recording and analyzing these behaviors, such as behavioral coding, slow-motion and time-lapse filming, and cumulative recordings of eye movements, are presented. These techniques allow for a deeper understanding of sleep organization and provide insights into infant development. Keywords: Newborn sleep, active sleep, quiet sleep, sleep-wake cycles, infant development, behavioral observation, physiological recording, electroencephalogram (EEG), rapid eye movements (REM), spontaneous motor discharge (SMD), maturational changes. 2026-06-17T04:00:22.000Z yes A/V Geeks 16mm Films no 1569 Newborn sleepInfant sleepActive sleepQuiet sleepSleep cyclesInfant developmentBehavioral observationPhysiological recordingEEGREM sleepMaturation https://avgeeks.videonest.co/videos/1946447/av-geeks-16mm-lunch-6-15-2026-PTOKfVmr0k https://img.videonest.org/gamma/1946447_thumbnail_resized_v2.webp https://gamma.videonest.org/1946447_original_360.mp4 AV Geeks 16mm Lunch 6-15-2026 Starting the week by watching some vintage 16mm films! #16mmfilms #avgeeks 2026-06-16T06:16:41.000Z yes A/V Geeks 16mm Films no 3996 16mm filmvintage filmtelephonyunderwater cablecommunicationsengineeringsciencephysicseducationtechnologyfaithChristianityatomic energysubmarine cablecable laying https://avgeeks.videonest.co/videos/1946448/the-gift-silent-b-roll-1960s-voqsFi8JMO https://img.videonest.org/gamma/1946448_thumbnail_resized_v2.webp https://gamma.videonest.org/1946448_original_360.mp4 The Gift (silent, B-roll, 1960s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The University of Pittsburgh in the 1960s is the subject of this institutional promotional film, which blends scenes of everyday student life — dorm routines, students laughing and walking past landmarks like the Cathedral of Learning and Litchfield Towers — with an emphasis on the university's academic prestige and rapid growth. After an opening that positions Pitt among other notable American colleges, the film showcases its scientific stature through research facilities like the Cyclotron Laboratory and Space Research Coordination Center, extensive lab and lecture footage, and active construction sites documenting new buildings rising across campus. It also highlights the university's cultural and artistic side (ornate painted ceilings, stained glass, imported Italian stonework, and rare library books), its medical school and hospital, athletics at Trees Hall, and its scientific legacy — including the Virus Research Lab and Salk Hall, a nod to Jonas Salk's polio vaccine work — before closing on students socializing and people gathered on the Cathedral of Learning's balcony, leaving an impression of Pitt as a thriving institution that unites tradition, research, culture, and community. 2026-06-16T04:00:05.000Z yes A/V Geeks 16mm Films no 1271 University of Pittsburgh1960sstudent lifecampusacademic prestigeresearchcyclotronspace researchculturemedicineathleticsvintage footageb-roll https://avgeeks.videonest.co/videos/1948329/to-keep-it-you-have-to-give-it-away-reel-3-1970s-hi0veRngqG https://img.videonest.org/gamma/1948329_thumbnail_resized_v2.webp https://gamma.videonest.org/1948329_original_360.mp4 To Keep it You Have to Give it Away (Reel 3, 1970s) Reel three from a film explores rehabilitation programs for drug addicts, focusing on two key approaches: spiritual guidance through the Assembly of God and a more holistic, community-based model called Cinanon. The Assembly of God's Pittsburgh Challenge facility offers a live-in program emphasizing Bible study, chapel, and guidance, with residents sharing testimonies of finding hope and recovery through faith as a last resort. Cinanon, founded by Chuck Dietrich, operates as a commune and rehabilitation center, emphasizing radical lifestyle changes, personal responsibility, and a unique program called the "Synanon game" designed to foster open communication and self-examination. The film highlights the successes of both programs in helping individuals overcome addiction and rebuild their lives, while also touching on the unconventional nature of Cinanon and the community's efforts to sustain itself through donations and various enterprises, including an integrated school system. Keywords: drug addiction, rehabilitation, spiritual guidance, faith-based, community living, lifestyle change, self-help, personal responsibility, recovery, addiction treatment, halfway house, commune, Synanon, Assembly of God, testimony 2026-06-18T04:00:39.000Z yes A/V Geeks 16mm Films no 1109 drug addictionrehabilitationaddiction treatmentspiritual guidancefaith-basedcommunity livinglifestyle changeself-helprecoverySynanonAssembly of Godtestimony1970s https://avgeeks.videonest.co/videos/1948689/av-geeks-16mm-lunch-6-18-2026-F08tmtSm9y https://img.videonest.org/gamma/1948689_thumbnail_resized_v2.webp https://gamma.videonest.org/1948689_original_360.mp4 AV Geeks 16mm Lunch 6-18-2026 Thursday! 16mm films! Yes! #16mmfilms #avgeeks 2026-06-18T16:58:06.000Z yes A/V Geeks 16mm Films no 4166 16mm filmX-raysVietnam Warmilitary operationsmental healthphysicsmedical imagingpsychiatryscientific discoveryaviationlogisticstherapyhistorical filmradiographychild psychology https://avgeeks.videonest.co/videos/1949140/the-fighting-small-mouth-DVyJE0zLRz https://img.videonest.org/gamma/1949140_thumbnail_resized_v2.webp https://gamma.videonest.org/1949140_original_360.mp4 The Fighting Small-Mouth Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film explores the life cycle and habits of the smallmouth bass, highlighting its tenacity and appeal as a game fish. It details their spawning rituals, where males diligently guard their nests and eggs, and their preferred habitats in clear, fresh waters. The documentary also touches upon the impact of pollution on their survival and concludes with a discussion on effective fishing lures and techniques, featuring an interview with Dr. James Westman of Rutgers University. Keywords: smallmouth bass, spawning, nesting, male guarding, freshwater, clear water, pollution, game fish, fishing lures, conservation, aquatic life, river, lake, courtship, eggs, hatching, fry, predation, angling, habitat, trolling, casting. 2026-06-19T04:00:30.000Z yes A/V Geeks 16mm Films no 840 smallmouth bassspawningnestingfreshwatergame fishfishing luresaquatic liferiverlakeanglinghabitatconservation https://avgeeks.videonest.co/videos/1949496/safety-in-big-truck-operations-1980s-c7Jx3gko-_ https://img.videonest.org/gamma/1949496_thumbnail_resized_v2.webp https://gamma.videonest.org/1949496_original_360.mp4 Safety In Big Truck Operations (1980s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film emphasizes the critical importance of safety when operating large lift trucks, particularly those exceeding 10,000 lbs. It details pre-operation checks, including personal protective equipment, truck maintenance inspections (air filter, coolant, oil, leaks, belts, chains), and understanding the truck's rated capacity. The program also covers safe operating practices such as maintaining visibility, observing traffic rules, controlling speed, using parking brakes, properly handling loads (checking weight and center), and navigating inclines and declines, highlighting balance and stability. Finally, it stresses safe refueling procedures and concludes that a safe operation is an efficient one. Keywords: Lift truck safety, heavy machinery, operator responsibility, pre-operation checks, personal protective equipment, truck maintenance, load capacity, safe driving, inclines, declines, stacking, refueling, accident prevention. 2026-06-19T14:30:31.000Z yes A/V Geeks 16mm Films no 843 lift truck safetyheavy machineryoperator responsibilitypre-operation checksmaintenanceload capacitysafe drivingrefuelingaccident preventionheavy equipment operation https://avgeeks.videonest.co/videos/1950280/the-nation-s-mental-health-1951-SV-_fawr63 https://img.videonest.org/gamma/1950280_thumbnail_resized_v2.webp https://gamma.videonest.org/1950280_original_360.mp4 The Nation's Mental Health (1951) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film highlights the growing concern over mental illness in America, particularly after World War II, when draft figures revealed a significant number of individuals were rejected due to emotional instability. It showcases the establishment of the National Mental Health Act and the creation of the National Institute of Mental Health. The documentary then details the training of mental health professionals, including psychiatrists, psychologists, and psychiatric aides, at institutions like the Menninger Clinic. Various therapeutic approaches are demonstrated, from physical treatments like electric shock and insulin therapy to psychoanalysis, drama therapy, occupational therapy, and art therapy. Finally, it emphasizes the importance of community-level intervention through mental health clinics and public awareness campaigns by organizations like the National Association for Mental Health, underscoring that a healthy mental state is fostered by understanding and cooperation within families and communities. Keywords: mental illness, psychiatry, National Mental Health Act, National Institute of Mental Health, training, therapy, community mental health, prevention, psychoanalysis, drama therapy, occupational therapy 2026-06-20T04:00:36.000Z yes A/V Geeks 16mm Films no 1086 mental illnesspsychiatrymental healththerapypsychoanalysispost-warcommunity healthpublic healthWWIIresearchprevention https://avgeeks.videonest.co/videos/1950931/shyness-1953-mni0p2CWxQ https://img.videonest.org/gamma/1950931_thumbnail_resized_v2.webp https://gamma.videonest.org/1950931_original_360.mp4 Shyness (1953) This film explores the critical role of early childhood development and the impact of parental and educational influences on a child's social and emotional well-being. Through the stories of three children – Anna, who struggles with shyness due to overbearing parental expectations; Jimmy, who exhibits extreme fear due to overprotective parenting; and Robert, who is a happy, independent child – the film highlights how specific upbringing methods can lead to difficulties in social adjustment. It emphasizes that shyness is not an innate trait but a learned behavior that can be overcome with understanding, patience, and opportunities for positive social interaction, ultimately leading to happier and more well-adjusted adults. Keywords: Child psychology, shyness, emotional development, parenting styles, early childhood education, social interaction, self-confidence, overcoming fear, child guidance, peer relationships 2026-06-21T04:00:29.000Z yes A/V Geeks 16mm Films no 1292 https://avgeeks.videonest.co/videos/1951996/spills-and-thrills-1950s-eSFUZLibAu https://img.videonest.org/gamma/1951996_thumbnail_resized_v2.webp https://gamma.videonest.org/1951996_original_360.mp4 Spills and Thrills (1950s) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film showcases thrilling winter sports and aquatic activities. It highlights figure skaters achieving Olympic glory through dedicated practice, speed skaters battling it out on the ice, and daring bobsledders navigating treacherous downhill courses. The film also features the grace of a Canadian figure skating champion and the impressive technical skill of an American competitor. Additionally, it captures the excitement of slalom skiing and downhill racing, emphasizing the speed and danger involved. The narrative then shifts to the warm shores of Waikiki for a look at traditional Hawaiian surfboarding and the challenging sport of outrigger canoeing. Finally, the film concludes with a glimpse of high-speed powerboat racing, featuring a record-breaking run by Sir Malcolm Campbell. Keywords: Winter Olympics, figure skating, speed skating, bobsledding, slalom skiing, downhill skiing, surfboarding, outrigger canoeing, powerboat racing, speed records. 2026-06-22T04:00:21.000Z yes A/V Geeks 16mm Films no 543 figure skatingspeed skatingbobsleddingskiingsurfingcanoeingpowerboat racingwinter sportsaquatic activities1950s https://avgeeks.videonest.co/videos/1952818/people-to-people-this-is-the-life-1953-9uft7yywHD https://img.videonest.org/gamma/1952818_thumbnail_resized_v2.webp https://gamma.videonest.org/1952818_original_360.mp4 People to People - This is the Life (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film tells the story of two families, the Fishers and the Stones, who become neighbors. The initial interactions are strained, particularly between the patriarchs, Mr. Fisher and Mr. Stone, who have differing views on child-rearing and religion. Mr. Stone, an atheist, is resistant to religious upbringing for his children, Bill and Betty, while Mr. Fisher strongly believes in the importance of faith and church. A significant incident occurs when Mr. Stone's son, Pete, gets into trouble for reckless driving and a hit-and-run accident. This event prompts Mr. Stone to re-evaluate his parenting, and with guidance from Mr. Fisher, he begins to understand the importance of early spiritual guidance for his children. The film concludes with a hopeful note, suggesting that with care and attention, much like tending to a rose bush, young people can be guided toward a positive path, and the Stone family starts to embrace a more traditional, faith-based approach to life. Keywords: Family, neighbors, parenting, religion, atheism, child-rearing, community, conflict, reconciliation, spiritual guidance, faith, redemption, rose bush analogy, hit and run, church invitation, moral values. 2026-06-23T04:00:01.000Z yes A/V Geeks 16mm Films no 1766 familyfaithparentingreligionneighborschild upbringingredemptionspiritual guidancehit and runcommunitymoral valuesChristianitylife lessonsfamily valuesLutheran Church https://avgeeks.videonest.co/videos/1954012/material-possession-this-is-the-life-1953-DGwkePPsUY https://img.videonest.org/gamma/1954012_thumbnail_resized_v2.webp https://gamma.videonest.org/1954012_original_360.mp4 Material Possession - This is the Life (1953) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. The film tells the story of Peter, a young boy who is motivated to help save his church's youth director's job by organizing his friends to raise $600 through pledges. Initially, Peter gets caught up in a romantic pursuit with a new girl named Celia, which leads him to neglect his responsibilities and spend money he had pledged. Through a conversation with his grandfather and father, Peter learns a valuable lesson about Christian stewardship and the true meaning of possessions. He realizes his mistake, sells his tuxedo to help cover his pledge, and encourages his friends to fulfill theirs, ultimately ensuring the youth program is saved. Keywords: youth director, fundraising, pledges, church, Christian stewardship, responsibility, money, sacrifice, lesson, community, purpose, God, gift, trust 2026-06-24T04:00:05.000Z yes A/V Geeks 16mm Films no 1723 youth directorfundraisingpledgeschurchstewardshipresponsibilitysacrificeChristiancommunityGodtrustlesson https://avgeeks.videonest.co/videos/1954753/my-broadcast-SS-F6DOmv2 https://img.videonest.org/gamma/1954753_thumbnail_resized_v2.webp https://gamma.videonest.org/1954753_original_360.mp4 My Broadcast 2026-06-24T20:25:54.000Z yes A/V Geeks 16mm Films no 22 CTAChicago TransitRapid TransitTrainSubwayPublic TransportationVintage16mm filmUrbanCity https://avgeeks.videonest.co/videos/1954994/how-to-weld-t-1-steels-1961-bWrU-GfWdv https://img.videonest.org/gamma/1954994_thumbnail_resized_v2.webp https://gamma.videonest.org/1954994_original_360.mp4 How to Weld T-1 Steels (1961) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. This film details the proper welding procedures for USS T1 steel, a high-strength, versatile metal. It emphasizes three key rules: using the correct low-hydrogen electrodes, applying the appropriate welding heat to ensure rapid cooling, and following specific welding techniques. The video explains how to avoid underbead cracking by using low-hydrogen electrodes and keeping them dry, and how to control heat input using a welding heat input calculator to maintain T1 steel's toughness. It also covers preferred welding techniques like stringer beads over weave beads, arc air gouging, and methods to prevent shrinkage cracks in fillet welds, such as using more ductile rods, peening, shrink cushions, or butter welds. Keywords: USS T1 steel, welding, low-hydrogen electrodes, heat input, rapid cooling, cracking, welding techniques, welding heat input calculator, stringer bead, fillet weld, shrinkage cracks 2026-06-25T04:00:19.000Z yes A/V Geeks 16mm Films no 1104 USS T1 steelweldinglow-hydrogen electrodesheat inputrapid coolingcrackingwelding techniquesstringer beadfillet weldshrinkage cracksarc air gougingwelding heat input calculator https://avgeeks.videonest.co/videos/1955804/mr-compliance-inspector-silent-1950s-NpRAEPAoEM https://img.videonest.org/gamma/1955804_thumbnail_resized_v2.webp https://gamma.videonest.org/1955804_original_360.mp4 Mr Compliance Inspector (silent, 1950s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Silent 16mm footage that follows a building compliance inspector through the process of inspecting a residential home construction project. The film opens with ground-clearing and foundation work — workers moving dirt and rubble — then progresses through various stages of construction: close-up inspection of concrete masonry block walls, exposed wood framing, and electrical or plumbing rough-ins visible in the walls and ceiling joists. Throughout the film, the inspector (a suited man with a clipboard and glasses) is shown meeting with on-site supervisors wearing hard hats, reviewing blueprints together both outside and inside the framed structure. As the home nears completion — seen as a finished brick exterior — the inspector makes a final visit to the property, where he meets with the homeowner at the front door, conducts a walk-through of the completed house, and concludes by handing over documentation, presumably a certificate of occupancy or compliance sign-off. The film appears to be a training or public-information piece about the role of the building inspector at each phase of residential construction, from site prep through final approval. 2026-06-26T04:00:18.000Z yes A/V Geeks 16mm Films no 1605 building inspectionconstructionresidentialinspectorhome buildingsite inspectionplumbingelectricalblueprintscertificate of occupancy16mm filmvintage footage https://avgeeks.videonest.co/videos/1956462/how-to-make-a-type-slide-sears-studio-silent-1970s-zFxx6XhFpT https://img.videonest.org/gamma/1956462_thumbnail_resized_v2.webp https://gamma.videonest.org/1956462_original_360.mp4 How to Make a Type Slide Sears Studio (SILENT, 1970s?) Email us at footage@avgeeks.com if you have questions about the footage and are interested in using it in your project. Silent footage. At Sears Studio, a man in a white shirt and glasses works at a desk surrounded by posters featuring "Sears Studio" branding and slogans like "PROUDLY IN PRINT" and "THE END." The production moves through various office and industrial environments where individuals work on graphic design projects, sorting papers, and operating complex machinery. A woman with short blonde hair operates a large industrial machine, while other scenes show men interacting with documents, some of which include "A YEAR-END report" and "Fashion in Trim" graphics. The work involves manual tasks such as using scissors to cut through sheets of paper and placing small items into industrial machines equipped with metal chutes and press arms. The footage transitions from these industrial and office settings to a series of glowing red and white organic structures that resemble branching veins or root systems growing vertically in the dark. The film concludes with these pulsing, biological-looking forms expanding against a dark background. 2026-06-27T04:00:32.000Z yes A/V Geeks 16mm Films no 533 Sears Studiotype slidegraphic design1970sproductionprocessingindustrialofficevintagefilm